2M1SA

Nmr assignment of the arenaviral protein z from lassa fever virus
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
99
structure length
99
Chain Sequence
MGNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAAPTAPPTGAADSIRPPPYSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RING finger protein Z
publication title Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E
pubmed doi rcsb
source organism Lassa virus josiah
total genus 5
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03854 zf-P11 P-11 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.310 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m1sA01
2M1SA
chains in the Genus database with same CATH superfamily
2EOQA 3DF6A 4X8WA 4B3ME 2L2MA 2M4IA 2EL5A 2NUEA 4R2DA 1GTKA 4WXCA 1BBGA 2UUAE 1X47A 3VK6A 2DLQA 3HQ1A 3M99B 2EMYA 3MSWA 5AE2A 2EMBA 5BR8E 4LF5E 4F9BB 2EPMX 3L00A 2LUQA 2MKDA 1XNQE 4R2QA 1WRJA 4B3RE 2B3TB 4ZYEA 3DJWA 4RHBB 3VHTB 2EPCA 2EMZA 1ZBTA 3HPZA 2GHFA 1XMQE 5KL7A 4OX9E 4AQYE 2MDGA 2L8TA 1PJTA 4GKJE 4DV5E 2YTNA 2EM4A 2YTJA 5AC4A 2EMAA 2IHR1 2EQ3A 2EMFA 5A2QC 5IV8B 2L2KB 2EMHA 4P7DA 4WXDA 2EN2A 3BIDA 4R2AA 3C6KA 5LMNE 2CPNA 3TQMA 3HTXA 2EWLA 2YRHA 1RQ0A 4DV2E 2PRTA 4JI3E 2EMLA 2EM9A 2L3JA 4BC9A 1X3CA 1FJGE 4WYQB 3EPHA 2ELYA 1DQ3A 3RMPA 2EPNA 2YSOA 2EM6A 4BBYA 2EOXA 2VE7C 2YWQA 2E72A 2YTOA 1YUJA 1T4NA 2YTPA 5IT9C 3BF2A 2LT7A 4DMIA 1KYQA 3J80C 2VRDA 3AUZA 1IBLE 2YRKA 1G2FC 1G2DC 2CTDA 2G7HA 4DR1E 4M9VC 3JU0A 2RSIA 4WSPA 1T4LB 2B9DA 2JOBA 2N3GA 3JAMC 2NA2A 5LLQA 2UUBE 4BC7A 2KONA 2LCEA 4DR6E 4ZYDA 1NCSA 1QU6A 2RSMA 4L5NC 3OTOE 4N4RB 2EOIA 4HEIA 5TSEA 1TN9A 2J7JA 2ADRA 4DUZE 4X65E 2EN8A 2JWOA 1A1FA 1TF6A 2YTGA 2LRSA 3EPLA 2CT1A 2EE8A 3VYXA 4JYAE 2EOEA 2I9IA 1EH7A 1YUIA 2JR1A 2EM5A 4BMJA 2UXCE 2EZ6A 3H09A 2V85A 3AV0A 1Z1BA 1XMOE 3C6MA 3MHHC 5AASA 1UILA 4I8OA 4LU9A 2HJJA 4DV6E 1L4SA 1KJKA 4WFTA 2EMCA 1NEIA 2BB8A 2YTDA 3ADGA 3J7AG 2RTXA 1UHZA 2M9AA 4DR3E 2L6MA 2EL4A 1MEYC 2EPPA 4KWYA 3T1YE 1RC7A 3UK3C 1TF3A 3K6QA 1YFHA 5DNYA 2YTFA 4WPYA 2DIXA 1MGTA 1GZ6A 1WXRA 4JI7E 5AC5A 4ZYHA 2ODRC 4F9CB 4LF7E 4Q35B 3EPJA 3KZYA 2LE2A 2GPIA 1SR9A 2EMGA 2L2NA 2R1FA 4OOGC 3THOB 5KL6A 4LF6E 2WZOA 4LF4E 1XNRE 1T4OA 5A6JA 1JK1A 2V86A 1YYOA 2EPRA 2EPXA 2YSPA 1ZU1A 2R76A 2MC6A 4X9JA 1HNXE 2LVHA 2EPOA 3LMLA 1BB8A 1FKAE 3VYYA 4O4KA 4NXME 3BGHA 1YYKA 2LTRA 2ZM6E 2EMKA 2V89A 1STUA 2DRPA 2EN6A 4RH8A 2RS7A 4R2PA 1YPNA 1WHNA 2D9HA 2DMYA 1A1HA 2EJ4A 1JK2A 4DV7E 3HXLA 4X62E 4O43A 3IWBA 2JP9A 1EH8A 4YHHE 2JY9A 2UUCE 2VF1A 2NUFA 2RQLA 5FLXC 2VQFE 4NZVA 4O24A 2EM3A 1N3GA 1WJPA 2JOXA 4GZNC 1QNTA 1T39A 2EOZA 3FIGA 2KOUA 3LLHA 5IWAE 1EKZA 4L8NA 2EN7A 3J81C 2ODRD 1A1JA 2A25A 4FK5C 2LBSB 2B7TA 1UN6B 4R8OA 4TUGA 1IBME 4NXNE 1HNZE 2EM7A 3HPSA 4LF9E 1UBDC 2YTIA 2HHHE 4IS1C 1DGCA 1PKPA 3QG5C 2K7IA 2UXBE 1SFEA 2EQ0A 5ADZA 2VQEE 4DV3E 1J26A 2N3HA 3F6GA 5LL6R 2Q8UA 1PJSA 2B7VA 2MC5A 2EOJA 1B69A 1YZ9A 4LTYA 2WCC3 2UXDE 2KHXA 1PDAA 1EH6A 2MDRA 1A1KA 1N33E 2EPAA 4ZYGA 2F8BA 2L3CA 1IQOA 2I13A 2EOYA 4J8ZA 2EPLX 2GLIA 2EPKX 4K0KE 2LJHA 2RPCA 5T6JA 4JI6E 1O0WA 4X64E 4JI4E 2EN4A 2EOOA 5IXMB 4LF8E 2LUPB 3MHSC 4DV1E 4BCAA 2LO3A 2EMIA 1P47A 2JPAA 2EORA 4X66E 2FGGA 3F6HA 3JTZA 2E5LE 4HTGA 1A1LA 2V8QB 4LFAE 2FTXB 2M1SA 3KWRA 1X6EA 4F9AB 4JV5E 4LFCE 1DI2A 3IWDA 1HNWE 5CFFE 3THNA 2YTEA 4KHPE 1A1IA 4DKKA 5KL3A 3C4TA 1IBKE 2EOMA 4DR2E 1N36E 1RMDA 4JI1E 2DMIA 4R2CA 4NHRA 2YPNA 2LTSA 2HC5A 1PJQA 2BBGA 1F2IG 4JI0E 1X49A 1X5WA 2EMWA 5A6KA 2YTQA 1ZBQA 4LFBE 1N32E 4M2ZA 2EM8A 4TUIA 1X6HA 4M30A 3J7Yp 1GQEA 1LLMC 2EN3A 4JI5E 4DR4E 2EM2A 1N34E 2WBUA 1AAYA 2EN1A 4B3SE 5KL5A 1BBOA 3C4BA 2V87A 4DV0E 4JI2E 4IJDA 4P78A 1I94E 4R2SA 2FV4B 3ADLA 2NUGA 1X48A 4MLVA 2V88A 4GKKE 2CSHA 1T38A 2N8XA 5A6BD 3IWCA 4Q28A 2EL6A 4R03A 5AE3A 3EPKA 2L92A 4BHBA 4F6MA 2M7QA 3ADJA 2LJUA 2EOSA 3EQ1A 4WX9A 4F6NA 1IQSA 2JVAA 3KZZA 1ZR9A 2EPZA 1YSAC 2E1MA 5A69A 5A6BA 2ENCA 2YU8A 2EPUA 2EP3A 4KZSA 2MKNA 3T1HE 2RS6A 4MLQA 1AH5A 3ZOQB 1IMUA 2DSYA 2NABA 3OMLA 4GEQB 2WBSA 2DGCA 4F54A 2YU5A 2UU9E 1WHQA 4DV4E 2JYAA 4R2RA 5A6AA 3ADIA 2EMXA 4R2EA 1HR0E 2ENAA 3ECRA 5KL2A 5KL4A 4O5GA 2EOFA 2JXPA 2V83A 2EM0A 2EOHA 2YRMA 2LMZA 2WBTA 2YZTA 1ZAAC 2YT4A 4DR7E 2ELZA 2K4VA 5AE1A 2L33A 4F2JC 1YYWA 4BHCA 4WSGA 1J5EE 2ENHA 2HGHA 5F3WA 4M0VA 2DLKA 1X6FA 2DB2A 2H36X 4DR5E 4YY3E 3P1XA 4BS9A 4B3TE 5LMUE 4JI8E 1A1GA 2LV2A 2F4VE 2EQ1A 4DUYE 3BBGA
chains in the Genus database with same CATH topology
1ZBQA 2LRSA 3DF6A 4X8WA 5FLXC 4B3ME 2L2MA 2M4IA 4LFBE 1N32E 2NUEA 4M2ZA 2VQFE 3VYXA 4JYAE 4TUIA 4M30A 3J7Yp 2JOXA 2UUAE 1GQEA 1X47A 2JR1A 3VK6A 3HQ1A 3FIGA 4BMJA 2UXCE 2EZ6A 4JI5E 4DR4E 3H09A 2V85A 1N34E 2KOUA 3LLHA 3AV0A 1XMOE 3MSWA 5AE2A 5IWAE 1EKZA 4L8NA 3J81C 2ODRD 4B3SE 5AASA 1UILA 4I8OA 5BR8E 4LF5E 4LU9A 4F9BB 3C4BA 2V87A 4DV0E 4DV6E 2LUQA 4JI2E 1XNQE 4P78A 1I94E 4WFTA 4B3RE 2LBSB 2FV4B 2B3TB 2B7TA 2NUGA 3ADLA 1X48A 3DJWA 4R8OA 4TUGA 1IBME 2V88A 4NXNE 1ZBTA 3HPZA 1HNZE 4LF9E 3HPSA 4GKKE 4OX9E 3ADGA 1XMQE 3J7AG 4AQYE 2RTXA 2L8TA 2HHHE 1UHZA 4GKJE 4DV5E 3IWCA 2L6MA 4DR3E 4Q28A 1PKPA 4R03A 3T1YE 2UXBE 5AE3A 5ADZA 1RC7A 2VQEE 2IHR1 4DV3E 2L92A 1J26A 2N3HA 3F6GA 3ADJA 3K6QA 5LL6R 2M7QA 5A2QC 2L2KB 2B7VA 2MC5A 5DNYA 2JVAA 4P7DA 1YZ9A 4WPYA 4LTYA 5LMNE 2CPNA 2DIXA 2KHXA 2UXDE 4DV7E 1GZ6A 1WXRA 2E1MA 3HTXA 2EWLA 2MDRA 4JI7E 1N33E 2ODRC 1RQ0A 4KZSA 4DV2E 3T1HE 4JI3E 4F9CB 4LF7E 2RS6A 3ZOQB 2F8BA 2L3JA 4BC9A 2L3CA 2DSYA 3OMLA 4OOGC 2LE2A 4GEQB 1SR9A 2L2NA 4LF6E 4F54A 1FJGE 4WYQB 1N36E 4J8ZA 2WZOA 2UU9E 4LF4E 1WHQA 1DQ3A 4DV4E 4K0KE 2LJHA 1XNRE 1T4OA 5T6JA 3RMPA 4JI6E 1O0WA 2NUFA 3ADIA 4X64E 1HR0E 2V86A 4JI4E 1YYOA 4BBYA 4LF8E 2VE7C 2LUPB 2MC6A 4DV1E 4BCAA 1HNXE 2V83A 4X66E 3LMLA 2FGGA 2LMZA 3F6HA 3VYYA 1FKAE 3JTZA 2E5LE 1T4NA 4NXME 2V8QB 4LFAE 2YZTA 1YYKA 5IT9C 2FTXB 2M1SA 2LTRA 2YT4A 2ZM6E 3KWRA 4JV5E 4DMIA 4F9AB 3J80C 4LFCE 4DR7E 3AUZA 1IBLE 1DI2A 2K4VA 2V89A 1STUA 3IWDA 5AE1A 1HNWE 2L33A 5CFFE 2G7HA 4DR1E 1YYWA 4KHPE 4DKKA 3JU0A 2RS7A 3C4TA 1J5EE 4WSPA 1T4LB 1IBKE 4DR2E 2B9DA 2JOBA 2N3GA 3JAMC 2NA2A 5F3WA 1WHNA 4M0VA 2KONA 4BC7A 2UUBE 4DR6E 4JI1E 2DB2A 2DMYA 2H36X 4DR5E 4YY3E 3HXLA 1QU6A 2LTSA 2RSMA 3IWBA 3P1XA 4L5NC 4BS9A 4X62E 4JI8E 3OTOE 5LMUE 4B3TE 1X49A 4X65E 4DUZE 4YHHE 4JI0E 2JWOA 2F4VE 2JY9A 2UUCE 2VF1A 4DUYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1S A; 
#chains in the Genus database with same CATH topology
 2EOQ A;  3DF6 A;  4X8W A;  4B3M E;  2L2M A;  2M4I A;  2EL5 A;  2NUE A;  4R2D A;  1GTK A;  4WXC A;  1BBG A;  2UUA E;  1X47 A;  3VK6 A;  2DLQ A;  3HQ1 A;  3M99 B;  2EMY A;  3MSW A;  5AE2 A;  2EMB A;  5BR8 E;  4LF5 E;  4F9B B;  2EPM X;  3L00 A;  2LUQ A;  2MKD A;  1XNQ E;  4R2Q A;  1WRJ A;  4B3R E;  2B3T B;  4ZYE A;  3DJW A;  4RHB B;  3VHT B;  2EPC A;  2EMZ A;  1ZBT A;  3HPZ A;  2GHF A;  1XMQ E;  5KL7 A;  4OX9 E;  4AQY E;  2MDG A;  2L8T A;  1PJT A;  4GKJ E;  4DV5 E;  2YTN A;  2EM4 A;  2YTJ A;  5AC4 A;  2EMA A;  2IHR 1;  2EQ3 A;  2EMF A;  5A2Q C;  5IV8 B;  2L2K B;  2EMH A;  4P7D A;  4WXD A;  2EN2 A;  3BID A;  4R2A A;  3C6K A;  5LMN E;  2CPN A;  3TQM A;  3HTX A;  2EWL A;  2YRH A;  1RQ0 A;  4DV2 E;  2PRT A;  4JI3 E;  2EML A;  2EM9 A;  2L3J A;  4BC9 A;  1X3C A;  1FJG E;  4WYQ B;  3EPH A;  2ELY A;  1DQ3 A;  3RMP A;  2EPN A;  2YSO A;  2EM6 A;  4BBY A;  2EOX A;  2VE7 C;  2YWQ A;  2E72 A;  2YTO A;  1YUJ A;  1T4N A;  2YTP A;  5IT9 C;  3BF2 A;  2LT7 A;  4DMI A;  1KYQ A;  3J80 C;  2VRD A;  3AUZ A;  1IBL E;  2YRK A;  1G2F C;  1G2D C;  2CTD A;  2G7H A;  4DR1 E;  4M9V C;  3JU0 A;  2RSI A;  4WSP A;  1T4L B;  2B9D A;  2JOB A;  2N3G A;  3JAM C;  2NA2 A;  5LLQ A;  2UUB E;  4BC7 A;  2KON A;  2LCE A;  4DR6 E;  4ZYD A;  1NCS A;  1QU6 A;  2RSM A;  4L5N C;  3OTO E;  4N4R B;  2EOI A;  4HEI A;  5TSE A;  1TN9 A;  2J7J A;  2ADR A;  4DUZ E;  4X65 E;  2EN8 A;  2JWO A;  1A1F A;  1TF6 A;  2YTG A;  2LRS A;  3EPL A;  2CT1 A;  2EE8 A;  3VYX A;  4JYA E;  2EOE A;  2I9I A;  1EH7 A;  1YUI A;  2JR1 A;  2EM5 A;  4BMJ A;  2UXC E;  2EZ6 A;  3H09 A;  2V85 A;  3AV0 A;  1Z1B A;  1XMO E;  3C6M A;  3MHH C;  5AAS A;  1UIL A;  4I8O A;  4LU9 A;  2HJJ A;  4DV6 E;  1L4S A;  1KJK A;  4WFT A;  2EMC A;  1NEI A;  2BB8 A;  2YTD A;  3ADG A;  3J7A G;  2RTX A;  1UHZ A;  2M9A A;  4DR3 E;  2L6M A;  2EL4 A;  1MEY C;  2EPP A;  4KWY A;  3T1Y E;  1RC7 A;  3UK3 C;  1TF3 A;  3K6Q A;  1YFH A;  5DNY A;  2YTF A;  4WPY A;  2DIX A;  1MGT A;  1GZ6 A;  1WXR A;  4JI7 E;  5AC5 A;  4ZYH A;  2ODR C;  4F9C B;  4LF7 E;  4Q35 B;  3EPJ A;  3KZY A;  2LE2 A;  2GPI A;  1SR9 A;  2EMG A;  2L2N A;  2R1F A;  4OOG C;  3THO B;  5KL6 A;  4LF6 E;  2WZO A;  4LF4 E;  1XNR E;  1T4O A;  5A6J A;  1JK1 A;  2V86 A;  1YYO A;  2EPR A;  2EPX A;  2YSP A;  1ZU1 A;  2R76 A;  2MC6 A;  4X9J A;  1HNX E;  2LVH A;  2EPO A;  3LML A;  1BB8 A;  1FKA E;  3VYY A;  4O4K A;  4NXM E;  3BGH A;  1YYK A;  2LTR A;  2ZM6 E;  2EMK A;  2V89 A;  1STU A;  2DRP A;  2EN6 A;  4RH8 A;  2RS7 A;  4R2P A;  1YPN A;  1WHN A;  2D9H A;  2DMY A;  1A1H A;  2EJ4 A;  1JK2 A;  4DV7 E;  3HXL A;  4X62 E;  4O43 A;  3IWB A;  2JP9 A;  1EH8 A;  4YHH E;  2JY9 A;  2UUC E;  2VF1 A;  2NUF A;  2RQL A;  5FLX C;  2VQF E;  4NZV A;  4O24 A;  2EM3 A;  1N3G A;  1WJP A;  2JOX A;  4GZN C;  1QNT A;  1T39 A;  2EOZ A;  3FIG A;  2KOU A;  3LLH A;  5IWA E;  1EKZ A;  4L8N A;  2EN7 A;  3J81 C;  2ODR D;  1A1J A;  2A25 A;  4FK5 C;  2LBS B;  2B7T A;  1UN6 B;  4R8O A;  4TUG A;  1IBM E;  4NXN E;  1HNZ E;  2EM7 A;  3HPS A;  4LF9 E;  1UBD C;  2YTI A;  2HHH E;  4IS1 C;  1DGC A;  1PKP A;  3QG5 C;  2K7I A;  2UXB E;  1SFE A;  2EQ0 A;  5ADZ A;  2VQE E;  4DV3 E;  1J26 A;  2N3H A;  3F6G A;  5LL6 R;  2Q8U A;  1PJS A;  2B7V A;  2MC5 A;  2EOJ A;  1B69 A;  1YZ9 A;  4LTY A;  2WCC 3;  2UXD E;  2KHX A;  1PDA A;  1EH6 A;  2MDR A;  1A1K A;  1N33 E;  2EPA A;  4ZYG A;  2F8B A;  2L3C A;  1IQO A;  2I13 A;  2EOY A;  4J8Z A;  2EPL X;  2GLI A;  2EPK X;  4K0K E;  2LJH A;  2RPC A;  5T6J A;  4JI6 E;  1O0W A;  4X64 E;  4JI4 E;  2EN4 A;  2EOO A;  5IXM B;  4LF8 E;  2LUP B;  3MHS C;  4DV1 E;  4BCA A;  2LO3 A;  2EMI A;  1P47 A;  2JPA A;  2EOR A;  4X66 E;  2FGG A;  3F6H A;  3JTZ A;  2E5L E;  4HTG A;  1A1L A;  2V8Q B;  4LFA E;  2FTX B;  2M1S A;  3KWR A;  1X6E A;  4F9A B;  4JV5 E;  4LFC E;  1DI2 A;  3IWD A;  1HNW E;  5CFF E;  3THN A;  2YTE A;  4KHP E;  1A1I A;  4DKK A;  5KL3 A;  3C4T A;  1IBK E;  2EOM A;  4DR2 E;  1N36 E;  1RMD A;  4JI1 E;  2DMI A;  4R2C A;  4NHR A;  2YPN A;  2LTS A;  2HC5 A;  1PJQ A;  2BBG A;  1F2I G;  4JI0 E;  1X49 A;  1X5W A;  2EMW A;  5A6K A;  2YTQ A;  1ZBQ A;  4LFB E;  1N32 E;  4M2Z A;  2EM8 A;  4TUI A;  1X6H A;  4M30 A;  3J7Y p;  1GQE A;  1LLM C;  2EN3 A;  4JI5 E;  4DR4 E;  2EM2 A;  1N34 E;  2WBU A;  1AAY A;  2EN1 A;  4B3S E;  5KL5 A;  1BBO A;  3C4B A;  2V87 A;  4DV0 E;  4JI2 E;  4IJD A;  4P78 A;  1I94 E;  4R2S A;  2FV4 B;  3ADL A;  2NUG A;  1X48 A;  4MLV A;  2V88 A;  4GKK E;  2CSH A;  1T38 A;  2N8X A;  5A6B D;  3IWC A;  4Q28 A;  2EL6 A;  4R03 A;  5AE3 A;  3EPK A;  2L92 A;  4BHB A;  4F6M A;  2M7Q A;  3ADJ A;  2LJU A;  2EOS A;  3EQ1 A;  4WX9 A;  4F6N A;  1IQS A;  2JVA A;  3KZZ A;  1ZR9 A;  2EPZ A;  1YSA C;  2E1M A;  5A69 A;  5A6B A;  2ENC A;  2YU8 A;  2EPU A;  2EP3 A;  4KZS A;  2MKN A;  3T1H E;  2RS6 A;  4MLQ A;  1AH5 A;  3ZOQ B;  1IMU A;  2DSY A;  2NAB A;  3OML A;  4GEQ B;  2WBS A;  2DGC A;  4F54 A;  2YU5 A;  2UU9 E;  1WHQ A;  4DV4 E;  2JYA A;  4R2R A;  5A6A A;  3ADI A;  2EMX A;  4R2E A;  1HR0 E;  2ENA A;  3ECR A;  5KL2 A;  5KL4 A;  4O5G A;  2EOF A;  2JXP A;  2V83 A;  2EM0 A;  2EOH A;  2YRM A;  2LMZ A;  2WBT A;  2YZT A;  1ZAA C;  2YT4 A;  4DR7 E;  2ELZ A;  2K4V A;  5AE1 A;  2L33 A;  4F2J C;  1YYW A;  4BHC A;  4WSG A;  1J5E E;  2ENH A;  2HGH A;  5F3W A;  4M0V A;  2DLK A;  1X6F A;  2DB2 A;  2H36 X;  4DR5 E;  4YY3 E;  3P1X A;  4BS9 A;  4B3T E;  5LMU E;  4JI8 E;  1A1G A;  2LV2 A;  2F4V E;  2EQ1 A;  4DUY E;  3BBG A; 
#chains in the Genus database with same CATH homology
 1ZBQ A;  2LRS A;  3DF6 A;  4X8W A;  5FLX C;  4B3M E;  2L2M A;  2M4I A;  4LFB E;  1N32 E;  2NUE A;  4M2Z A;  2VQF E;  3VYX A;  4JYA E;  4TUI A;  4M30 A;  3J7Y p;  2JOX A;  2UUA E;  1GQE A;  1X47 A;  2JR1 A;  3VK6 A;  3HQ1 A;  3FIG A;  4BMJ A;  2UXC E;  2EZ6 A;  4JI5 E;  4DR4 E;  3H09 A;  2V85 A;  1N34 E;  2KOU A;  3LLH A;  3AV0 A;  1XMO E;  3MSW A;  5AE2 A;  5IWA E;  1EKZ A;  4L8N A;  3J81 C;  2ODR D;  4B3S E;  5AAS A;  1UIL A;  4I8O A;  5BR8 E;  4LF5 E;  4LU9 A;  4F9B B;  3C4B A;  2V87 A;  4DV0 E;  4DV6 E;  2LUQ A;  4JI2 E;  1XNQ E;  4P78 A;  1I94 E;  4WFT A;  4B3R E;  2LBS B;  2FV4 B;  2B3T B;  2B7T A;  2NUG A;  3ADL A;  1X48 A;  3DJW A;  4R8O A;  4TUG A;  1IBM E;  2V88 A;  4NXN E;  1ZBT A;  3HPZ A;  1HNZ E;  4LF9 E;  3HPS A;  4GKK E;  4OX9 E;  3ADG A;  1XMQ E;  3J7A G;  4AQY E;  2RTX A;  2L8T A;  2HHH E;  1UHZ A;  4GKJ E;  4DV5 E;  3IWC A;  2L6M A;  4DR3 E;  4Q28 A;  1PKP A;  4R03 A;  3T1Y E;  2UXB E;  5AE3 A;  5ADZ A;  1RC7 A;  2VQE E;  2IHR 1;  4DV3 E;  2L92 A;  1J26 A;  2N3H A;  3F6G A;  3ADJ A;  3K6Q A;  5LL6 R;  2M7Q A;  5A2Q C;  2L2K B;  2B7V A;  2MC5 A;  5DNY A;  2JVA A;  4P7D A;  1YZ9 A;  4WPY A;  4LTY A;  5LMN E;  2CPN A;  2DIX A;  2KHX A;  2UXD E;  4DV7 E;  1GZ6 A;  1WXR A;  2E1M A;  3HTX A;  2EWL A;  2MDR A;  4JI7 E;  1N33 E;  2ODR C;  1RQ0 A;  4KZS A;  4DV2 E;  3T1H E;  4JI3 E;  4F9C B;  4LF7 E;  2RS6 A;  3ZOQ B;  2F8B A;  2L3J A;  4BC9 A;  2L3C A;  2DSY A;  3OML A;  4OOG C;  2LE2 A;  4GEQ B;  1SR9 A;  2L2N A;  4LF6 E;  4F54 A;  1FJG E;  4WYQ B;  1N36 E;  4J8Z A;  2WZO A;  2UU9 E;  4LF4 E;  1WHQ A;  1DQ3 A;  4DV4 E;  4K0K E;  2LJH A;  1XNR E;  1T4O A;  5T6J A;  3RMP A;  4JI6 E;  1O0W A;  2NUF A;  3ADI A;  4X64 E;  1HR0 E;  2V86 A;  4JI4 E;  1YYO A;  4BBY A;  4LF8 E;  2VE7 C;  2LUP B;  2MC6 A;  4DV1 E;  4BCA A;  1HNX E;  2V83 A;  4X66 E;  3LML A;  2FGG A;  2LMZ A;  3F6H A;  3VYY A;  1FKA E;  3JTZ A;  2E5L E;  1T4N A;  4NXM E;  2V8Q B;  4LFA E;  2YZT A;  1YYK A;  5IT9 C;  2FTX B;  2M1S A;  2LTR A;  2YT4 A;  2ZM6 E;  3KWR A;  4JV5 E;  4DMI A;  4F9A B;  3J80 C;  4LFC E;  4DR7 E;  3AUZ A;  1IBL E;  1DI2 A;  2K4V A;  2V89 A;  1STU A;  3IWD A;  5AE1 A;  1HNW E;  2L33 A;  5CFF E;  2G7H A;  4DR1 E;  1YYW A;  4KHP E;  4DKK A;  3JU0 A;  2RS7 A;  3C4T A;  1J5E E;  4WSP A;  1T4L B;  1IBK E;  4DR2 E;  2B9D A;  2JOB A;  2N3G A;  3JAM C;  2NA2 A;  5F3W A;  1WHN A;  4M0V A;  2KON A;  4BC7 A;  2UUB E;  4DR6 E;  4JI1 E;  2DB2 A;  2DMY A;  2H36 X;  4DR5 E;  4YY3 E;  3HXL A;  1QU6 A;  2LTS A;  2RSM A;  3IWB A;  3P1X A;  4L5N C;  4BS9 A;  4X62 E;  4JI8 E;  3OTO E;  5LMU E;  4B3T E;  1X49 A;  4X65 E;  4DUZ E;  4YHH E;  4JI0 E;  2JWO A;  2F4V E;  2JY9 A;  2UUC E;  2VF1 A;  4DUY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...