2M1SA

Nmr assignment of the arenaviral protein z from lassa fever virus
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
99
structure length
99
Chain Sequence
MGNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAAPTAPPTGAADSIRPPPYSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E
pubmed doi rcsb
source organism Lassa virus josiah
molecule tags Transcription
molecule keywords RING finger protein Z
total genus 5
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03854 zf-P11 P-11 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.310 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m1sA01
2M1SA
chains in the Genus database with same CATH superfamily
2EORA 3THNA 1X49A 2GPIA 4DV5E 1G2DC 2EMXA 2RQLA 2YTPA 4O4KA 2MDRA 3C4TA 2EMKA 2KONA 4R2SA 4LF6E 3DF6A 2LUQA 4OOGC 4RHBB 3HPSA 5AE2A 2JXPA 4JI6E 2LRSA 1STUA 2EOZA 4R2CA 4BS9A 4JI8E 1YYKA 4FK5C 3EPHA 2F4VE 4BMJA 2EJ4A 4JI7E 4R2AA 1MGTA 1WHNA 2EPAA 5AC4A 2EOYA 4DV3E 2N3HA 2F8BA 2EOOA 2EPZA 3IWDA 2EM6A 4JI1E 1IQSA 1RMDA 3ECRA 2L6MA 2EOJA 5KL7A 1YYOA 2RPCA 1UBDC 1QNTA 2EQ3A 2L2NA 3AV0A 4WSPA 1T4LB 1XNRE 4YHHE 2EOXA 2EPLX 4NXME 2ENCA 1XMQE 5LL6R 4F9CB 1A1HA 2YSOA 1SFEA 1EKZA 4DKKA 2I13A 4DR2E 1A1KA 2EM2A 2DGCA 2ODRD 5A6AA 3OMLA 1DGCA 2WBTA 4J8ZA 2ELYA 2WBSA 4DV6E 1RC7A 1EH7A 3VK6A 2BB8A 2EMAA 3ADGA 4BHCA 3AUZA 2L3JA 1WXRA 3VHTB 5LMNE 2WCC3 2EE8A 4DV1E 4RH8A 4LF7E 2LE2A 1N32E 1IMUA 2NUFA 4LFBE 5KL5A 2L33A 4L8NA 2R1FA 3H09A 3DJWA 4MLVA 2EOFA 1J5EE 2ZM6E 2HJJA 4ZYDA 3HXLA 4P7DA 1N36E 1I94E 4O43A 2LJHA 2ODRC 1BBOA 2ELZA 1KJKA 2LCEA 5ADZA 4DUYE 1HNXE 2UUCE 2EQ1A 3L00A 2RSIA 2MKNA 1G2FC 2EPXA 4BCAA 1ZU1A 2YSPA 4DV7E 4DR1E 2LTSA 2UUBE 1MEYC 1WHQA 3T1HE 4M30A 1X6FA 3JAMC 4F54A 2EPNA 4X62E 2EN3A 4B3TE 2YT4A 2EM9A 2WZOA 2NUGA 3BGHA 2B7VA 5FLXC 4NXNE 4LU9A 1TF3A 1UILA 2EQ0A 2YTDA 2EMFA 1AAYA 1HNWE 2CTDA 4NZVA 2EOEA 4HEIA 1AH5A 2L8TA 2UXBE 2EOMA 2HC5A 3BF2A 1X6HA 1RQ0A 2YU5A 2YTGA 1PKPA 3FIGA 4B3RE 3J81C 2DB2A 2JY9A 4I8OA 5IXMB 2CPNA 3JU0A 4MLQA 4LF9E 2EMHA 4JYAE 2YTEA 3MHHC 5KL4A 4OX9E 4BBYA 5A6KA 2V89A 2HHHE 4M0VA 1PDAA 2EOHA 1YUJA 2JOBA 2EL5A 4JI2E 4R2EA 2EM5A 1X48A 2JOXA 2MDGA 2IHR1 1X6EA 1NCSA 5AC5A 1B69A 2EPUA 2N8XA 2YRKA 3IWBA 2EN1A 2DRPA 2YTIA 3K6QA 4L5NC 1A1JA 4LF5E 1J26A 2DSYA 2YPNA 1T4NA 2Q8UA 1YSAC 2EOQA 4JI4E 2NA2A 2EMGA 2K7IA 3C6KA 4WYQB 1X5WA 2FGGA 2EN8A 3QG5C 1KYQA 2YTFA 2I9IA 2YRHA 4X9JA 4X64E 1A1FA 2B3TB 2V87A 1HNZE 3LMLA 1JK1A 3C6MA 4F6MA 1XNQE 4LF4E 3HTXA 2M4IA 5KL2A 4R2DA 1QU6A 2EOIA 3LLHA 2YZTA 2JP9A 1YZ9A 2UUAE 2MC5A 3VYXA 1O0WA 2EWLA 4P78A 2EM7A 4X8WA 3KWRA 3C4BA 1WRJA 3J80C 3ADLA 4WXCA 2V85A 3RMPA 1ZBTA 2YTJA 5A2QC 1GQEA 4DV0E 2M1SA 2LBSB 2NUEA 5LMUE 2DMIA 2KHXA 2YWQA 2PRTA 1PJQA 4ZYGA 2H36X 2RTXA 4IS1C 2VRDA 5DNYA 2LMZA 4DR5E 3BBGA 4R03A 5A69A 2EN2A 4GKJE 4TUIA 2RSMA 2EMWA 2LUPB 2EL4A 2EOSA 1A1GA 4BHBA 2EMYA 2EZ6A 2V8QB 5A6BA 3P1XA 4BC7A 1UN6B 1GZ6A 3EQ1A 3MHSC 4GZNC 2GLIA 4R2RA 3JTZA 2VF1A 4X65E 5CFFE 3KZYA 5IV8B 4R2QA 1N33E 3J7Yp 2UU9E 2G7HA 4NHRA 2R76A 4JI0E 2DIXA 2JYAA 4IJDA 3VYYA 4M9VC 2YTQA 1JK2A 2LV2A 4WFTA 4K0KE 2EPRA 2EMIA 3EPLA 3ADJA 3EPJA 1T38A 1NEIA 1PJSA 2WBUA 4LFAE 5KL6A 1EH6A 4O24A 2EPPA 2JWOA 4B3SE 4YY3E 1SR9A 2ADRA 2EMLA 2KOUA 2M7QA 4WSGA 5KL3A 1X3CA 2EP3A 2L3CA 1A1IA 2EMCA 2EPMX 2EMZA 4LF8E 4DR4E 5BR8E 2EM3A 3M99B 4F6NA 2YTOA 4X66E 5AE1A 4WPYA 2M9AA 1DQ3A 2RS7A 4LTYA 2E72A 2UXCE 1N3GA 2B7TA 2E1MA 4GEQB 2LTRA 1IBKE 1BB8A 2L2KB 5IWAE 3TQMA 1A1LA 2CSHA 4TUGA 4WXDA 4F2JC 5A6JA 1YPNA 5TSEA 2NABA 2JR1A 3EPKA 1ZAAC 1YFHA 5T6JA 4DUZE 2EM4A 1T4OA 3HQ1A 2V86A 1TN9A 1YUIA 5AE3A 4R2PA 1Z1BA 4WX9A 2ENAA 1FJGE 2N3GA 2YRMA 4ZYHA 4DR6E 3MSWA 1BBGA 2L92A 2D9HA 2EPCA 2LO3A 3J7AG 2CT1A 1X47A 2E5LE 2A25A 2VQFE 1F2IG 2DLQA 2FV4B 4Q28A 1IBME 1PJTA 5F3WA 3F6HA 1UHZA 1IQOA 2LJUA 3HPZA 2ENHA 1N34E 4ZYEA 4DR3E 3THOB 1ZBQA 2K4VA 2HGHA 2VE7C 2EN7A 3IWCA 5A6BD 3ADIA 4Q35B 2EN4A 2L2MA 2MC6A 1LLMC 2DMYA 2MKDA 1IBLE 2EM0A 4BC9A 2B9DA 2J7JA 2EL6A 1XMOE 5LLQA 1GTKA 4DR7E 2LVHA 4JI3E 4JI5E 2GHFA 1L4SA 2RS6A 2YU8A 2JVAA 3BIDA 1EH8A 2V88A 4R8OA 2EMBA 4O5GA 1P47A 2EPKX 3OTOE 2DLKA 2FTXB 4M2ZA 2EPOA 4F9BB 2YTNA 2V83A 2VQEE 2LT7A 4GKKE 2UXDE 1TF6A 4DMIA 4JV5E 4DV4E 1FKAE 1T39A 2BBGA 3ZOQB 4AQYE 3KZZA 4F9AB 4N4RB 5AASA 2JPAA 1ZR9A 3UK3C 4DV2E 3T1YE 4B3ME 1WJPA 1HR0E 2EM8A 4LFCE 3F6GA 4KZSA 1DI2A 4KWYA 1YYWA 5IT9C 4HTGA 2EN6A 4KHPE
chains in the Genus database with same CATH topology
5IWAE 4X62E 1X49A 4B3TE 2YT4A 2V85A 2WZOA 3RMPA 2NUGA 4TUGA 2B7VA 1ZBTA 4DV5E 5FLXC 4NXNE 5A2QC 1GQEA 4LU9A 2M1SA 2MDRA 3C4TA 2KONA 5LMUE 4DV0E 2LBSB 1UILA 4LF6E 2JR1A 2KHXA 3DF6A 5T6JA 2LUQA 1HNWE 4DUZE 2H36X 4OOGC 2RTXA 3HPSA 5AE2A 1T4OA 2L8TA 3HQ1A 2UXBE 4JI6E 2V86A 2LRSA 1STUA 1RQ0A 5DNYA 1YYKA 2LMZA 4JI8E 1PKPA 4BS9A 5AE3A 3FIGA 4B3RE 3J81C 2DB2A 2JY9A 4I8OA 2CPNA 1FJGE 2N3GA 4DR5E 3JU0A 2F4VE 4LF9E 4BMJA 4DR6E 4R03A 3MSWA 4JYAE 2L92A 4GKJE 1IBKE 4TUIA 4OX9E 2RSMA 4JI7E 2LUPB 3J7AG 1X47A 4BBYA 2E5LE 1WHNA 2V89A 2HHHE 2VQFE 4M0VA 4DV3E 2FV4B 2N3HA 2EZ6A 2V8QB 2F8BA 3P1XA 3IWDA 4Q28A 1IBME 2JOBA 4BC7A 4JI1E 5F3WA 4JI2E 3F6HA 1GZ6A 1X48A 2L6MA 2JOXA 1UHZA 1YYOA 2IHR1 3JTZA 2VF1A 2L2NA 1T4LB 4WSPA 3AV0A 4X65E 1XNRE 4YHHE 5CFFE 3HPZA 4NXME 1XMQE 5LL6R 4F9CB 1N34E 1N33E 4DR3E 3IWBA 1EKZA 4DKKA 3J7Yp 2UU9E 2G7HA 1ZBQA 4DR2E 2K4VA 4JI0E 2DIXA 2VE7C 2ODRD 3K6QA 3VYYA 4L5NC 3OMLA 4LF5E 1J26A 2DSYA 3IWCA 3J80C 3ADIA 4J8ZA 1T4NA 4WFTA 2L2KB 4DV6E 4K0KE 1RC7A 3JAMC 2L2MA 2MC6A 3VK6A 3ADJA 2DMYA 1IBLE 3ADGA 4JI4E 4BC9A 2NA2A 2B9DA 3AUZA 1XMOE 2L3JA 4WYQB 1WXRA 2FGGA 5LMNE 4LFAE 4DR7E 4DV1E 4JI3E 4JI5E 4LF7E 2LE2A 1N32E 2NUFA 2RS6A 4X64E 4LFBE 2JVAA 2L33A 2JWOA 2V88A 4R8OA 4B3SE 4KHPE 2B3TB 4L8NA 4YY3E 1SR9A 2V87A 1HNZE 3H09A 3LMLA 3DJWA 2KOUA 2M7QA 2L3CA 2NUEA 3OTOE 1J5EE 2ZM6E 2FTXB 4M2ZA 4F9BB 2V83A 2VQEE 4GKKE 2UXDE 3HXLA 4P7DA 1XNQE 4DMIA 4JV5E 1N36E 4DV4E 1FKAE 4LF4E 3HTXA 2M4IA 1I94E 4LF8E 2LJHA 1QU6A 2ODRC 4DR4E 3LLHA 5BR8E 3ZOQB 4AQYE 2YZTA 4F9AB 5ADZA 4DUYE 4X66E 5AASA 1HNXE 5AE1A 2UUCE 4WPYA 4DV2E 1DQ3A 3T1YE 4B3ME 2RS7A 1YZ9A 4LTYA 2UUAE 1HR0E 4BCAA 4LFCE 2MC5A 3F6GA 4KZSA 2B7TA 1DI2A 2UXCE 3VYXA 2E1MA 1O0WA 2EWLA 4DV7E 4DR1E 2LTSA 4P78A 1YYWA 5IT9C 2UUBE 4X8WA 4GEQB 1WHQA 3T1HE 4M30A 2LTRA 3KWRA 3C4BA 4F54A 3ADLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1S A; 
#chains in the Genus database with same CATH topology
 2EOR A;  3THN A;  1X49 A;  2GPI A;  4DV5 E;  1G2D C;  2EMX A;  2RQL A;  2YTP A;  4O4K A;  2MDR A;  3C4T A;  2EMK A;  2KON A;  4R2S A;  4LF6 E;  3DF6 A;  2LUQ A;  4OOG C;  4RHB B;  3HPS A;  5AE2 A;  2JXP A;  4JI6 E;  2LRS A;  1STU A;  2EOZ A;  4R2C A;  4BS9 A;  4JI8 E;  1YYK A;  4FK5 C;  3EPH A;  2F4V E;  4BMJ A;  2EJ4 A;  4JI7 E;  4R2A A;  1MGT A;  1WHN A;  2EPA A;  5AC4 A;  2EOY A;  4DV3 E;  2N3H A;  2F8B A;  2EOO A;  2EPZ A;  3IWD A;  2EM6 A;  4JI1 E;  1IQS A;  1RMD A;  3ECR A;  2L6M A;  2EOJ A;  5KL7 A;  1YYO A;  2RPC A;  1UBD C;  1QNT A;  2EQ3 A;  2L2N A;  3AV0 A;  4WSP A;  1T4L B;  1XNR E;  4YHH E;  2EOX A;  2EPL X;  4NXM E;  2ENC A;  1XMQ E;  5LL6 R;  4F9C B;  1A1H A;  2YSO A;  1SFE A;  1EKZ A;  4DKK A;  2I13 A;  4DR2 E;  1A1K A;  2EM2 A;  2DGC A;  2ODR D;  5A6A A;  3OML A;  1DGC A;  2WBT A;  4J8Z A;  2ELY A;  2WBS A;  4DV6 E;  1RC7 A;  1EH7 A;  3VK6 A;  2BB8 A;  2EMA A;  3ADG A;  4BHC A;  3AUZ A;  2L3J A;  1WXR A;  3VHT B;  5LMN E;  2WCC 3;  2EE8 A;  4DV1 E;  4RH8 A;  4LF7 E;  2LE2 A;  1N32 E;  1IMU A;  2NUF A;  4LFB E;  5KL5 A;  2L33 A;  4L8N A;  2R1F A;  3H09 A;  3DJW A;  4MLV A;  2EOF A;  1J5E E;  2ZM6 E;  2HJJ A;  4ZYD A;  3HXL A;  4P7D A;  1N36 E;  1I94 E;  4O43 A;  2LJH A;  2ODR C;  1BBO A;  2ELZ A;  1KJK A;  2LCE A;  5ADZ A;  4DUY E;  1HNX E;  2UUC E;  2EQ1 A;  3L00 A;  2RSI A;  2MKN A;  1G2F C;  2EPX A;  4BCA A;  1ZU1 A;  2YSP A;  4DV7 E;  4DR1 E;  2LTS A;  2UUB E;  1MEY C;  1WHQ A;  3T1H E;  4M30 A;  1X6F A;  3JAM C;  4F54 A;  2EPN A;  4X62 E;  2EN3 A;  4B3T E;  2YT4 A;  2EM9 A;  2WZO A;  2NUG A;  3BGH A;  2B7V A;  5FLX C;  4NXN E;  4LU9 A;  1TF3 A;  1UIL A;  2EQ0 A;  2YTD A;  2EMF A;  1AAY A;  1HNW E;  2CTD A;  4NZV A;  2EOE A;  4HEI A;  1AH5 A;  2L8T A;  2UXB E;  2EOM A;  2HC5 A;  3BF2 A;  1X6H A;  1RQ0 A;  2YU5 A;  2YTG A;  1PKP A;  3FIG A;  4B3R E;  3J81 C;  2DB2 A;  2JY9 A;  4I8O A;  5IXM B;  2CPN A;  3JU0 A;  4MLQ A;  4LF9 E;  2EMH A;  4JYA E;  2YTE A;  3MHH C;  5KL4 A;  4OX9 E;  4BBY A;  5A6K A;  2V89 A;  2HHH E;  4M0V A;  1PDA A;  2EOH A;  1YUJ A;  2JOB A;  2EL5 A;  4JI2 E;  4R2E A;  2EM5 A;  1X48 A;  2JOX A;  2MDG A;  2IHR 1;  1X6E A;  1NCS A;  5AC5 A;  1B69 A;  2EPU A;  2N8X A;  2YRK A;  3IWB A;  2EN1 A;  2DRP A;  2YTI A;  3K6Q A;  4L5N C;  1A1J A;  4LF5 E;  1J26 A;  2DSY A;  2YPN A;  1T4N A;  2Q8U A;  1YSA C;  2EOQ A;  4JI4 E;  2NA2 A;  2EMG A;  2K7I A;  3C6K A;  4WYQ B;  1X5W A;  2FGG A;  2EN8 A;  3QG5 C;  1KYQ A;  2YTF A;  2I9I A;  2YRH A;  4X9J A;  4X64 E;  1A1F A;  2B3T B;  2V87 A;  1HNZ E;  3LML A;  1JK1 A;  3C6M A;  4F6M A;  1XNQ E;  4LF4 E;  3HTX A;  2M4I A;  5KL2 A;  4R2D A;  1QU6 A;  2EOI A;  3LLH A;  2YZT A;  2JP9 A;  1YZ9 A;  2UUA E;  2MC5 A;  3VYX A;  1O0W A;  2EWL A;  4P78 A;  2EM7 A;  4X8W A;  3KWR A;  3C4B A;  1WRJ A;  3J80 C;  3ADL A;  4WXC A;  2V85 A;  3RMP A;  1ZBT A;  2YTJ A;  5A2Q C;  1GQE A;  4DV0 E;  2M1S A;  2LBS B;  2NUE A;  5LMU E;  2DMI A;  2KHX A;  2YWQ A;  2PRT A;  1PJQ A;  4ZYG A;  2H36 X;  2RTX A;  4IS1 C;  2VRD A;  5DNY A;  2LMZ A;  4DR5 E;  3BBG A;  4R03 A;  5A69 A;  2EN2 A;  4GKJ E;  4TUI A;  2RSM A;  2EMW A;  2LUP B;  2EL4 A;  2EOS A;  1A1G A;  4BHB A;  2EMY A;  2EZ6 A;  2V8Q B;  5A6B A;  3P1X A;  4BC7 A;  1UN6 B;  1GZ6 A;  3EQ1 A;  3MHS C;  4GZN C;  2GLI A;  4R2R A;  3JTZ A;  2VF1 A;  4X65 E;  5CFF E;  3KZY A;  5IV8 B;  4R2Q A;  1N33 E;  3J7Y p;  2UU9 E;  2G7H A;  4NHR A;  2R76 A;  4JI0 E;  2DIX A;  2JYA A;  4IJD A;  3VYY A;  4M9V C;  2YTQ A;  1JK2 A;  2LV2 A;  4WFT A;  4K0K E;  2EPR A;  2EMI A;  3EPL A;  3ADJ A;  3EPJ A;  1T38 A;  1NEI A;  1PJS A;  2WBU A;  4LFA E;  5KL6 A;  1EH6 A;  4O24 A;  2EPP A;  2JWO A;  4B3S E;  4YY3 E;  1SR9 A;  2ADR A;  2EML A;  2KOU A;  2M7Q A;  4WSG A;  5KL3 A;  1X3C A;  2EP3 A;  2L3C A;  1A1I A;  2EMC A;  2EPM X;  2EMZ A;  4LF8 E;  4DR4 E;  5BR8 E;  2EM3 A;  3M99 B;  4F6N A;  2YTO A;  4X66 E;  5AE1 A;  4WPY A;  2M9A A;  1DQ3 A;  2RS7 A;  4LTY A;  2E72 A;  2UXC E;  1N3G A;  2B7T A;  2E1M A;  4GEQ B;  2LTR A;  1IBK E;  1BB8 A;  2L2K B;  5IWA E;  3TQM A;  1A1L A;  2CSH A;  4TUG A;  4WXD A;  4F2J C;  5A6J A;  1YPN A;  5TSE A;  2NAB A;  2JR1 A;  3EPK A;  1ZAA C;  1YFH A;  5T6J A;  4DUZ E;  2EM4 A;  1T4O A;  3HQ1 A;  2V86 A;  1TN9 A;  1YUI A;  5AE3 A;  4R2P A;  1Z1B A;  4WX9 A;  2ENA A;  1FJG E;  2N3G A;  2YRM A;  4ZYH A;  4DR6 E;  3MSW A;  1BBG A;  2L92 A;  2D9H A;  2EPC A;  2LO3 A;  3J7A G;  2CT1 A;  1X47 A;  2E5L E;  2A25 A;  2VQF E;  1F2I G;  2DLQ A;  2FV4 B;  4Q28 A;  1IBM E;  1PJT A;  5F3W A;  3F6H A;  1UHZ A;  1IQO A;  2LJU A;  3HPZ A;  2ENH A;  1N34 E;  4ZYE A;  4DR3 E;  3THO B;  1ZBQ A;  2K4V A;  2HGH A;  2VE7 C;  2EN7 A;  3IWC A;  5A6B D;  3ADI A;  4Q35 B;  2EN4 A;  2L2M A;  2MC6 A;  1LLM C;  2DMY A;  2MKD A;  1IBL E;  2EM0 A;  4BC9 A;  2B9D A;  2J7J A;  2EL6 A;  1XMO E;  5LLQ A;  1GTK A;  4DR7 E;  2LVH A;  4JI3 E;  4JI5 E;  2GHF A;  1L4S A;  2RS6 A;  2YU8 A;  2JVA A;  3BID A;  1EH8 A;  2V88 A;  4R8O A;  2EMB A;  4O5G A;  1P47 A;  2EPK X;  3OTO E;  2DLK A;  2FTX B;  4M2Z A;  2EPO A;  4F9B B;  2YTN A;  2V83 A;  2VQE E;  2LT7 A;  4GKK E;  2UXD E;  1TF6 A;  4DMI A;  4JV5 E;  4DV4 E;  1FKA E;  1T39 A;  2BBG A;  3ZOQ B;  4AQY E;  3KZZ A;  4F9A B;  4N4R B;  5AAS A;  2JPA A;  1ZR9 A;  3UK3 C;  4DV2 E;  3T1Y E;  4B3M E;  1WJP A;  1HR0 E;  2EM8 A;  4LFC E;  3F6G A;  4KZS A;  1DI2 A;  4KWY A;  1YYW A;  5IT9 C;  4HTG A;  2EN6 A;  4KHP E; 
#chains in the Genus database with same CATH homology
 5IWA E;  4X62 E;  1X49 A;  4B3T E;  2YT4 A;  2V85 A;  2WZO A;  3RMP A;  2NUG A;  4TUG A;  2B7V A;  1ZBT A;  4DV5 E;  5FLX C;  4NXN E;  5A2Q C;  1GQE A;  4LU9 A;  2M1S A;  2MDR A;  3C4T A;  2KON A;  5LMU E;  4DV0 E;  2LBS B;  1UIL A;  4LF6 E;  2JR1 A;  2KHX A;  3DF6 A;  5T6J A;  2LUQ A;  1HNW E;  4DUZ E;  2H36 X;  4OOG C;  2RTX A;  3HPS A;  5AE2 A;  1T4O A;  2L8T A;  3HQ1 A;  2UXB E;  4JI6 E;  2V86 A;  2LRS A;  1STU A;  1RQ0 A;  5DNY A;  1YYK A;  2LMZ A;  4JI8 E;  1PKP A;  4BS9 A;  5AE3 A;  3FIG A;  4B3R E;  3J81 C;  2DB2 A;  2JY9 A;  4I8O A;  2CPN A;  1FJG E;  2N3G A;  4DR5 E;  3JU0 A;  2F4V E;  4LF9 E;  4BMJ A;  4DR6 E;  4R03 A;  3MSW A;  4JYA E;  2L92 A;  4GKJ E;  1IBK E;  4TUI A;  4OX9 E;  2RSM A;  4JI7 E;  2LUP B;  3J7A G;  1X47 A;  4BBY A;  2E5L E;  1WHN A;  2V89 A;  2HHH E;  2VQF E;  4M0V A;  4DV3 E;  2FV4 B;  2N3H A;  2EZ6 A;  2V8Q B;  2F8B A;  3P1X A;  3IWD A;  4Q28 A;  1IBM E;  2JOB A;  4BC7 A;  4JI1 E;  5F3W A;  4JI2 E;  3F6H A;  1GZ6 A;  1X48 A;  2L6M A;  2JOX A;  1UHZ A;  1YYO A;  2IHR 1;  3JTZ A;  2VF1 A;  2L2N A;  1T4L B;  4WSP A;  3AV0 A;  4X65 E;  1XNR E;  4YHH E;  5CFF E;  3HPZ A;  4NXM E;  1XMQ E;  5LL6 R;  4F9C B;  1N34 E;  1N33 E;  4DR3 E;  3IWB A;  1EKZ A;  4DKK A;  3J7Y p;  2UU9 E;  2G7H A;  1ZBQ A;  4DR2 E;  2K4V A;  4JI0 E;  2DIX A;  2VE7 C;  2ODR D;  3K6Q A;  3VYY A;  4L5N C;  3OML A;  4LF5 E;  1J26 A;  2DSY A;  3IWC A;  3J80 C;  3ADI A;  4J8Z A;  1T4N A;  4WFT A;  2L2K B;  4DV6 E;  4K0K E;  1RC7 A;  3JAM C;  2L2M A;  2MC6 A;  3VK6 A;  3ADJ A;  2DMY A;  1IBL E;  3ADG A;  4JI4 E;  4BC9 A;  2NA2 A;  2B9D A;  3AUZ A;  1XMO E;  2L3J A;  4WYQ B;  1WXR A;  2FGG A;  5LMN E;  4LFA E;  4DR7 E;  4DV1 E;  4JI3 E;  4JI5 E;  4LF7 E;  2LE2 A;  1N32 E;  2NUF A;  2RS6 A;  4X64 E;  4LFB E;  2JVA A;  2L33 A;  2JWO A;  2V88 A;  4R8O A;  4B3S E;  4KHP E;  2B3T B;  4L8N A;  4YY3 E;  1SR9 A;  2V87 A;  1HNZ E;  3H09 A;  3LML A;  3DJW A;  2KOU A;  2M7Q A;  2L3C A;  2NUE A;  3OTO E;  1J5E E;  2ZM6 E;  2FTX B;  4M2Z A;  4F9B B;  2V83 A;  2VQE E;  4GKK E;  2UXD E;  3HXL A;  4P7D A;  1XNQ E;  4DMI A;  4JV5 E;  1N36 E;  4DV4 E;  1FKA E;  4LF4 E;  3HTX A;  2M4I A;  1I94 E;  4LF8 E;  2LJH A;  1QU6 A;  2ODR C;  4DR4 E;  3LLH A;  5BR8 E;  3ZOQ B;  4AQY E;  2YZT A;  4F9A B;  5ADZ A;  4DUY E;  4X66 E;  5AAS A;  1HNX E;  5AE1 A;  2UUC E;  4WPY A;  4DV2 E;  1DQ3 A;  3T1Y E;  4B3M E;  2RS7 A;  1YZ9 A;  4LTY A;  2UUA E;  1HR0 E;  4BCA A;  4LFC E;  2MC5 A;  3F6G A;  4KZS A;  2B7T A;  1DI2 A;  2UXC E;  3VYX A;  2E1M A;  1O0W A;  2EWL A;  4DV7 E;  4DR1 E;  2LTS A;  4P78 A;  1YYW A;  5IT9 C;  2UUB E;  4X8W A;  4GEQ B;  1WHQ A;  3T1H E;  4M30 A;  2LTR A;  3KWR A;  3C4B A;  4F54 A;  3ADL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...