2M1SA

Nmr assignment of the arenaviral protein z from lassa fever virus
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
99
structure length
99
Chain Sequence
b'MGNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAAPTAPPTGAADSIRPPPYSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING finger protein Z
publication title Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E
pubmed doi rcsb
source organism Lassa virus josiah
molecule tags Transcription
total genus 5
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03854 zf-P11 P-11 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.310 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m1sA01
2M1SA
chains in the Genus database with same CATH superfamily
4JI2E 1X49A 4LF4E 4LF8E 2UXBE 2EM8A 1T4LB 2JY9A 4AQYE 1KYQA 1A1JA 4LFCE 2KOUA 2YRKA 5AE2A 3ADLA 2EOYA 2JVAA 2L6MA 2WCC3 2MKDA 1ZBQA 4KHPE 2LUPB 4X9JA 4DV7E 4KZSA 1N33E 1XMQE 2E72A 3BIDA 2EN4A 2L2MA 4LF6E 2EOMA 1EH6A 1PJTA 2RQLA 2HC5A 4MLVA 1Z1BA 3ADJA 2EMXA 2YRHA 2EPPA 4B3SE 2M9AA 3H09A 2R76A 2BBGA 3HPSA 1P47A 2F8BA 2JWOA 4FK5C 2GPIA 3AV0A 2M4IA 1AH5A 4DUZE 2YTQA 2YTFA 3LLHA 1IBLE 5LLQA 4DR4E 2EQ3A 1DGCA 4DUYE 1FJGE 3MSWA 4JI0E 1J26A 3BF2A 4DV3E 4R8OA 3DF6A 5IWAE 1TN9A 2N8XA 4M0VA 2I9IA 2ENAA 3LMLA 1ZU1A 5T6JA 5IV8B 2EMAA 3OTOE 5TSEA 5CFFE 2K4VA 1QNTA 2EM3A 4LF5E 2DB2A 2L33A 2JYAA 1IBME 2V87A 2B7VA 2EPLX 4ZYEA 3IWCA 1RQ0A 4X65E 4L8NA 3HXLA 2E1MA 2EM5A 2WBUA 4R03A 3J7AG 2EMHA 2EMGA 2LE2A 4JV5E 2MKNA 2JOXA 2EOHA 1N34E 2YRMA 1I94E 1DI2A 3ZOQB 4KWYA 4MLQA 2EOFA 4JI7E 2HHHE 1STUA 2Q8UA 2RTXA 3KWRA 1X6HA 2ZM6E 2EPAA 1RC7A 1B69A 1WHQA 2UXDE 2LO3A 1PDAA 2YTIA 4WSGA 2VQFE 1PJSA 4O43A 5IT9C 2EN1A 5A6AA 4DV0E 1TF6A 1YYKA 2K7IA 3AUZA 1WXRA 3JTZA 5AE3A 4WX9A 4WPYA 5KL7A 2LMZA 2NA2A 3THOB 2V83A 2GHFA 4X62E 2EOIA 2E5LE 1YPNA 1AAYA 5A6BA 3F6HA 4BS9A 2EPMX 2EPUA 4JI5E 2F4VE 5AC5A 1T39A 2RPCA 2EPRA 2EM6A 4R2RA 2EM9A 1HR0E 3MHSC 2LTRA 2EN2A 1PJQA 2CSHA 1YUJA 4DV2E 2EMCA 2DIXA 1UILA 3ECRA 3F6GA 2EQ0A 2NABA 1N3GA 1ZBTA 2EPCA 5ADZA 4M2ZA 5LMNE 1A1GA 4LF9E 3HPZA 2WBTA 4M9VC 1IMUA 2L8TA 1HNZE 3IWDA 2EM7A 2CPNA 2HJJA 4LU9A 2M7QA 2FGGA 2LV2A 1MGTA 2J7JA 2YSPA 1L4SA 2VF1A 3C6KA 1GTKA 4GEQB 2FTXB 1XNRE 3MHHC 4IJDA 4WFTA 3KZZA 1SR9A 5AASA 1UHZA 2YWQA 4LTYA 3RMPA 4OX9E 4YY3E 3BBGA 2GLIA 4GKJE 4NHRA 2MDGA 3THNA 4YHHE 2L3JA 4LF7E 4GKKE 5FLXC 4JI1E 2UUAE 2DSYA 4F54A 2A25A 1X6FA 2RSIA 1A1FA 2LTSA 4TUIA 4R2DA 1XNQE 4BHCA 4O24A 2LJHA 1IBKE 2EPXA 2V88A 2R1FA 4BMJA 1NEIA 2EMLA 2EN7A 2B7TA 4WYQB 4M30A 3C4BA 4J8ZA 2NUFA 2UUBE 5A6JA 2YPNA 4BC7A 5KL5A 4R2CA 2EPKX 1G2DC 3BGHA 4JI6E 2RS7A 4LFAE 2V8QB 2LUQA 4ZYHA 2EN6A 4WSPA 2B9DA 2V89A 2L92A 4NZVA 1ZAAC 4DR2E 2NUEA 2MC6A 4BCAA 4RHBB 2EWLA 2RSMA 2YT4A 5LL6R 3C6MA 2ODRD 5IXMB 4L5NC 1HNXE 2EMFA 1JK2A 4ZYDA 2D9HA 3JAMC 2V86A 2EMIA 3EPLA 4K0KE 4Q28A 4B3ME 1IQOA 4WXCA 4DV4E 2N3HA 1YUIA 5A69A 3OMLA 4DV1E 3C4TA 5KL3A 2EOZA 2YTDA 2YZTA 1NCSA 2DMIA 2EN8A 1A1IA 3HQ1A 3IWBA 1MEYC 2EZ6A 2IHR1 2YSOA 2EMYA 1IQSA 1SFEA 1YZ9A 5LMUE 3VK6A 1RMDA 2EE8A 1X5WA 1X47A 1GZ6A 5A2QC 4Q35B 2YTGA 2JXPA 2NUGA 2EOXA 5KL6A 5A6KA 2EOEA 1QU6A 4R2SA 2V85A 5KL2A 1LLMC 2EL6A 2MDRA 3VYXA 2EMWA 1XMOE 1WHNA 1WRJA 4JI4E 1HNWE 5BR8E 2BB8A 2KHXA 4HTGA 1N32E 2LRSA 4R2QA 3K6QA 1X48A 1X3CA 2EOSA 2LVHA 4HEIA 2DGCA 2DRPA 1F2IG 1YYWA 2UUCE 2WBSA 4F9CB 1T38A 2G7HA 4DV6E 4X66E 4R2AA 4F6NA 4TUGA 4N4RB 1O0WA 2VRDA 4DKKA 5KL4A 3HTXA 2ADRA 2DMYA 2FV4B 4I8OA 1BBGA 3KZYA 1EH8A 1KJKA 3ADGA 4O5GA 4P78A 4DV5E 1FKAE 3J81C 1YYOA 3L00A 1N36E 2EOQA 2EMBA 2ENHA 2ELZA 5AC4A 2DLKA 4BHBA 2HGHA 1YFHA 4JI3E 2EL5A 2N3GA 4B3RE 5AE1A 1T4NA 2EPNA 4BC9A 4DMIA 4DR5E 4GZNC 3M99B 2JOBA 3T1HE 1UN6B 2ODRC 2EPOA 5F3WA 2EMKA 4F9BB 1X6EA 2EM2A 2VQEE 3VHTB 2RS6A 2LBSB 2LT7A 4IS1C 2JPAA 4DR3E 1J5EE 1DQ3A 3VYYA 4BBYA 2H36X 2EM0A 3EPKA 4OOGC 1A1KA 4JI8E 1ZR9A 3JU0A 1GQEA 5A6BD 1EKZA 4RH8A 5DNYA 1PKPA 2YTPA 2L2NA 3J80C 1BB8A 4P7DA 1A1HA 2M1SA 4F2JC 4F9AB 2EP3A 2L2KB 2YTEA 2ELYA 4NXME 2JP9A 4R2EA 2CT1A 1G2FC 2EL4A 3FIGA 2KONA 3EPHA 1A1LA 4ZYGA 4X8WA 2EN3A 4LFBE 2EJ4A 2YU5A 3J7Yp 2ENCA 4R2PA 4F6MA 3QG5C 2EOJA 2LCEA 1WJPA 4X64E 1EH7A 4DR1E 2WZOA 4B3TE 3UK3C 4DR7E 4JYAE 3ADIA 4WXDA 2B3TB 3P1XA 1YSAC 1TF3A 3EPJA 2VE7C 3EQ1A 2I13A 2LJUA 2EPZA 2EORA 2EOOA 2L3CA 2YTNA 4DR6E 3T1YE 1BBOA 1JK1A 3TQMA 2EM4A 2PRTA 2YU8A 1T4OA 2DLQA 2CTDA 2EQ1A 2UXCE 3DJWA 1UBDC 4NXNE 2MC5A 2YTJA 2YTOA 4O4KA 2UU9E 2EMZA 2JR1A
chains in the Genus database with same CATH topology
4JI2E 4M30A 3C4BA 1X49A 2N3GA 4J8ZA 2VQFE 5AE1A 2NUFA 2UUBE 1T4NA 4LF4E 4BC9A 4DMIA 4DR5E 4LF8E 5IT9C 2JOBA 2UXBE 4BC7A 1T4LB 3T1HE 2JY9A 4DV0E 4AQYE 1YYKA 2ODRC 4JI6E 4LFAE 2RS7A 2V8QB 5F3WA 2LUQA 3AUZA 4F9BB 4LFCE 4WSPA 1WXRA 2B9DA 2KOUA 3JTZA 5AE3A 2VQEE 2V89A 4WPYA 2RS6A 2L92A 5AE2A 2LMZA 2NA2A 2LBSB 2JVAA 2L6MA 4DR2E 3ADLA 2V83A 1ZBQA 4KHPE 2LUPB 4DV7E 4DR3E 2NUEA 4KZSA 1J5EE 1N33E 2MC6A 4BCAA 1XMQE 1DQ3A 3VYYA 2EWLA 2RSMA 2YT4A 5LL6R 4X62E 4BBYA 2H36X 2ODRD 2E5LE 4L5NC 1HNXE 2L2MA 4LF6E 4OOGC 3F6HA 4BS9A 4JI8E 3JAMC 2V86A 3JU0A 1GQEA 4B3RE 4JI5E 1EKZA 3ADJA 4DR7E 4K0KE 4Q28A 2F4VE 5DNYA 4B3ME 1PKPA 4DV4E 2N3HA 4B3SE 3H09A 2L2NA 3J80C 3HPSA 3OMLA 4DV1E 3C4TA 4P7DA 1HR0E 2F8BA 2JWOA 2M1SA 2LTRA 2YZTA 4F9AB 3AV0A 3HQ1A 3IWBA 2EZ6A 2IHR1 2M4IA 2L2KB 4DUZE 4DV2E 1IBLE 3LLHA 4NXME 1YZ9A 4DR4E 5LMUE 4DUYE 2DIXA 1UILA 3FIGA 3VK6A 3F6GA 1FJGE 3MSWA 2KONA 4JI0E 1ZBTA 4DV3E 1J26A 4X8WA 1X47A 4LFBE 1GZ6A 5ADZA 5A2QC 4M2ZA 2NUGA 4R8OA 5LMNE 3J7Yp 3DF6A 5IWAE 1QU6A 4LF9E 3HPZA 2V85A 4M0VA 2L8TA 1HNZE 3LMLA 5T6JA 3IWDA 2MDRA 3VYXA 3OTOE 2CPNA 1XMOE 5CFFE 1WHNA 4LU9A 4JI4E 4X64E 2K4VA 4DR1E 1HNWE 4LF5E 2DB2A 2M7QA 2L33A 2FGGA 2WZOA 5BR8E 4B3TE 2KHXA 1IBME 1N32E 3ADIA 2LRSA 2V87A 4JYAE 2B7VA 2B3TB 3P1XA 3K6QA 1X48A 2VF1A 3IWCA 4GEQB 1RQ0A 2FTXB 4X65E 1XNRE 4L8NA 2VE7C 2E1MA 3HXLA 1YYWA 2UUCE 4WFTA 4F9CB 1SR9A 2G7HA 4R03A 5AASA 1UHZA 4DV6E 3J7AG 4X66E 2L3CA 4TUGA 1O0WA 4DR6E 4LTYA 3RMPA 3T1YE 4OX9E 2LE2A 4YY3E 4GKJE 4JV5E 2JOXA 4DKKA 1N34E 3HTXA 4YHHE 2DMYA 2FV4B 4I8OA 2L3JA 1I94E 3ZOQB 4LF7E 4GKKE 1DI2A 5FLXC 4JI1E 1T4OA 4JI7E 2DSYA 1STUA 2RTXA 3ADGA 4F54A 2HHHE 3KWRA 2LTSA 2UUAE 4P78A 4DV5E 1FKAE 4TUIA 3J81C 2ZM6E 1XNQE 1YYOA 1N36E 2UXCE 3DJWA 1RC7A 2LJHA 1IBKE 4NXNE 1WHQA 2MC5A 2V88A 2UU9E 4BMJA 2UXDE 2JR1A 4WYQB 2B7TA 4JI3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1S A; 
#chains in the Genus database with same CATH topology
 4JI2 E;  1X49 A;  4LF4 E;  4LF8 E;  2UXB E;  2EM8 A;  1T4L B;  2JY9 A;  4AQY E;  1KYQ A;  1A1J A;  4LFC E;  2KOU A;  2YRK A;  5AE2 A;  3ADL A;  2EOY A;  2JVA A;  2L6M A;  2WCC 3;  2MKD A;  1ZBQ A;  4KHP E;  2LUP B;  4X9J A;  4DV7 E;  4KZS A;  1N33 E;  1XMQ E;  2E72 A;  3BID A;  2EN4 A;  2L2M A;  4LF6 E;  2EOM A;  1EH6 A;  1PJT A;  2RQL A;  2HC5 A;  4MLV A;  1Z1B A;  3ADJ A;  2EMX A;  2YRH A;  2EPP A;  4B3S E;  2M9A A;  3H09 A;  2R76 A;  2BBG A;  3HPS A;  1P47 A;  2F8B A;  2JWO A;  4FK5 C;  2GPI A;  3AV0 A;  2M4I A;  1AH5 A;  4DUZ E;  2YTQ A;  2YTF A;  3LLH A;  1IBL E;  5LLQ A;  4DR4 E;  2EQ3 A;  1DGC A;  4DUY E;  1FJG E;  3MSW A;  4JI0 E;  1J26 A;  3BF2 A;  4DV3 E;  4R8O A;  3DF6 A;  5IWA E;  1TN9 A;  2N8X A;  4M0V A;  2I9I A;  2ENA A;  3LML A;  1ZU1 A;  5T6J A;  5IV8 B;  2EMA A;  3OTO E;  5TSE A;  5CFF E;  2K4V A;  1QNT A;  2EM3 A;  4LF5 E;  2DB2 A;  2L33 A;  2JYA A;  1IBM E;  2V87 A;  2B7V A;  2EPL X;  4ZYE A;  3IWC A;  1RQ0 A;  4X65 E;  4L8N A;  3HXL A;  2E1M A;  2EM5 A;  2WBU A;  4R03 A;  3J7A G;  2EMH A;  2EMG A;  2LE2 A;  4JV5 E;  2MKN A;  2JOX A;  2EOH A;  1N34 E;  2YRM A;  1I94 E;  1DI2 A;  3ZOQ B;  4KWY A;  4MLQ A;  2EOF A;  4JI7 E;  2HHH E;  1STU A;  2Q8U A;  2RTX A;  3KWR A;  1X6H A;  2ZM6 E;  2EPA A;  1RC7 A;  1B69 A;  1WHQ A;  2UXD E;  2LO3 A;  1PDA A;  2YTI A;  4WSG A;  2VQF E;  1PJS A;  4O43 A;  5IT9 C;  2EN1 A;  5A6A A;  4DV0 E;  1TF6 A;  1YYK A;  2K7I A;  3AUZ A;  1WXR A;  3JTZ A;  5AE3 A;  4WX9 A;  4WPY A;  5KL7 A;  2LMZ A;  2NA2 A;  3THO B;  2V83 A;  2GHF A;  4X62 E;  2EOI A;  2E5L E;  1YPN A;  1AAY A;  5A6B A;  3F6H A;  4BS9 A;  2EPM X;  2EPU A;  4JI5 E;  2F4V E;  5AC5 A;  1T39 A;  2RPC A;  2EPR A;  2EM6 A;  4R2R A;  2EM9 A;  1HR0 E;  3MHS C;  2LTR A;  2EN2 A;  1PJQ A;  2CSH A;  1YUJ A;  4DV2 E;  2EMC A;  2DIX A;  1UIL A;  3ECR A;  3F6G A;  2EQ0 A;  2NAB A;  1N3G A;  1ZBT A;  2EPC A;  5ADZ A;  4M2Z A;  5LMN E;  1A1G A;  4LF9 E;  3HPZ A;  2WBT A;  4M9V C;  1IMU A;  2L8T A;  1HNZ E;  3IWD A;  2EM7 A;  2CPN A;  2HJJ A;  4LU9 A;  2M7Q A;  2FGG A;  2LV2 A;  1MGT A;  2J7J A;  2YSP A;  1L4S A;  2VF1 A;  3C6K A;  1GTK A;  4GEQ B;  2FTX B;  1XNR E;  3MHH C;  4IJD A;  4WFT A;  3KZZ A;  1SR9 A;  5AAS A;  1UHZ A;  2YWQ A;  4LTY A;  3RMP A;  4OX9 E;  4YY3 E;  3BBG A;  2GLI A;  4GKJ E;  4NHR A;  2MDG A;  3THN A;  4YHH E;  2L3J A;  4LF7 E;  4GKK E;  5FLX C;  4JI1 E;  2UUA E;  2DSY A;  4F54 A;  2A25 A;  1X6F A;  2RSI A;  1A1F A;  2LTS A;  4TUI A;  4R2D A;  1XNQ E;  4BHC A;  4O24 A;  2LJH A;  1IBK E;  2EPX A;  2V88 A;  2R1F A;  4BMJ A;  1NEI A;  2EML A;  2EN7 A;  2B7T A;  4WYQ B;  4M30 A;  3C4B A;  4J8Z A;  2NUF A;  2UUB E;  5A6J A;  2YPN A;  4BC7 A;  5KL5 A;  4R2C A;  2EPK X;  1G2D C;  3BGH A;  4JI6 E;  2RS7 A;  4LFA E;  2V8Q B;  2LUQ A;  4ZYH A;  2EN6 A;  4WSP A;  2B9D A;  2V89 A;  2L92 A;  4NZV A;  1ZAA C;  4DR2 E;  2NUE A;  2MC6 A;  4BCA A;  4RHB B;  2EWL A;  2RSM A;  2YT4 A;  5LL6 R;  3C6M A;  2ODR D;  5IXM B;  4L5N C;  1HNX E;  2EMF A;  1JK2 A;  4ZYD A;  2D9H A;  3JAM C;  2V86 A;  2EMI A;  3EPL A;  4K0K E;  4Q28 A;  4B3M E;  1IQO A;  4WXC A;  4DV4 E;  2N3H A;  1YUI A;  5A69 A;  3OML A;  4DV1 E;  3C4T A;  5KL3 A;  2EOZ A;  2YTD A;  2YZT A;  1NCS A;  2DMI A;  2EN8 A;  1A1I A;  3HQ1 A;  3IWB A;  1MEY C;  2EZ6 A;  2IHR 1;  2YSO A;  2EMY A;  1IQS A;  1SFE A;  1YZ9 A;  5LMU E;  3VK6 A;  1RMD A;  2EE8 A;  1X5W A;  1X47 A;  1GZ6 A;  5A2Q C;  4Q35 B;  2YTG A;  2JXP A;  2NUG A;  2EOX A;  5KL6 A;  5A6K A;  2EOE A;  1QU6 A;  4R2S A;  2V85 A;  5KL2 A;  1LLM C;  2EL6 A;  2MDR A;  3VYX A;  2EMW A;  1XMO E;  1WHN A;  1WRJ A;  4JI4 E;  1HNW E;  5BR8 E;  2BB8 A;  2KHX A;  4HTG A;  1N32 E;  2LRS A;  4R2Q A;  3K6Q A;  1X48 A;  1X3C A;  2EOS A;  2LVH A;  4HEI A;  2DGC A;  2DRP A;  1F2I G;  1YYW A;  2UUC E;  2WBS A;  4F9C B;  1T38 A;  2G7H A;  4DV6 E;  4X66 E;  4R2A A;  4F6N A;  4TUG A;  4N4R B;  1O0W A;  2VRD A;  4DKK A;  5KL4 A;  3HTX A;  2ADR A;  2DMY A;  2FV4 B;  4I8O A;  1BBG A;  3KZY A;  1EH8 A;  1KJK A;  3ADG A;  4O5G A;  4P78 A;  4DV5 E;  1FKA E;  3J81 C;  1YYO A;  3L00 A;  1N36 E;  2EOQ A;  2EMB A;  2ENH A;  2ELZ A;  5AC4 A;  2DLK A;  4BHB A;  2HGH A;  1YFH A;  4JI3 E;  2EL5 A;  2N3G A;  4B3R E;  5AE1 A;  1T4N A;  2EPN A;  4BC9 A;  4DMI A;  4DR5 E;  4GZN C;  3M99 B;  2JOB A;  3T1H E;  1UN6 B;  2ODR C;  2EPO A;  5F3W A;  2EMK A;  4F9B B;  1X6E A;  2EM2 A;  2VQE E;  3VHT B;  2RS6 A;  2LBS B;  2LT7 A;  4IS1 C;  2JPA A;  4DR3 E;  1J5E E;  1DQ3 A;  3VYY A;  4BBY A;  2H36 X;  2EM0 A;  3EPK A;  4OOG C;  1A1K A;  4JI8 E;  1ZR9 A;  3JU0 A;  1GQE A;  5A6B D;  1EKZ A;  4RH8 A;  5DNY A;  1PKP A;  2YTP A;  2L2N A;  3J80 C;  1BB8 A;  4P7D A;  1A1H A;  2M1S A;  4F2J C;  4F9A B;  2EP3 A;  2L2K B;  2YTE A;  2ELY A;  4NXM E;  2JP9 A;  4R2E A;  2CT1 A;  1G2F C;  2EL4 A;  3FIG A;  2KON A;  3EPH A;  1A1L A;  4ZYG A;  4X8W A;  2EN3 A;  4LFB E;  2EJ4 A;  2YU5 A;  3J7Y p;  2ENC A;  4R2P A;  4F6M A;  3QG5 C;  2EOJ A;  2LCE A;  1WJP A;  4X64 E;  1EH7 A;  4DR1 E;  2WZO A;  4B3T E;  3UK3 C;  4DR7 E;  4JYA E;  3ADI A;  4WXD A;  2B3T B;  3P1X A;  1YSA C;  1TF3 A;  3EPJ A;  2VE7 C;  3EQ1 A;  2I13 A;  2LJU A;  2EPZ A;  2EOR A;  2EOO A;  2L3C A;  2YTN A;  4DR6 E;  3T1Y E;  1BBO A;  1JK1 A;  3TQM A;  2EM4 A;  2PRT A;  2YU8 A;  1T4O A;  2DLQ A;  2CTD A;  2EQ1 A;  2UXC E;  3DJW A;  1UBD C;  4NXN E;  2MC5 A;  2YTJ A;  2YTO A;  4O4K A;  2UU9 E;  2EMZ A;  2JR1 A; 
#chains in the Genus database with same CATH homology
 4JI2 E;  4M30 A;  3C4B A;  1X49 A;  2N3G A;  4J8Z A;  2VQF E;  5AE1 A;  2NUF A;  2UUB E;  1T4N A;  4LF4 E;  4BC9 A;  4DMI A;  4DR5 E;  4LF8 E;  5IT9 C;  2JOB A;  2UXB E;  4BC7 A;  1T4L B;  3T1H E;  2JY9 A;  4DV0 E;  4AQY E;  1YYK A;  2ODR C;  4JI6 E;  4LFA E;  2RS7 A;  2V8Q B;  5F3W A;  2LUQ A;  3AUZ A;  4F9B B;  4LFC E;  4WSP A;  1WXR A;  2B9D A;  2KOU A;  3JTZ A;  5AE3 A;  2VQE E;  2V89 A;  4WPY A;  2RS6 A;  2L92 A;  5AE2 A;  2LMZ A;  2NA2 A;  2LBS B;  2JVA A;  2L6M A;  4DR2 E;  3ADL A;  2V83 A;  1ZBQ A;  4KHP E;  2LUP B;  4DV7 E;  4DR3 E;  2NUE A;  4KZS A;  1J5E E;  1N33 E;  2MC6 A;  4BCA A;  1XMQ E;  1DQ3 A;  3VYY A;  2EWL A;  2RSM A;  2YT4 A;  5LL6 R;  4X62 E;  4BBY A;  2H36 X;  2ODR D;  2E5L E;  4L5N C;  1HNX E;  2L2M A;  4LF6 E;  4OOG C;  3F6H A;  4BS9 A;  4JI8 E;  3JAM C;  2V86 A;  3JU0 A;  1GQE A;  4B3R E;  4JI5 E;  1EKZ A;  3ADJ A;  4DR7 E;  4K0K E;  4Q28 A;  2F4V E;  5DNY A;  4B3M E;  1PKP A;  4DV4 E;  2N3H A;  4B3S E;  3H09 A;  2L2N A;  3J80 C;  3HPS A;  3OML A;  4DV1 E;  3C4T A;  4P7D A;  1HR0 E;  2F8B A;  2JWO A;  2M1S A;  2LTR A;  2YZT A;  4F9A B;  3AV0 A;  3HQ1 A;  3IWB A;  2EZ6 A;  2IHR 1;  2M4I A;  2L2K B;  4DUZ E;  4DV2 E;  1IBL E;  3LLH A;  4NXM E;  1YZ9 A;  4DR4 E;  5LMU E;  4DUY E;  2DIX A;  1UIL A;  3FIG A;  3VK6 A;  3F6G A;  1FJG E;  3MSW A;  2KON A;  4JI0 E;  1ZBT A;  4DV3 E;  1J26 A;  4X8W A;  1X47 A;  4LFB E;  1GZ6 A;  5ADZ A;  5A2Q C;  4M2Z A;  2NUG A;  4R8O A;  5LMN E;  3J7Y p;  3DF6 A;  5IWA E;  1QU6 A;  4LF9 E;  3HPZ A;  2V85 A;  4M0V A;  2L8T A;  1HNZ E;  3LML A;  5T6J A;  3IWD A;  2MDR A;  3VYX A;  3OTO E;  2CPN A;  1XMO E;  5CFF E;  1WHN A;  4LU9 A;  4JI4 E;  4X64 E;  2K4V A;  4DR1 E;  1HNW E;  4LF5 E;  2DB2 A;  2M7Q A;  2L33 A;  2FGG A;  2WZO A;  5BR8 E;  4B3T E;  2KHX A;  1IBM E;  1N32 E;  3ADI A;  2LRS A;  2V87 A;  4JYA E;  2B7V A;  2B3T B;  3P1X A;  3K6Q A;  1X48 A;  2VF1 A;  3IWC A;  4GEQ B;  1RQ0 A;  2FTX B;  4X65 E;  1XNR E;  4L8N A;  2VE7 C;  2E1M A;  3HXL A;  1YYW A;  2UUC E;  4WFT A;  4F9C B;  1SR9 A;  2G7H A;  4R03 A;  5AAS A;  1UHZ A;  4DV6 E;  3J7A G;  4X66 E;  2L3C A;  4TUG A;  1O0W A;  4DR6 E;  4LTY A;  3RMP A;  3T1Y E;  4OX9 E;  2LE2 A;  4YY3 E;  4GKJ E;  4JV5 E;  2JOX A;  4DKK A;  1N34 E;  3HTX A;  4YHH E;  2DMY A;  2FV4 B;  4I8O A;  2L3J A;  1I94 E;  3ZOQ B;  4LF7 E;  4GKK E;  1DI2 A;  5FLX C;  4JI1 E;  1T4O A;  4JI7 E;  2DSY A;  1STU A;  2RTX A;  3ADG A;  4F54 A;  2HHH E;  3KWR A;  2LTS A;  2UUA E;  4P78 A;  4DV5 E;  1FKA E;  4TUI A;  3J81 C;  2ZM6 E;  1XNQ E;  1YYO A;  1N36 E;  2UXC E;  3DJW A;  1RC7 A;  2LJH A;  1IBK E;  4NXN E;  1WHQ A;  2MC5 A;  2V88 A;  2UU9 E;  4BMJ A;  2UXD E;  2JR1 A;  4WYQ B;  2B7T A;  4JI3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...