2M1SA

Nmr assignment of the arenaviral protein z from lassa fever virus
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
99
structure length
99
Chain Sequence
MGNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAAPTAPPTGAADSIRPPPYSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING finger protein Z
publication title Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E
pubmed doi rcsb
source organism Lassa virus josiah
molecule tags Transcription
total genus 5
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03854 zf-P11 P-11 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.310 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m1sA01
2M1SA
chains in the Genus database with same CATH superfamily
4BS9A 3ADLA 5DNYA 2YU8A 2EOZA 1SR9A 2ADRA 4DR4E 2N8XA 3VHTB 3C6KA 4ZYEA 2EOEA 2L2KB 4O5GA 4WYQB 2EN6A 4DV7E 3BF2A 1BB8A 1T4LB 1I94E 2RS6A 1STUA 3RMPA 5LL6R 1KYQA 1RQ0A 2LMZA 3EPKA 1TN9A 1HNZE 3HTXA 1NCSA 2L6MA 4OX9E 2L33A 4LF5E 3THNA 2EMIA 2EMLA 2JOXA 4B3SE 2LVHA 3EPJA 2EM8A 4I8OA 2I9IA 4GEQB 1XMOE 5A6JA 2ODRD 2UUCE 1YYWA 1SFEA 2HC5A 4YY3E 4L5NC 2YTNA 4IJDA 4R2PA 2K4VA 1YUJA 5A6AA 2NUFA 2F4VE 1MGTA 2YTIA 4M30A 5IWAE 4JI5E 2E5LE 3BGHA 2ZM6E 5KL5A 1EH7A 4R2CA 2DIXA 1N3GA 4DV3E 2B3TB 2M7QA 2WBTA 5TSEA 4DV2E 2GPIA 2EMZA 2J7JA 2NABA 4X65E 1N32E 1X3CA 4DR3E 2VQEE 2EM3A 2UXCE 2NA2A 3OMLA 4JI4E 2EM7A 2PRTA 5AE3A 1B69A 3HPSA 3AUZA 5AASA 4F9CB 1P47A 3K6QA 2YRKA 3BBGA 3JU0A 1A1IA 2UXDE 4R2EA 4DUZE 3HPZA 5IV8B 2VF1A 2BB8A 1T4NA 1J5EE 3FIGA 4GZNC 1T4OA 4FK5C 1UBDC 2EORA 2RQLA 2UXBE 2EM6A 3ADJA 2LCEA 1IBLE 1YZ9A 1WJPA 1TF6A 2YTDA 3J81C 2L2NA 2NUGA 2G7HA 1FJGE 2UU9E 2V83A 3KWRA 4LTYA 2KONA 2ELZA 2VE7C 2LJHA 4F2JC 4KWYA 1ZR9A 4MLQA 4Q35B 4P78A 2EM9A 2DLQA 2EM5A 4DR2E 1NEIA 4MLVA 1Z1BA 2YTFA 4P7DA 2L2MA 3IWCA 3EQ1A 4M0VA 3C6MA 4R8OA 2EMYA 2JPAA 4JI0E 2CPNA 4JI1E 5AC4A 5LMUE 2EOHA 3ADGA 3F6HA 2YTEA 2YSPA 2LBSB 2V86A 2LO3A 2WBSA 2R1FA 4R2SA 4WXCA 1FKAE 5A2QC 1DGCA 2DMYA 3J7AG 2EPLX 4DR6E 1BBOA 1EH6A 2EMXA 1QU6A 4HEIA 2LJUA 2B7TA 1XMQE 2GLIA 4LF4E 2JR1A 4BMJA 4L8NA 2WBUA 1YYOA 2UUAE 4B3RE 3J80C 3ZOQB 3ADIA 4R2DA 2EPRA 1G2FC 2KHXA 2WZOA 4DV6E 5F3WA 1IMUA 4ZYDA 2JY9A 4WPYA 4JI7E 3HQ1A 1ZBTA 2M1SA 4DR5E 4F54A 3JAMC 4JI3E 2RSMA 3LLHA 1N36E 1IQSA 1JK2A 4GKKE 2YRHA 3T1YE 4K0KE 2LT7A 3F6GA 2HGHA 4YHHE 1F2IG 5LMNE 2LV2A 2EOYA 2RTXA 1YFHA 1EH8A 3MHSC 2DLKA 3TQMA 4DR7E 2M9AA 2HJJA 4LF6E 2EZ6A 4BHBA 1PJQA 2CSHA 2EPOA 3ECRA 2JP9A 2EOQA 2YSOA 4O24A 2RS7A 4M2ZA 2FTXB 2EE8A 4X62E 2JVAA 5KL4A 2YT4A 2RPCA 2YTJA 4BC7A 2CTDA 3IWDA 4DKKA 2BBGA 4NXME 1X48A 2EN8A 1EKZA 4BBYA 2ELYA 2N3HA 2JWOA 2EPMX 3BIDA 4ZYHA 2EPXA 2EN1A 4BHCA 2DRPA 1O0WA 2EPZA 1ZAAC 2YTPA 2V88A 4JI6E 4HTGA 4GKJE 4F6NA 1BBGA 2EL5A 5KL7A 3VYYA 5A6BA 4OOGC 2EL6A 1AH5A 2KOUA 5KL3A 4R2QA 1A1KA 4DV5E 2EMBA 2EOOA 2YTGA 3C4BA 4DV4E 5A6KA 1WHQA 4Q28A 3L00A 2CT1A 3AV0A 2MKNA 1ZU1A 2MDRA 1MEYC 5KL6A 2V8QB 4RHBB 4JI2E 1IBME 1PDAA 2EJ4A 2DSYA 2YPNA 2UUBE 2E1MA 2MC5A 2F8BA 1GQEA 1HNWE 2L3CA 2VQFE 1YYKA 2D9HA 3OTOE 4LFCE 2EMAA 5CFFE 4NXNE 2L3JA 1XNQE 1QNTA 2MKDA 1HNXE 2LTSA 2YTQA 4O4KA 4JI8E 4LU9A 5AE1A 1TF3A 5A6BD 1KJKA 4F9BB 1AAYA 2YU5A 3DF6A 1RMDA 1LLMC 2EQ0A 2EPAA 5LLQA 1XNRE 2LUPB 3HXLA 4DMIA 3H09A 2YWQA 4IS1C 4LFAE 4KHPE 2EOXA 2EN2A 5KL2A 3J7Yp 2L8TA 3KZZA 2EMWA 2LUQA 2N3GA 4WSPA 2EN4A 4M9VC 4F9AB 4DV1E 4AQYE 2V89A 2LTRA 2YZTA 3DJWA 1PKPA 2A25A 4X9JA 1UN6B 4JYAE 2ODRC 2EM4A 3KZYA 2M4IA 5BR8E 4J8ZA 2LRSA 2ENAA 2EM2A 1YUIA 2MDGA 2LE2A 3VYXA 2E72A 1HR0E 2EOFA 1A1GA 2EPUA 2FGGA 5FLXC 1DQ3A 3T1HE 2EOSA 2EN3A 2DMIA 4ZYGA 2EN7A 2EWLA 1WRJA 4R2AA 4B3ME 2Q8UA 2YTOA 5T6JA 3M99B 1GTKA 1PJSA 2L92A 2YRMA 1X6HA 4N4RB 4LF7E 4WSGA 3JTZA 2GHFA 1X6EA 3C4TA 4LF9E 2WCC3 1YSAC 1A1LA 1JK1A 1YPNA 2RSIA 4R2RA 2EMHA 4KZSA 1WHNA 1UILA 1A1HA 5A69A 2IHR1 2R76A 4LFBE 3P1XA 1T38A 3THOB 5AE2A 4RH8A 2K7IA 4WX9A 2EMKA 2EM0A 2EMFA 2HHHE 2EMGA 4X64E 1N33E 2DGCA 1A1JA 3EPLA 1X47A 4NZVA 1PJTA 2B7VA 1UHZA 4B3TE 2ENCA 4DR1E 2I13A 1IBKE 2MC6A 2JOBA 1IQOA 1X6FA 4F6MA 4R03A 4TUIA 2FV4B 4BC9A 4DV0E 4WXDA 2JYAA 2EOIA 4NHRA 3MSWA 2JXPA 5AC5A 2EPNA 1X49A 1T39A 2V87A 4TUGA 1GZ6A 2EOMA 1N34E 1A1FA 4O43A 1J26A 2H36X 4BCAA 1DI2A 1X5WA 1G2DC 2EOJA 5ADZA 2EQ3A 2EPPA 1WXRA 4X66E 1L4SA 2EP3A 2EQ1A 3LMLA 2EMCA 4LF8E 2NUEA 3MHHC 1RC7A 4WFTA 3EPHA 2EPKX 1ZBQA 4DUYE 4JV5E 3VK6A 2ENHA 3IWBA 2EL4A 2V85A 2B9DA 2DB2A 2VRDA 3QG5C 4X8WA 3UK3C 2EPCA 5IT9C 5IXMB
chains in the Genus database with same CATH topology
3IWDA 4BS9A 4DKKA 3ADLA 1IBLE 2M4IA 1YZ9A 5BR8E 5DNYA 4J8ZA 4NXME 2LRSA 3J81C 1X48A 2L2NA 1SR9A 1EKZA 2NUGA 2G7HA 4BBYA 1FJGE 2UU9E 2N3HA 2LE2A 2V83A 3VYXA 3KWRA 1HR0E 4DR4E 2JWOA 4LTYA 2KONA 2VE7C 2LJHA 2FGGA 5FLXC 1DQ3A 3T1HE 4P78A 2L2KB 1O0WA 4DR2E 4WYQB 2EWLA 2V88A 4DV7E 4B3ME 4JI6E 4P7DA 5T6JA 1T4LB 4GKJE 1I94E 2L2MA 2RS6A 3IWCA 3VYYA 1STUA 4M0VA 4R8OA 4OOGC 5LL6R 1RQ0A 2LMZA 3RMPA 2L92A 2CPNA 4JI1E 4JI0E 4LF7E 1HNZE 3HTXA 3JTZA 4JYAE 4LF9E 3C4TA 2KOUA 5LMUE 4DV5E 3ADGA 2L6MA 3F6HA 4OX9E 2L33A 4LF5E 2LBSB 3C4BA 2V86A 4DV4E 2JOXA 4B3SE 1WHQA 4KZSA 4Q28A 4I8OA 4GEQB 1WHNA 5A2QC 1UILA 1XMOE 2DMYA 1FKAE 2ODRD 2UUCE 1YYWA 3J7AG 2IHR1 3AV0A 4DR6E 4YY3E 4L5NC 4LFBE 3P1XA 2K4VA 1QU6A 2MDRA 5AE2A 2NUFA 2F4VE 2B7TA 1XMQE 2HHHE 2V8QB 4X64E 4LF4E 1N33E 2JR1A 4M30A 5IWAE 4JI5E 4BMJA 4L8NA 1YYOA 2UUAE 4B3RE 3J80C 2E5LE 1X47A 3ZOQB 3ADIA 2B7VA 4JI2E 1IBME 2UUBE 1UHZA 2DSYA 2E1MA 2MC5A 2F8BA 4B3TE 2KHXA 2WZOA 4DV6E 4DR1E 1GQEA 5F3WA 1IBKE 2MC6A 2ZM6E 2JOBA 2L3CA 1HNWE 4R03A 4TUIA 2FV4B 2JY9A 3ADJA 2DIXA 4WPYA 4BC9A 2VQFE 4DV0E 2B3TB 2M7QA 4DV3E 1YYKA 4JI7E 3OTOE 4LFCE 3HQ1A 3MSWA 4DV2E 5CFFE 4NXNE 2L3JA 1ZBTA 2M1SA 1XNQE 1X49A 4DR5E 1HNXE 4F54A 3JAMC 2V87A 4TUGA 2LTSA 4JI3E 2RSMA 4X65E 3LLHA 1N36E 1N32E 1GZ6A 4DR3E 1N34E 4GKKE 4JI8E 2VQEE 3T1YE 4LU9A 4K0KE 5AE1A 2NA2A 2UXCE 1J26A 2H36X 3F6GA 3OMLA 4JI4E 4BCAA 4F9BB 4YHHE 5LMNE 1DI2A 3DF6A 2RTXA 5AE3A 1XNRE 2LUPB 3HXLA 4DMIA 3H09A 5ADZA 1WXRA 4X66E 3HPSA 4LFAE 4KHPE 3AUZA 4DR7E 5AASA 4F9CB 4LF6E 3J7Yp 2EZ6A 2L8TA 3K6QA 3JU0A 2UXDE 3LMLA 4LF8E 4DUZE 2NUEA 3HPZA 2LUQA 2VF1A 2N3GA 4WSPA 1RC7A 4WFTA 2RS7A 4F9AB 4M2ZA 1T4NA 2FTXB 4DV1E 1J5EE 1ZBQA 3FIGA 4X62E 4DUYE 4AQYE 2V89A 3VK6A 2LTRA 2JVAA 3IWBA 4JV5E 2YZTA 3DJWA 1PKPA 1T4OA 2YT4A 2V85A 4BC7A 2B9DA 2DB2A 4X8WA 2UXBE 5IT9C 2ODRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1S A; 
#chains in the Genus database with same CATH topology
 4BS9 A;  3ADL A;  5DNY A;  2YU8 A;  2EOZ A;  1SR9 A;  2ADR A;  4DR4 E;  2N8X A;  3VHT B;  3C6K A;  4ZYE A;  2EOE A;  2L2K B;  4O5G A;  4WYQ B;  2EN6 A;  4DV7 E;  3BF2 A;  1BB8 A;  1T4L B;  1I94 E;  2RS6 A;  1STU A;  3RMP A;  5LL6 R;  1KYQ A;  1RQ0 A;  2LMZ A;  3EPK A;  1TN9 A;  1HNZ E;  3HTX A;  1NCS A;  2L6M A;  4OX9 E;  2L33 A;  4LF5 E;  3THN A;  2EMI A;  2EML A;  2JOX A;  4B3S E;  2LVH A;  3EPJ A;  2EM8 A;  4I8O A;  2I9I A;  4GEQ B;  1XMO E;  5A6J A;  2ODR D;  2UUC E;  1YYW A;  1SFE A;  2HC5 A;  4YY3 E;  4L5N C;  2YTN A;  4IJD A;  4R2P A;  2K4V A;  1YUJ A;  5A6A A;  2NUF A;  2F4V E;  1MGT A;  2YTI A;  4M30 A;  5IWA E;  4JI5 E;  2E5L E;  3BGH A;  2ZM6 E;  5KL5 A;  1EH7 A;  4R2C A;  2DIX A;  1N3G A;  4DV3 E;  2B3T B;  2M7Q A;  2WBT A;  5TSE A;  4DV2 E;  2GPI A;  2EMZ A;  2J7J A;  2NAB A;  4X65 E;  1N32 E;  1X3C A;  4DR3 E;  2VQE E;  2EM3 A;  2UXC E;  2NA2 A;  3OML A;  4JI4 E;  2EM7 A;  2PRT A;  5AE3 A;  1B69 A;  3HPS A;  3AUZ A;  5AAS A;  4F9C B;  1P47 A;  3K6Q A;  2YRK A;  3BBG A;  3JU0 A;  1A1I A;  2UXD E;  4R2E A;  4DUZ E;  3HPZ A;  5IV8 B;  2VF1 A;  2BB8 A;  1T4N A;  1J5E E;  3FIG A;  4GZN C;  1T4O A;  4FK5 C;  1UBD C;  2EOR A;  2RQL A;  2UXB E;  2EM6 A;  3ADJ A;  2LCE A;  1IBL E;  1YZ9 A;  1WJP A;  1TF6 A;  2YTD A;  3J81 C;  2L2N A;  2NUG A;  2G7H A;  1FJG E;  2UU9 E;  2V83 A;  3KWR A;  4LTY A;  2KON A;  2ELZ A;  2VE7 C;  2LJH A;  4F2J C;  4KWY A;  1ZR9 A;  4MLQ A;  4Q35 B;  4P78 A;  2EM9 A;  2DLQ A;  2EM5 A;  4DR2 E;  1NEI A;  4MLV A;  1Z1B A;  2YTF A;  4P7D A;  2L2M A;  3IWC A;  3EQ1 A;  4M0V A;  3C6M A;  4R8O A;  2EMY A;  2JPA A;  4JI0 E;  2CPN A;  4JI1 E;  5AC4 A;  5LMU E;  2EOH A;  3ADG A;  3F6H A;  2YTE A;  2YSP A;  2LBS B;  2V86 A;  2LO3 A;  2WBS A;  2R1F A;  4R2S A;  4WXC A;  1FKA E;  5A2Q C;  1DGC A;  2DMY A;  3J7A G;  2EPL X;  4DR6 E;  1BBO A;  1EH6 A;  2EMX A;  1QU6 A;  4HEI A;  2LJU A;  2B7T A;  1XMQ E;  2GLI A;  4LF4 E;  2JR1 A;  4BMJ A;  4L8N A;  2WBU A;  1YYO A;  2UUA E;  4B3R E;  3J80 C;  3ZOQ B;  3ADI A;  4R2D A;  2EPR A;  1G2F C;  2KHX A;  2WZO A;  4DV6 E;  5F3W A;  1IMU A;  4ZYD A;  2JY9 A;  4WPY A;  4JI7 E;  3HQ1 A;  1ZBT A;  2M1S A;  4DR5 E;  4F54 A;  3JAM C;  4JI3 E;  2RSM A;  3LLH A;  1N36 E;  1IQS A;  1JK2 A;  4GKK E;  2YRH A;  3T1Y E;  4K0K E;  2LT7 A;  3F6G A;  2HGH A;  4YHH E;  1F2I G;  5LMN E;  2LV2 A;  2EOY A;  2RTX A;  1YFH A;  1EH8 A;  3MHS C;  2DLK A;  3TQM A;  4DR7 E;  2M9A A;  2HJJ A;  4LF6 E;  2EZ6 A;  4BHB A;  1PJQ A;  2CSH A;  2EPO A;  3ECR A;  2JP9 A;  2EOQ A;  2YSO A;  4O24 A;  2RS7 A;  4M2Z A;  2FTX B;  2EE8 A;  4X62 E;  2JVA A;  5KL4 A;  2YT4 A;  2RPC A;  2YTJ A;  4BC7 A;  2CTD A;  3IWD A;  4DKK A;  2BBG A;  4NXM E;  1X48 A;  2EN8 A;  1EKZ A;  4BBY A;  2ELY A;  2N3H A;  2JWO A;  2EPM X;  3BID A;  4ZYH A;  2EPX A;  2EN1 A;  4BHC A;  2DRP A;  1O0W A;  2EPZ A;  1ZAA C;  2YTP A;  2V88 A;  4JI6 E;  4HTG A;  4GKJ E;  4F6N A;  1BBG A;  2EL5 A;  5KL7 A;  3VYY A;  5A6B A;  4OOG C;  2EL6 A;  1AH5 A;  2KOU A;  5KL3 A;  4R2Q A;  1A1K A;  4DV5 E;  2EMB A;  2EOO A;  2YTG A;  3C4B A;  4DV4 E;  5A6K A;  1WHQ A;  4Q28 A;  3L00 A;  2CT1 A;  3AV0 A;  2MKN A;  1ZU1 A;  2MDR A;  1MEY C;  5KL6 A;  2V8Q B;  4RHB B;  4JI2 E;  1IBM E;  1PDA A;  2EJ4 A;  2DSY A;  2YPN A;  2UUB E;  2E1M A;  2MC5 A;  2F8B A;  1GQE A;  1HNW E;  2L3C A;  2VQF E;  1YYK A;  2D9H A;  3OTO E;  4LFC E;  2EMA A;  5CFF E;  4NXN E;  2L3J A;  1XNQ E;  1QNT A;  2MKD A;  1HNX E;  2LTS A;  2YTQ A;  4O4K A;  4JI8 E;  4LU9 A;  5AE1 A;  1TF3 A;  5A6B D;  1KJK A;  4F9B B;  1AAY A;  2YU5 A;  3DF6 A;  1RMD A;  1LLM C;  2EQ0 A;  2EPA A;  5LLQ A;  1XNR E;  2LUP B;  3HXL A;  4DMI A;  3H09 A;  2YWQ A;  4IS1 C;  4LFA E;  4KHP E;  2EOX A;  2EN2 A;  5KL2 A;  3J7Y p;  2L8T A;  3KZZ A;  2EMW A;  2LUQ A;  2N3G A;  4WSP A;  2EN4 A;  4M9V C;  4F9A B;  4DV1 E;  4AQY E;  2V89 A;  2LTR A;  2YZT A;  3DJW A;  1PKP A;  2A25 A;  4X9J A;  1UN6 B;  4JYA E;  2ODR C;  2EM4 A;  3KZY A;  2M4I A;  5BR8 E;  4J8Z A;  2LRS A;  2ENA A;  2EM2 A;  1YUI A;  2MDG A;  2LE2 A;  3VYX A;  2E72 A;  1HR0 E;  2EOF A;  1A1G A;  2EPU A;  2FGG A;  5FLX C;  1DQ3 A;  3T1H E;  2EOS A;  2EN3 A;  2DMI A;  4ZYG A;  2EN7 A;  2EWL A;  1WRJ A;  4R2A A;  4B3M E;  2Q8U A;  2YTO A;  5T6J A;  3M99 B;  1GTK A;  1PJS A;  2L92 A;  2YRM A;  1X6H A;  4N4R B;  4LF7 E;  4WSG A;  3JTZ A;  2GHF A;  1X6E A;  3C4T A;  4LF9 E;  2WCC 3;  1YSA C;  1A1L A;  1JK1 A;  1YPN A;  2RSI A;  4R2R A;  2EMH A;  4KZS A;  1WHN A;  1UIL A;  1A1H A;  5A69 A;  2IHR 1;  2R76 A;  4LFB E;  3P1X A;  1T38 A;  3THO B;  5AE2 A;  4RH8 A;  2K7I A;  4WX9 A;  2EMK A;  2EM0 A;  2EMF A;  2HHH E;  2EMG A;  4X64 E;  1N33 E;  2DGC A;  1A1J A;  3EPL A;  1X47 A;  4NZV A;  1PJT A;  2B7V A;  1UHZ A;  4B3T E;  2ENC A;  4DR1 E;  2I13 A;  1IBK E;  2MC6 A;  2JOB A;  1IQO A;  1X6F A;  4F6M A;  4R03 A;  4TUI A;  2FV4 B;  4BC9 A;  4DV0 E;  4WXD A;  2JYA A;  2EOI A;  4NHR A;  3MSW A;  2JXP A;  5AC5 A;  2EPN A;  1X49 A;  1T39 A;  2V87 A;  4TUG A;  1GZ6 A;  2EOM A;  1N34 E;  1A1F A;  4O43 A;  1J26 A;  2H36 X;  4BCA A;  1DI2 A;  1X5W A;  1G2D C;  2EOJ A;  5ADZ A;  2EQ3 A;  2EPP A;  1WXR A;  4X66 E;  1L4S A;  2EP3 A;  2EQ1 A;  3LML A;  2EMC A;  4LF8 E;  2NUE A;  3MHH C;  1RC7 A;  4WFT A;  3EPH A;  2EPK X;  1ZBQ A;  4DUY E;  4JV5 E;  3VK6 A;  2ENH A;  3IWB A;  2EL4 A;  2V85 A;  2B9D A;  2DB2 A;  2VRD A;  3QG5 C;  4X8W A;  3UK3 C;  2EPC A;  5IT9 C;  5IXM B; 
#chains in the Genus database with same CATH homology
 3IWD A;  4BS9 A;  4DKK A;  3ADL A;  1IBL E;  2M4I A;  1YZ9 A;  5BR8 E;  5DNY A;  4J8Z A;  4NXM E;  2LRS A;  3J81 C;  1X48 A;  2L2N A;  1SR9 A;  1EKZ A;  2NUG A;  2G7H A;  4BBY A;  1FJG E;  2UU9 E;  2N3H A;  2LE2 A;  2V83 A;  3VYX A;  3KWR A;  1HR0 E;  4DR4 E;  2JWO A;  4LTY A;  2KON A;  2VE7 C;  2LJH A;  2FGG A;  5FLX C;  1DQ3 A;  3T1H E;  4P78 A;  2L2K B;  1O0W A;  4DR2 E;  4WYQ B;  2EWL A;  2V88 A;  4DV7 E;  4B3M E;  4JI6 E;  4P7D A;  5T6J A;  1T4L B;  4GKJ E;  1I94 E;  2L2M A;  2RS6 A;  3IWC A;  3VYY A;  1STU A;  4M0V A;  4R8O A;  4OOG C;  5LL6 R;  1RQ0 A;  2LMZ A;  3RMP A;  2L92 A;  2CPN A;  4JI1 E;  4JI0 E;  4LF7 E;  1HNZ E;  3HTX A;  3JTZ A;  4JYA E;  4LF9 E;  3C4T A;  2KOU A;  5LMU E;  4DV5 E;  3ADG A;  2L6M A;  3F6H A;  4OX9 E;  2L33 A;  4LF5 E;  2LBS B;  3C4B A;  2V86 A;  4DV4 E;  2JOX A;  4B3S E;  1WHQ A;  4KZS A;  4Q28 A;  4I8O A;  4GEQ B;  1WHN A;  5A2Q C;  1UIL A;  1XMO E;  2DMY A;  1FKA E;  2ODR D;  2UUC E;  1YYW A;  3J7A G;  2IHR 1;  3AV0 A;  4DR6 E;  4YY3 E;  4L5N C;  4LFB E;  3P1X A;  2K4V A;  1QU6 A;  2MDR A;  5AE2 A;  2NUF A;  2F4V E;  2B7T A;  1XMQ E;  2HHH E;  2V8Q B;  4X64 E;  4LF4 E;  1N33 E;  2JR1 A;  4M30 A;  5IWA E;  4JI5 E;  4BMJ A;  4L8N A;  1YYO A;  2UUA E;  4B3R E;  3J80 C;  2E5L E;  1X47 A;  3ZOQ B;  3ADI A;  2B7V A;  4JI2 E;  1IBM E;  2UUB E;  1UHZ A;  2DSY A;  2E1M A;  2MC5 A;  2F8B A;  4B3T E;  2KHX A;  2WZO A;  4DV6 E;  4DR1 E;  1GQE A;  5F3W A;  1IBK E;  2MC6 A;  2ZM6 E;  2JOB A;  2L3C A;  1HNW E;  4R03 A;  4TUI A;  2FV4 B;  2JY9 A;  3ADJ A;  2DIX A;  4WPY A;  4BC9 A;  2VQF E;  4DV0 E;  2B3T B;  2M7Q A;  4DV3 E;  1YYK A;  4JI7 E;  3OTO E;  4LFC E;  3HQ1 A;  3MSW A;  4DV2 E;  5CFF E;  4NXN E;  2L3J A;  1ZBT A;  2M1S A;  1XNQ E;  1X49 A;  4DR5 E;  1HNX E;  4F54 A;  3JAM C;  2V87 A;  4TUG A;  2LTS A;  4JI3 E;  2RSM A;  4X65 E;  3LLH A;  1N36 E;  1N32 E;  1GZ6 A;  4DR3 E;  1N34 E;  4GKK E;  4JI8 E;  2VQE E;  3T1Y E;  4LU9 A;  4K0K E;  5AE1 A;  2NA2 A;  2UXC E;  1J26 A;  2H36 X;  3F6G A;  3OML A;  4JI4 E;  4BCA A;  4F9B B;  4YHH E;  5LMN E;  1DI2 A;  3DF6 A;  2RTX A;  5AE3 A;  1XNR E;  2LUP B;  3HXL A;  4DMI A;  3H09 A;  5ADZ A;  1WXR A;  4X66 E;  3HPS A;  4LFA E;  4KHP E;  3AUZ A;  4DR7 E;  5AAS A;  4F9C B;  4LF6 E;  3J7Y p;  2EZ6 A;  2L8T A;  3K6Q A;  3JU0 A;  2UXD E;  3LML A;  4LF8 E;  4DUZ E;  2NUE A;  3HPZ A;  2LUQ A;  2VF1 A;  2N3G A;  4WSP A;  1RC7 A;  4WFT A;  2RS7 A;  4F9A B;  4M2Z A;  1T4N A;  2FTX B;  4DV1 E;  1J5E E;  1ZBQ A;  3FIG A;  4X62 E;  4DUY E;  4AQY E;  2V89 A;  3VK6 A;  2LTR A;  2JVA A;  3IWB A;  4JV5 E;  2YZT A;  3DJW A;  1PKP A;  1T4O A;  2YT4 A;  2V85 A;  4BC7 A;  2B9D A;  2DB2 A;  4X8W A;  2UXB E;  5IT9 C;  2ODR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...