2I9IA

Crystal structure of helicobacter pylori protein hp0492
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
221
structure length
221
Chain Sequence
ERMKTSSEHVTPLDFNYPIHIVQAPQNHHVVGILTPRIQVSDNLKPYIDKFQDALINQIQTIFEKRGYQVLRFQDEKALNAQDKRKIFSVLDLKGWVGILEDLKMNLKDPNNPNLDTLVDQSSGSVWFNFYEPESNRVVHDFAVEVGTFQAMTYTYKHNNSGGLNSSNSIIHEYLEKNKEDAIHKILNRMYAVVMKKAVTELTKENIDKYREAIDRMKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
publication title Crystal Structure of Helicobacter pylori hypothetical protein O25234
rcsb
source organism Helicobacter pylori
total genus 79
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2006-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.180 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Putative neuraminyllactose-binding hemagglutinin homolog like domain 2i9iA00
3BGHA 2I9IA
chains in the Genus database with same CATH superfamily
1A1IA 1DI2A 1YYWA 3H09A 2I9IA 4HTGA 2YWQA 5AE3A 1GQEA 1GZ6A 2EQ1A 1MGTA 1YUJA 4J8ZA 2RSIA 2GPIA 3EQ1A 2IHR1 2GLIA 1SFEA 2WBSA 2LV2A 1TF6A 4R2CA 4R03A 2WBUA 1I94E 2YTQA 1ZBTA 4WXDA 2EMWA 2MC5A 4DMIA 3J7Yp 4L5NC 1YPNA 5A2QC 2LBSB 1WRJA 1ZU1A 4NXME 2LMZA 2V83A 1NCSA 4JI6E 2HGHA 1F2IG 4K0KE 3HTXA 3K6QA 4DV6E 1JK1A 2LCEA 3EPKA 4M0VA 2ENHA 3L00A 1N34E 2N8XA 2K4VA 1B69A 5BR8E 2WCC3 4F6NA 2EOYA 1X47A 2EQ0A 3KWRA 1O0WA 1X49A 5A6BA 4LFBE 2YSOA 2EN3A 2EOOA 4F54A 2VF1A 4TUGA 2MKNA 2G7HA 4LFAE 2EZ6A 1STUA 3BIDA 2NABA 1AH5A 1N33E 2EL5A 2RTXA 2EPAA 2RPCA 2EMFA 2YPNA 2EQ3A 4R2RA 5IWAE 2JYAA 3F6GA 3C6MA 4R2SA 2EPOA 1HNZE 4R2QA 4GKJE 4OOGC 2EWLA 3IWCA 2M7QA 2YTDA 1L4SA 2R1FA 2EL4A 5DNYA 2JOXA 3T1HE 2JVAA 2ENCA 4DV4E 1YFHA 1TN9A 2EOIA 4DV5E 2D9HA 2EP3A 4LF6E 5T6JA 1WHQA 2K7IA 2EPLX 4NZVA 2UUBE 4BC7A 3OMLA 4LF5E 3M99B 2E1MA 4BMJA 1A1HA 2LO3A 2EE8A 2RS6A 2YRHA 4DV2E 2CT1A 2HC5A 2FGGA 1EH8A 2EPCA 4P78A 3JAMC 3KZZA 2NUEA 2EOEA 5AE2A 5LMNE 2EN1A 2LJUA 3ZOQB 1RC7A 2ADRA 5A6KA 2I13A 2UUAE 3FIGA 2L3CA 1A1GA 2EN4A 2EN2A 4WX9A 2YRMA 2EOMA 4DUZE 1IBLE 2ENAA 1XNRE 2EPZA 3MHHC 2Q8UA 4MLQA 1P47A 2EMAA 2HJJA 2L2KB 2YSPA 2YTOA 4LTYA 4NHRA 4ZYGA 2EL6A 1JK2A 3ADGA 4WSGA 1RMDA 1IBME 5A6AA 1T4NA 2NA2A 1G2FC 2EPMX 2UUCE 2EM7A 3VYXA 2EM8A 2EPKX 2GHFA 1XMQE 1DGCA 2CPNA 2L3JA 4JYAE 2N3GA 1YSAC 4JI1E 5KL2A 4JI2E 2VQFE 1BBGA 3VK6A 5FLXC 2EN8A 4X9JA 4MLVA 2LJHA 2EMKA 2EJ4A 4Q28A 2JPAA 4DR1E 4DR6E 1ZAAC 4X66E 3LMLA 2EPXA 1KYQA 5KL3A 3J81C 5KL6A 3P1XA 5LL6R 1NEIA 1TF3A 1J5EE 2EMCA 1DQ3A 4WYQB 2R76A 4R2AA 2B3TB 1MEYC 2EMXA 2DMIA 4B3RE 4KHPE 4DR3E 2V88A 3RMPA 3AV0A 1RQ0A 4DR2E 1UHZA 2LTRA 4LF9E 2EMIA 2KONA 2YZTA 2LUQA 1G2DC 4Q35B 2EM9A 5A69A 4AQYE 3THNA 1Z1BA 2EM6A 2EN7A 3VYYA 2DB2A 1YYKA 4JI8E 1UILA 3F6HA 4BS9A 1PDAA 2EPPA 3AUZA 2YTEA 2DLKA 2EOJA 1PJTA 2M9AA 2MC6A 1T4LB 4X62E 2A25A 1X5WA 4WXCA 2YU5A 2EM2A 1HNXE 2EOXA 2LTSA 1BBOA 1HR0E 1IBKE 2YU8A 4M2ZA 2EM5A 2VE7C 4ZYDA 3C6KA 2F8BA 2EOZA 4ZYEA 2PRTA 2EN6A 3MSWA 1X6FA 4DV1E 1IMUA 1X6EA 5AC5A 4DR7E 2L6MA 3BBGA 4GZNC 3TQMA 3DF6A 2YRKA 4GKKE 2E72A 1X6HA 2YTNA 2B9DA 1QU6A 3JU0A 2EMZA 4DV0E 2YTPA 5TSEA 4JI3E 4IS1C 2EMLA 4LF8E 5ADZA 4JI4E 2EOQA 5KL5A 1X48A 2ODRD 2YTJA 2MKDA 1IQOA 4GEQB 4R2EA 3J80C 3OTOE 5KL4A 1FKAE 1N36E 2LUPB 2EMYA 4R8OA 2EOSA 2KHXA 4JI7E 2EMBA 1PKPA 2L33A 3EPJA 2HHHE 3EPHA 2CSHA 3LLHA 3HQ1A 4JI0E 4O5GA 2EOHA 3BGHA 2UXBE 1A1JA 2M4IA 1T4OA 4DR5E 4BHBA 3HPSA 1EH6A 2L8TA 2ODRC 2EORA 4TUIA 2L2MA 3HPZA 4F9AB 2JXPA 4M9VC 1LLMC 2JOBA 5LMUE 4F9BB 2ELYA 4LFCE 1EH7A 1BB8A 1PJQA 4BHCA 4L8NA 4R2PA 2WZOA 4O43A 2VQEE 1GTKA 4F2JC 4JV5E 2B7TA 4HEIA 4B3TE 1N32E 1WHNA 2FV4B 4OX9E 5AASA 1ZBQA 2EPRA 4B3ME 2DLQA 4KZSA 2UXCE 4FK5C 2EMGA 2CTDA 2H36X 4BBYA 4BC9A 1WJPA 2LVHA 1XMOE 1A1FA 5A6BD 4ZYHA 2UXDE 3DJWA 4LF7E 2N3HA 5IV8B 2LE2A 2EM4A 1A1LA 2V89A 2ZM6E 2V87A 4I8OA 2RQLA 4B3SE 4YY3E 2EM0A 3EPLA 1UN6B 2YTIA 5F3WA 1A1KA 2KOUA 2NUGA 4N4RB 1ZR9A 2DIXA 2J7JA 2YT4A 4R2DA 1T38A 1AAYA 2UU9E 2DGCA 4O4KA 1UBDC 3THOB 5KL7A 4WFTA 3JTZA 3KZYA 2YTGA 4JI5E 2DSYA 4WSPA 3QG5C 2DMYA 2EM3A 1XNQE 5CFFE 2WBTA 5IT9C 2RSMA 3J7AG 1IQSA 3VHTB 2L2NA 4KWYA 1YUIA 4YHHE 1J26A 1SR9A 2JWOA 3T1YE 3IWBA 2YTFA 3HXLA 4X64E 2EOFA 2LT7A 5A6JA 4LF4E 3C4BA 1X3CA 1KJKA 2ELZA 4X65E 1FJGE 2BB8A 3UK3C 2JY9A 2VRDA 5AC4A 4X8WA 1WXRA 2FTXB 4WPYA 2F4VE 5LLQA 2RS7A 2JR1A 2EPUA 3C4TA 4NXNE 1HNWE 2BBGA 1N3GA 2E5LE 4RH8A 1EKZA 1QNTA 3MHSC 1PJSA 4F9CB 4RHBB 2JP9A 3IWDA 2B7VA 2LRSA 1YZ9A 5AE1A 3BF2A 4DV3E 2V8QB 1YYOA 2MDRA 4DV7E 2EPNA 4BCAA 2MDGA 2L92A 2M1SA 2EMHA 4DKKA 1T39A 3ADLA 4F6MA 3ADIA 4DR4E 2V86A 2V85A 4LU9A 4IJDA 4M30A 4DUYE 5IXMB 2NUFA 4P7DA 3ECRA 3ADJA 4O24A 2DRPA
chains in the Genus database with same CATH topology
3BGHA 2I9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BGH A;  2I9I A; 
#chains in the Genus database with same CATH topology
 1A1I A;  1DI2 A;  1YYW A;  3H09 A;  2I9I A;  4HTG A;  2YWQ A;  5AE3 A;  1GQE A;  1GZ6 A;  2EQ1 A;  1MGT A;  1YUJ A;  4J8Z A;  2RSI A;  2GPI A;  3EQ1 A;  2IHR 1;  2GLI A;  1SFE A;  2WBS A;  2LV2 A;  1TF6 A;  4R2C A;  4R03 A;  2WBU A;  1I94 E;  2YTQ A;  1ZBT A;  4WXD A;  2EMW A;  2MC5 A;  4DMI A;  3J7Y p;  4L5N C;  1YPN A;  5A2Q C;  2LBS B;  1WRJ A;  1ZU1 A;  4NXM E;  2LMZ A;  2V83 A;  1NCS A;  4JI6 E;  2HGH A;  1F2I G;  4K0K E;  3HTX A;  3K6Q A;  4DV6 E;  1JK1 A;  2LCE A;  3EPK A;  4M0V A;  2ENH A;  3L00 A;  1N34 E;  2N8X A;  2K4V A;  1B69 A;  5BR8 E;  2WCC 3;  4F6N A;  2EOY A;  1X47 A;  2EQ0 A;  3KWR A;  1O0W A;  1X49 A;  5A6B A;  4LFB E;  2YSO A;  2EN3 A;  2EOO A;  4F54 A;  2VF1 A;  4TUG A;  2MKN A;  2G7H A;  4LFA E;  2EZ6 A;  1STU A;  3BID A;  2NAB A;  1AH5 A;  1N33 E;  2EL5 A;  2RTX A;  2EPA A;  2RPC A;  2EMF A;  2YPN A;  2EQ3 A;  4R2R A;  5IWA E;  2JYA A;  3F6G A;  3C6M A;  4R2S A;  2EPO A;  1HNZ E;  4R2Q A;  4GKJ E;  4OOG C;  2EWL A;  3IWC A;  2M7Q A;  2YTD A;  1L4S A;  2R1F A;  2EL4 A;  5DNY A;  2JOX A;  3T1H E;  2JVA A;  2ENC A;  4DV4 E;  1YFH A;  1TN9 A;  2EOI A;  4DV5 E;  2D9H A;  2EP3 A;  4LF6 E;  5T6J A;  1WHQ A;  2K7I A;  2EPL X;  4NZV A;  2UUB E;  4BC7 A;  3OML A;  4LF5 E;  3M99 B;  2E1M A;  4BMJ A;  1A1H A;  2LO3 A;  2EE8 A;  2RS6 A;  2YRH A;  4DV2 E;  2CT1 A;  2HC5 A;  2FGG A;  1EH8 A;  2EPC A;  4P78 A;  3JAM C;  3KZZ A;  2NUE A;  2EOE A;  5AE2 A;  5LMN E;  2EN1 A;  2LJU A;  3ZOQ B;  1RC7 A;  2ADR A;  5A6K A;  2I13 A;  2UUA E;  3FIG A;  2L3C A;  1A1G A;  2EN4 A;  2EN2 A;  4WX9 A;  2YRM A;  2EOM A;  4DUZ E;  1IBL E;  2ENA A;  1XNR E;  2EPZ A;  3MHH C;  2Q8U A;  4MLQ A;  1P47 A;  2EMA A;  2HJJ A;  2L2K B;  2YSP A;  2YTO A;  4LTY A;  4NHR A;  4ZYG A;  2EL6 A;  1JK2 A;  3ADG A;  4WSG A;  1RMD A;  1IBM E;  5A6A A;  1T4N A;  2NA2 A;  1G2F C;  2EPM X;  2UUC E;  2EM7 A;  3VYX A;  2EM8 A;  2EPK X;  2GHF A;  1XMQ E;  1DGC A;  2CPN A;  2L3J A;  4JYA E;  2N3G A;  1YSA C;  4JI1 E;  5KL2 A;  4JI2 E;  2VQF E;  1BBG A;  3VK6 A;  5FLX C;  2EN8 A;  4X9J A;  4MLV A;  2LJH A;  2EMK A;  2EJ4 A;  4Q28 A;  2JPA A;  4DR1 E;  4DR6 E;  1ZAA C;  4X66 E;  3LML A;  2EPX A;  1KYQ A;  5KL3 A;  3J81 C;  5KL6 A;  3P1X A;  5LL6 R;  1NEI A;  1TF3 A;  1J5E E;  2EMC A;  1DQ3 A;  4WYQ B;  2R76 A;  4R2A A;  2B3T B;  1MEY C;  2EMX A;  2DMI A;  4B3R E;  4KHP E;  4DR3 E;  2V88 A;  3RMP A;  3AV0 A;  1RQ0 A;  4DR2 E;  1UHZ A;  2LTR A;  4LF9 E;  2EMI A;  2KON A;  2YZT A;  2LUQ A;  1G2D C;  4Q35 B;  2EM9 A;  5A69 A;  4AQY E;  3THN A;  1Z1B A;  2EM6 A;  2EN7 A;  3VYY A;  2DB2 A;  1YYK A;  4JI8 E;  1UIL A;  3F6H A;  4BS9 A;  1PDA A;  2EPP A;  3AUZ A;  2YTE A;  2DLK A;  2EOJ A;  1PJT A;  2M9A A;  2MC6 A;  1T4L B;  4X62 E;  2A25 A;  1X5W A;  4WXC A;  2YU5 A;  2EM2 A;  1HNX E;  2EOX A;  2LTS A;  1BBO A;  1HR0 E;  1IBK E;  2YU8 A;  4M2Z A;  2EM5 A;  2VE7 C;  4ZYD A;  3C6K A;  2F8B A;  2EOZ A;  4ZYE A;  2PRT A;  2EN6 A;  3MSW A;  1X6F A;  4DV1 E;  1IMU A;  1X6E A;  5AC5 A;  4DR7 E;  2L6M A;  3BBG A;  4GZN C;  3TQM A;  3DF6 A;  2YRK A;  4GKK E;  2E72 A;  1X6H A;  2YTN A;  2B9D A;  1QU6 A;  3JU0 A;  2EMZ A;  4DV0 E;  2YTP A;  5TSE A;  4JI3 E;  4IS1 C;  2EML A;  4LF8 E;  5ADZ A;  4JI4 E;  2EOQ A;  5KL5 A;  1X48 A;  2ODR D;  2YTJ A;  2MKD A;  1IQO A;  4GEQ B;  4R2E A;  3J80 C;  3OTO E;  5KL4 A;  1FKA E;  1N36 E;  2LUP B;  2EMY A;  4R8O A;  2EOS A;  2KHX A;  4JI7 E;  2EMB A;  1PKP A;  2L33 A;  3EPJ A;  2HHH E;  3EPH A;  2CSH A;  3LLH A;  3HQ1 A;  4JI0 E;  4O5G A;  2EOH A;  3BGH A;  2UXB E;  1A1J A;  2M4I A;  1T4O A;  4DR5 E;  4BHB A;  3HPS A;  1EH6 A;  2L8T A;  2ODR C;  2EOR A;  4TUI A;  2L2M A;  3HPZ A;  4F9A B;  2JXP A;  4M9V C;  1LLM C;  2JOB A;  5LMU E;  4F9B B;  2ELY A;  4LFC E;  1EH7 A;  1BB8 A;  1PJQ A;  4BHC A;  4L8N A;  4R2P A;  2WZO A;  4O43 A;  2VQE E;  1GTK A;  4F2J C;  4JV5 E;  2B7T A;  4HEI A;  4B3T E;  1N32 E;  1WHN A;  2FV4 B;  4OX9 E;  5AAS A;  1ZBQ A;  2EPR A;  4B3M E;  2DLQ A;  4KZS A;  2UXC E;  4FK5 C;  2EMG A;  2CTD A;  2H36 X;  4BBY A;  4BC9 A;  1WJP A;  2LVH A;  1XMO E;  1A1F A;  5A6B D;  4ZYH A;  2UXD E;  3DJW A;  4LF7 E;  2N3H A;  5IV8 B;  2LE2 A;  2EM4 A;  1A1L A;  2V89 A;  2ZM6 E;  2V87 A;  4I8O A;  2RQL A;  4B3S E;  4YY3 E;  2EM0 A;  3EPL A;  1UN6 B;  2YTI A;  5F3W A;  1A1K A;  2KOU A;  2NUG A;  4N4R B;  1ZR9 A;  2DIX A;  2J7J A;  2YT4 A;  4R2D A;  1T38 A;  1AAY A;  2UU9 E;  2DGC A;  4O4K A;  1UBD C;  3THO B;  5KL7 A;  4WFT A;  3JTZ A;  3KZY A;  2YTG A;  4JI5 E;  2DSY A;  4WSP A;  3QG5 C;  2DMY A;  2EM3 A;  1XNQ E;  5CFF E;  2WBT A;  5IT9 C;  2RSM A;  3J7A G;  1IQS A;  3VHT B;  2L2N A;  4KWY A;  1YUI A;  4YHH E;  1J26 A;  1SR9 A;  2JWO A;  3T1Y E;  3IWB A;  2YTF A;  3HXL A;  4X64 E;  2EOF A;  2LT7 A;  5A6J A;  4LF4 E;  3C4B A;  1X3C A;  1KJK A;  2ELZ A;  4X65 E;  1FJG E;  2BB8 A;  3UK3 C;  2JY9 A;  2VRD A;  5AC4 A;  4X8W A;  1WXR A;  2FTX B;  4WPY A;  2F4V E;  5LLQ A;  2RS7 A;  2JR1 A;  2EPU A;  3C4T A;  4NXN E;  1HNW E;  2BBG A;  1N3G A;  2E5L E;  4RH8 A;  1EKZ A;  1QNT A;  3MHS C;  1PJS A;  4F9C B;  4RHB B;  2JP9 A;  3IWD A;  2B7V A;  2LRS A;  1YZ9 A;  5AE1 A;  3BF2 A;  4DV3 E;  2V8Q B;  1YYO A;  2MDR A;  4DV7 E;  2EPN A;  4BCA A;  2MDG A;  2L92 A;  2M1S A;  2EMH A;  4DKK A;  1T39 A;  3ADL A;  4F6M A;  3ADI A;  4DR4 E;  2V86 A;  2V85 A;  4LU9 A;  4IJD A;  4M30 A;  4DUY E;  5IXM B;  2NUF A;  4P7D A;  3ECR A;  3ADJ A;  4O24 A;  2DRP A; 
#chains in the Genus database with same CATH homology
 3BGH A;  2I9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...