2EPRA

Solution structure of the secound zinc finger domain of zinc finger protein 278
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
48
Chain Sequence
GSSGSSGRTRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the secound zinc finger domain of Zinc finger protein 278
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords POZ-, AT hook-, and zinc finger-containing protein 1
total genus 7
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eprA01
2YSPA 2DLQA 2CSHA 1WJPA 4F2JC 2EOYA 2EM5A 2EPCA 2EL4A 4R2PA 2EOFA 2EM8A 2ENAA 1MEYC 2DLKA 2WBTA 3UK3C 4GZNC 2EPAA 2EOMA 1LLMC 2YSOA 5KL4A 2HGHA 2YTIA 1A1JA 4F6MA 2EPXA 2EMLA 2ELYA 2J7JA 2EMZA 2EM9A 2MDGA 2EN8A 2RPCA 4R2AA 1A1LA 2MKNA 2YTOA 1DGCA 2LO3A 2LT7A 2LCEA 2EOZA 3MHHC 5KL5A 1NCSA 3EPJA 4F6NA 1TF6A 2YTPA 1YSAC 2EMKA 2ELZA 2EL6A 1AAYA 2EM0A 2EOOA 5KL2A 1X5WA 1RMDA 2EMWA 2EOQA 2WBUA 1UBDC 1TF3A 1A1FA 4R2EA 1UN6B 2YRHA 2D9HA 2EORA 2EMAA 2RSIA 4FK5C 1F2IG 2DMIA 2EMGA 2WCC3 2DGCA 1X6FA 3M99B 1Z1BA 1X6EA 2WBSA 2EMYA 4R2SA 2JPAA 3EPKA 2YTNA 1BB8A 2YU8A 2EN1A 2JP9A 2GHFA 2EOIA 2CT1A 2M9AA 2YU5A 5KL3A 1X6HA 2YTDA 2ADRA 2EQ0A 4IS1C 2EM4A 2EE8A 2EMCA 2EOJA 2EN3A 2EMXA 4R2DA 2EMFA 2YRMA 4R2QA 1BBOA 2R1FA 1TN9A 2EN2A 2NABA 1YUJA 2I13A 3EPLA 2DRPA 2EMBA 2EM2A 2EOEA 1B69A 2EN7A 5KL6A 1A1GA 1A1IA 2YTEA 5KL7A 2YTQA 2ENHA 2YRKA 4X9JA 2LV2A 2EJ4A 1P47A 2EPRA 2VRDA 3VHTB 2EQ1A 2EPUA 2EPPA 1JK1A 2EMIA 4M9VC 3EPHA 2EQ3A 2EMHA 2YTGA 2E72A 4WSGA 2BB8A 1ZR9A 2MKDA 2YTFA 2PRTA 2EP3A 3MHSC 2EOSA 2ENCA 2YTJA 2EOXA 1G2DC 2CTDA 1ZAAC 1X3CA 2A25A 4IJDA 2EN6A 1A1HA 2EL5A 1G2FC 2EOHA 4R2CA 2EN4A 1A1KA 4R2RA 2GLIA 2EPZA 1ZU1A 2EM7A 2LVHA 1YUIA 1JK2A 2EM6A 2EM3A 1KJKA
chains in the Genus database with same CATH superfamily
2E5LE 1PJTA 2CSHA 3HQ1A 4N4RB 4YY3E 1WJPA 2EOYA 2EM5A 3F6GA 2F4VE 1MEYC 2B7TA 1IBME 2EPAA 1T4NA 3J80C 2I9IA 5KL4A 2L33A 2HGHA 2HHHE 3HXLA 4DUYE 2L92A 2B9DA 1A1LA 2MKNA 3KZZA 2MC5A 4BC9A 4LTYA 4TUIA 1FKAE 3KWRA 2MC6A 3P1XA 3EPJA 3RMPA 2YTPA 3HTXA 2V85A 3MSWA 4I8OA 2ELZA 2EL6A 2EM0A 2EOOA 3IWBA 4AQYE 4GEQB 2RSMA 1TF3A 3BIDA 2V88A 4O24A 2YRHA 1UN6B 2L2MA 4WSPA 1KYQA 2L2NA 4X62E 5A6BD 4TUGA 1Z1BA 1X6EA 1SFEA 2MDRA 4R2SA 2JPAA 2YTNA 4LFAE 2L3JA 2JP9A 2EOIA 2M9AA 2V89A 5IT9C 4DR4E 1O0WA 2GPIA 4MLQA 4KWYA 2UXBE 5FLXC 5A6KA 3EQ1A 4F54A 4X65E 4HTGA 3T1HE 1YUJA 3EPLA 3H09A 1IMUA 4O4KA 1T4LB 1DI2A 2EM2A 1B69A 4NHRA 5KL7A 5A6JA 4X9JA 2YRKA 4DV0E 4BMJA 1RQ0A 2JOXA 3LLHA 4F9AB 2JVAA 3OTOE 2IHR1 2M1SA 2LUPB 2KHXA 3EPHA 2EQ3A 2EMHA 3ADIA 2VF1A 3HPSA 3J81C 1ZR9A 1GQEA 4Q28A 2EP3A 4LF6E 3FIGA 2ZM6E 4M0VA 2B7VA 4B3ME 1G2FC 1RC7A 1ZBTA 2EM7A 1JK2A 2EM6A 2ODRD 2EM3A 1KJKA 2YSPA 2VQFE 1IBLE 2DB2A 3J7AG 4L8NA 4WXCA 4WXDA 2YT4A 1N33E 2EZ6A 5AE2A 2EL4A 4R2PA 2EOFA 4DV6E 2ENAA 2DLKA 4LF5E 5CFFE 5LLQA 3C6KA 4GZNC 1I94E 2EOMA 2YSOA 5A69A 3HPZA 2YTIA 2JR1A 3JU0A 1EH8A 1T38A 4GKJE 2RPCA 1EH6A 1ZBQA 3ADGA 1IQSA 2LTSA 1DQ3A 4LF9E 4ZYHA 1T4OA 2EOZA 3MHHC 4RHBB 1WRJA 4DV7E 3AUZA 2EMKA 1AAYA 4JI2E 2EMWA 2HC5A 4DR3E 1UBDC 2LRSA 3QG5C 4R2EA 4FK5C 1HNZE 4K0KE 2YZTA 5T6JA 3ZOQB 4BS9A 2N8XA 5AC5A 1YYKA 2DGCA 2K4VA 3M99B 2CPNA 2WBSA 4WFTA 2YWQA 1EH7A 3EPKA 1PJQA 1BB8A 2YU8A 1X6HA 1QU6A 4DR1E 2EQ0A 4IS1C 2EM4A 2EE8A 2EMCA 2EOJA 4P78A 2RQLA 2EMFA 4R03A 2YRMA 4ZYGA 1BBOA 2NABA 4OX9E 2I13A 4P7DA 5AE3A 5A6BA 1FJGE 1YZ9A 5KL6A 5IWAE 2L2KB 5A6AA 2ENHA 2NUEA 4JI6E 2UUAE 4JI7E 1N36E 1SR9A 4Q35B 2FTXB 1PDAA 1GZ6A 4KZSA 1JK1A 2LJHA 4WYQB 4O43A 2YTGA 2LMZA 2MKDA 3BBGA 1HNWE 3L00A 3J7Yp 2N3HA 2EOXA 2YTJA 1ZAAC 1T39A 1IQOA 1MGTA 1A1HA 2EL5A 3AV0A 4DKKA 4R2CA 4JI0E 4R2RA 1WXRA 5TSEA 2NUFA 5IV8B 2B3TB 1YUIA 4MLVA 5IXMB 2NA2A 1X49A 4DV1E 4KHPE 3BGHA 2JXPA 4F2JC 5LL6R 2EPCA 2ODRC 2E1MA 2EM8A 3K6QA 2LE2A 2WBTA 3UK3C 1LLMC 2V83A 1A1JA 4F6MA 2EPXA 2EMLA 4BHBA 2J7JA 4DV3E 2EM9A 2MDGA 2VQEE 5BR8E 1HR0E 2YTOA 1DGCA 4ZYEA 2LT7A 2LCEA 1NCSA 1TF6A 4NZVA 2JWOA 5F3WA 4WX9A 3TQMA 5KL2A 1X5WA 3JTZA 2WBUA 5LMUE 1A1FA 1J26A 2EORA 1F2IG 4LF4E 4B3TE 2NUGA 4L5NC 2WCC3 2HJJA 4J8ZA 1UILA 4F9CB 3BF2A 1N3GA 2EMYA 2LTRA 4O5GA 4BBYA 3T1YE 3F6HA 2EN1A 2GHFA 4DUZE 2YU5A 4JI5E 2L6MA 1HNXE 5KL3A 2YTDA 1X48A 2ADRA 2DMYA 2N3GA 3KZYA 2EN3A 4JI8E 2EPMX 2R1FA 1TN9A 5ADZA 2EN2A 4GKKE 2Q8UA 1GTKA 1PKPA 2DRPA 1UHZA 2EMBA 2EN7A 1A1IA 2WZOA 2YTQA 1YPNA 4LFCE 4DR5E 2LV2A 2EPLX 2EJ4A 1P47A 2LJUA 2EPRA 2VRDA 3C4BA 3VHTB 4LFBE 2EQ1A 1YYWA 4X66E 4X64E 2EPUA 2EPPA 5LMNE 2EMIA 2EPKX 1L4SA 4DMIA 4WSGA 2FV4B 2BB8A 4JV5E 2YTFA 2K7IA 2V86A 3MHSC 2EOSA 2L8TA 3VYXA 2ENCA 1XMOE 1G2DC 2CTDA 2FGGA 1STUA 4DV2E 2A25A 4OOGC 1X47A 5DNYA 3THOB 4NXME 4LU9A 1XNQE 2EN4A 1A1KA 2EPOA 2G7HA 3C4TA 2LVHA 1ZU1A 4M2ZA 2R76A 4HEIA 4DV4E 2ELYA 2UU9E 5AASA 3THNA 2DLQA 2KOUA 2RS7A 2H36X 2M4IA 2DSYA 4BC7A 2LBSB 2BBGA 4X8WA 1PJSA 4NXNE 1WHNA 2EMZA 4R2AA 2EN8A 3OMLA 3VK6A 1EKZA 2LO3A 5KL5A 2JYAA 4F6NA 4JI3E 1QNTA 1AH5A 1YSAC 4JI4E 2F8BA 1RMDA 4LF8E 2EOQA 3ADLA 1YFHA 4B3RE 2D9HA 2EMAA 2RSIA 2UUBE 2JOBA 4BHCA 2DMIA 2EMGA 1BBGA 2UUCE 1X6FA 2DIXA 3LMLA 2EWLA 2LUQA 4WPYA 4M30A 3DF6A 4DV5E 2CT1A 2UXDE 3IWDA 2YPNA 1J5EE 1NEIA 4DR7E 4R8OA 4DR2E 2EMXA 4R2DA 4R2QA 3DJWA 2L3CA 4LF7E 2VE7C 4YHHE 2RTXA 1IBKE 1N34E 2EOEA 3JAMC 4DR6E 4JYAE 2UXCE 3IWCA 3ECRA 2YTEA 4F9BB 1A1GA 1YYOA 1XMQE 5A2QC 2RS6A 2KONA 4M9VC 4BCAA 2E72A 2EPNA 2V8QB 2PRTA 2V87A 4B3SE 3VYYA 1N32E 5AC4A 4JI1E 1X3CA 1XNRE 4IJDA 2JY9A 4RH8A 2EN6A 3C6MA 2EOHA 2M7QA 4ZYDA 2GLIA 2EPZA 5AE1A 1WHQA 3ADJA
chains in the Genus database with same CATH topology
2YSPA 2DLQA 2CSHA 1WJPA 4F2JC 2EOYA 2EM5A 2EPCA 2EL4A 4R2PA 2EOFA 2EM8A 2ENAA 1MEYC 2DLKA 2WBTA 3UK3C 4GZNC 2EPAA 2EOMA 1LLMC 2YSOA 5KL4A 2HGHA 2YTIA 1A1JA 4F6MA 2EPXA 2EMLA 2ELYA 2J7JA 2EMZA 2EM9A 2MDGA 2EN8A 2RPCA 4R2AA 1A1LA 2MKNA 2YTOA 1DGCA 2LO3A 2LT7A 2LCEA 2EOZA 3MHHC 5KL5A 1NCSA 3EPJA 4F6NA 1TF6A 2YTPA 1YSAC 2EMKA 2ELZA 2EL6A 1AAYA 2EM0A 2EOOA 5KL2A 1X5WA 1RMDA 2EMWA 2EOQA 2WBUA 1UBDC 1TF3A 1A1FA 4R2EA 1UN6B 2YRHA 2D9HA 2EORA 2EMAA 2RSIA 4FK5C 1F2IG 2DMIA 2EMGA 2WCC3 2DGCA 1X6FA 3M99B 1Z1BA 1X6EA 2WBSA 2EMYA 4R2SA 2JPAA 3EPKA 2YTNA 1BB8A 2YU8A 2EN1A 2JP9A 2GHFA 2EOIA 2CT1A 2M9AA 2YU5A 5KL3A 1X6HA 2YTDA 2ADRA 2EQ0A 4IS1C 2EM4A 2EE8A 2EMCA 2EOJA 2EN3A 2EMXA 4R2DA 2EMFA 2YRMA 4R2QA 1BBOA 2R1FA 1TN9A 2EN2A 2NABA 1YUJA 2I13A 3EPLA 2DRPA 2EMBA 2EM2A 2EOEA 1B69A 2EN7A 5KL6A 1A1GA 1A1IA 2YTEA 5KL7A 2YTQA 2ENHA 2YRKA 4X9JA 2LV2A 2EJ4A 1P47A 2EPRA 2VRDA 3VHTB 2EQ1A 2EPUA 2EPPA 1JK1A 2EMIA 4M9VC 3EPHA 2EQ3A 2EMHA 2YTGA 2E72A 4WSGA 2BB8A 1ZR9A 2MKDA 2YTFA 2PRTA 2EP3A 3MHSC 2EOSA 2ENCA 2YTJA 2EOXA 1G2DC 2CTDA 1ZAAC 1X3CA 2A25A 4IJDA 2EN6A 1A1HA 2EL5A 1G2FC 2EOHA 4R2CA 2EN4A 1A1KA 4R2RA 2GLIA 2EPZA 1ZU1A 2EM7A 2LVHA 1YUIA 1JK2A 2EM6A 2EM3A 1KJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSP A;  2DLQ A;  2CSH A;  1WJP A;  4F2J C;  2EOY A;  2EM5 A;  2EPC A;  2EL4 A;  4R2P A;  2EOF A;  2EM8 A;  2ENA A;  1MEY C;  2DLK A;  2WBT A;  3UK3 C;  4GZN C;  2EPA A;  2EOM A;  1LLM C;  2YSO A;  5KL4 A;  2HGH A;  2YTI A;  1A1J A;  4F6M A;  2EPX A;  2EML A;  2ELY A;  2J7J A;  2EMZ A;  2EM9 A;  2MDG A;  2EN8 A;  2RPC A;  4R2A A;  1A1L A;  2MKN A;  2YTO A;  1DGC A;  2LO3 A;  2LT7 A;  2LCE A;  2EOZ A;  3MHH C;  5KL5 A;  1NCS A;  3EPJ A;  4F6N A;  1TF6 A;  2YTP A;  1YSA C;  2EMK A;  2ELZ A;  2EL6 A;  1AAY A;  2EM0 A;  2EOO A;  5KL2 A;  1X5W A;  1RMD A;  2EMW A;  2EOQ A;  2WBU A;  1UBD C;  1TF3 A;  1A1F A;  4R2E A;  1UN6 B;  2YRH A;  2D9H A;  2EOR A;  2EMA A;  2RSI A;  4FK5 C;  1F2I G;  2DMI A;  2EMG A;  2WCC 3;  2DGC A;  1X6F A;  3M99 B;  1Z1B A;  1X6E A;  2WBS A;  2EMY A;  4R2S A;  2JPA A;  3EPK A;  2YTN A;  1BB8 A;  2YU8 A;  2EN1 A;  2JP9 A;  2GHF A;  2EOI A;  2CT1 A;  2M9A A;  2YU5 A;  5KL3 A;  1X6H A;  2YTD A;  2ADR A;  2EQ0 A;  4IS1 C;  2EM4 A;  2EE8 A;  2EMC A;  2EOJ A;  2EN3 A;  2EMX A;  4R2D A;  2EMF A;  2YRM A;  4R2Q A;  1BBO A;  2R1F A;  1TN9 A;  2EN2 A;  2NAB A;  1YUJ A;  2I13 A;  3EPL A;  2DRP A;  2EMB A;  2EM2 A;  2EOE A;  1B69 A;  2EN7 A;  5KL6 A;  1A1G A;  1A1I A;  2YTE A;  5KL7 A;  2YTQ A;  2ENH A;  2YRK A;  4X9J A;  2LV2 A;  2EJ4 A;  1P47 A;  2EPR A;  2VRD A;  3VHT B;  2EQ1 A;  2EPU A;  2EPP A;  1JK1 A;  2EMI A;  4M9V C;  3EPH A;  2EQ3 A;  2EMH A;  2YTG A;  2E72 A;  4WSG A;  2BB8 A;  1ZR9 A;  2MKD A;  2YTF A;  2PRT A;  2EP3 A;  3MHS C;  2EOS A;  2ENC A;  2YTJ A;  2EOX A;  1G2D C;  2CTD A;  1ZAA C;  1X3C A;  2A25 A;  4IJD A;  2EN6 A;  1A1H A;  2EL5 A;  1G2F C;  2EOH A;  4R2C A;  2EN4 A;  1A1K A;  4R2R A;  2GLI A;  2EPZ A;  1ZU1 A;  2EM7 A;  2LVH A;  1YUI A;  1JK2 A;  2EM6 A;  2EM3 A;  1KJK A; 
#chains in the Genus database with same CATH topology
 2E5L E;  1PJT A;  2CSH A;  3HQ1 A;  4N4R B;  4YY3 E;  1WJP A;  2EOY A;  2EM5 A;  3F6G A;  2F4V E;  1MEY C;  2B7T A;  1IBM E;  2EPA A;  1T4N A;  3J80 C;  2I9I A;  5KL4 A;  2L33 A;  2HGH A;  2HHH E;  3HXL A;  4DUY E;  2L92 A;  2B9D A;  1A1L A;  2MKN A;  3KZZ A;  2MC5 A;  4BC9 A;  4LTY A;  4TUI A;  1FKA E;  3KWR A;  2MC6 A;  3P1X A;  3EPJ A;  3RMP A;  2YTP A;  3HTX A;  2V85 A;  3MSW A;  4I8O A;  2ELZ A;  2EL6 A;  2EM0 A;  2EOO A;  3IWB A;  4AQY E;  4GEQ B;  2RSM A;  1TF3 A;  3BID A;  2V88 A;  4O24 A;  2YRH A;  1UN6 B;  2L2M A;  4WSP A;  1KYQ A;  2L2N A;  4X62 E;  5A6B D;  4TUG A;  1Z1B A;  1X6E A;  1SFE A;  2MDR A;  4R2S A;  2JPA A;  2YTN A;  4LFA E;  2L3J A;  2JP9 A;  2EOI A;  2M9A A;  2V89 A;  5IT9 C;  4DR4 E;  1O0W A;  2GPI A;  4MLQ A;  4KWY A;  2UXB E;  5FLX C;  5A6K A;  3EQ1 A;  4F54 A;  4X65 E;  4HTG A;  3T1H E;  1YUJ A;  3EPL A;  3H09 A;  1IMU A;  4O4K A;  1T4L B;  1DI2 A;  2EM2 A;  1B69 A;  4NHR A;  5KL7 A;  5A6J A;  4X9J A;  2YRK A;  4DV0 E;  4BMJ A;  1RQ0 A;  2JOX A;  3LLH A;  4F9A B;  2JVA A;  3OTO E;  2IHR 1;  2M1S A;  2LUP B;  2KHX A;  3EPH A;  2EQ3 A;  2EMH A;  3ADI A;  2VF1 A;  3HPS A;  3J81 C;  1ZR9 A;  1GQE A;  4Q28 A;  2EP3 A;  4LF6 E;  3FIG A;  2ZM6 E;  4M0V A;  2B7V A;  4B3M E;  1G2F C;  1RC7 A;  1ZBT A;  2EM7 A;  1JK2 A;  2EM6 A;  2ODR D;  2EM3 A;  1KJK A;  2YSP A;  2VQF E;  1IBL E;  2DB2 A;  3J7A G;  4L8N A;  4WXC A;  4WXD A;  2YT4 A;  1N33 E;  2EZ6 A;  5AE2 A;  2EL4 A;  4R2P A;  2EOF A;  4DV6 E;  2ENA A;  2DLK A;  4LF5 E;  5CFF E;  5LLQ A;  3C6K A;  4GZN C;  1I94 E;  2EOM A;  2YSO A;  5A69 A;  3HPZ A;  2YTI A;  2JR1 A;  3JU0 A;  1EH8 A;  1T38 A;  4GKJ E;  2RPC A;  1EH6 A;  1ZBQ A;  3ADG A;  1IQS A;  2LTS A;  1DQ3 A;  4LF9 E;  4ZYH A;  1T4O A;  2EOZ A;  3MHH C;  4RHB B;  1WRJ A;  4DV7 E;  3AUZ A;  2EMK A;  1AAY A;  4JI2 E;  2EMW A;  2HC5 A;  4DR3 E;  1UBD C;  2LRS A;  3QG5 C;  4R2E A;  4FK5 C;  1HNZ E;  4K0K E;  2YZT A;  5T6J A;  3ZOQ B;  4BS9 A;  2N8X A;  5AC5 A;  1YYK A;  2DGC A;  2K4V A;  3M99 B;  2CPN A;  2WBS A;  4WFT A;  2YWQ A;  1EH7 A;  3EPK A;  1PJQ A;  1BB8 A;  2YU8 A;  1X6H A;  1QU6 A;  4DR1 E;  2EQ0 A;  4IS1 C;  2EM4 A;  2EE8 A;  2EMC A;  2EOJ A;  4P78 A;  2RQL A;  2EMF A;  4R03 A;  2YRM A;  4ZYG A;  1BBO A;  2NAB A;  4OX9 E;  2I13 A;  4P7D A;  5AE3 A;  5A6B A;  1FJG E;  1YZ9 A;  5KL6 A;  5IWA E;  2L2K B;  5A6A A;  2ENH A;  2NUE A;  4JI6 E;  2UUA E;  4JI7 E;  1N36 E;  1SR9 A;  4Q35 B;  2FTX B;  1PDA A;  1GZ6 A;  4KZS A;  1JK1 A;  2LJH A;  4WYQ B;  4O43 A;  2YTG A;  2LMZ A;  2MKD A;  3BBG A;  1HNW E;  3L00 A;  3J7Y p;  2N3H A;  2EOX A;  2YTJ A;  1ZAA C;  1T39 A;  1IQO A;  1MGT A;  1A1H A;  2EL5 A;  3AV0 A;  4DKK A;  4R2C A;  4JI0 E;  4R2R A;  1WXR A;  5TSE A;  2NUF A;  5IV8 B;  2B3T B;  1YUI A;  4MLV A;  5IXM B;  2NA2 A;  1X49 A;  4DV1 E;  4KHP E;  3BGH A;  2JXP A;  4F2J C;  5LL6 R;  2EPC A;  2ODR C;  2E1M A;  2EM8 A;  3K6Q A;  2LE2 A;  2WBT A;  3UK3 C;  1LLM C;  2V83 A;  1A1J A;  4F6M A;  2EPX A;  2EML A;  4BHB A;  2J7J A;  4DV3 E;  2EM9 A;  2MDG A;  2VQE E;  5BR8 E;  1HR0 E;  2YTO A;  1DGC A;  4ZYE A;  2LT7 A;  2LCE A;  1NCS A;  1TF6 A;  4NZV A;  2JWO A;  5F3W A;  4WX9 A;  3TQM A;  5KL2 A;  1X5W A;  3JTZ A;  2WBU A;  5LMU E;  1A1F A;  1J26 A;  2EOR A;  1F2I G;  4LF4 E;  4B3T E;  2NUG A;  4L5N C;  2WCC 3;  2HJJ A;  4J8Z A;  1UIL A;  4F9C B;  3BF2 A;  1N3G A;  2EMY A;  2LTR A;  4O5G A;  4BBY A;  3T1Y E;  3F6H A;  2EN1 A;  2GHF A;  4DUZ E;  2YU5 A;  4JI5 E;  2L6M A;  1HNX E;  5KL3 A;  2YTD A;  1X48 A;  2ADR A;  2DMY A;  2N3G A;  3KZY A;  2EN3 A;  4JI8 E;  2EPM X;  2R1F A;  1TN9 A;  5ADZ A;  2EN2 A;  4GKK E;  2Q8U A;  1GTK A;  1PKP A;  2DRP A;  1UHZ A;  2EMB A;  2EN7 A;  1A1I A;  2WZO A;  2YTQ A;  1YPN A;  4LFC E;  4DR5 E;  2LV2 A;  2EPL X;  2EJ4 A;  1P47 A;  2LJU A;  2EPR A;  2VRD A;  3C4B A;  3VHT B;  4LFB E;  2EQ1 A;  1YYW A;  4X66 E;  4X64 E;  2EPU A;  2EPP A;  5LMN E;  2EMI A;  2EPK X;  1L4S A;  4DMI A;  4WSG A;  2FV4 B;  2BB8 A;  4JV5 E;  2YTF A;  2K7I A;  2V86 A;  3MHS C;  2EOS A;  2L8T A;  3VYX A;  2ENC A;  1XMO E;  1G2D C;  2CTD A;  2FGG A;  1STU A;  4DV2 E;  2A25 A;  4OOG C;  1X47 A;  5DNY A;  3THO B;  4NXM E;  4LU9 A;  1XNQ E;  2EN4 A;  1A1K A;  2EPO A;  2G7H A;  3C4T A;  2LVH A;  1ZU1 A;  4M2Z A;  2R76 A;  4HEI A;  4DV4 E;  2ELY A;  2UU9 E;  5AAS A;  3THN A;  2DLQ A;  2KOU A;  2RS7 A;  2H36 X;  2M4I A;  2DSY A;  4BC7 A;  2LBS B;  2BBG A;  4X8W A;  1PJS A;  4NXN E;  1WHN A;  2EMZ A;  4R2A A;  2EN8 A;  3OML A;  3VK6 A;  1EKZ A;  2LO3 A;  5KL5 A;  2JYA A;  4F6N A;  4JI3 E;  1QNT A;  1AH5 A;  1YSA C;  4JI4 E;  2F8B A;  1RMD A;  4LF8 E;  2EOQ A;  3ADL A;  1YFH A;  4B3R E;  2D9H A;  2EMA A;  2RSI A;  2UUB E;  2JOB A;  4BHC A;  2DMI A;  2EMG A;  1BBG A;  2UUC E;  1X6F A;  2DIX A;  3LML A;  2EWL A;  2LUQ A;  4WPY A;  4M30 A;  3DF6 A;  4DV5 E;  2CT1 A;  2UXD E;  3IWD A;  2YPN A;  1J5E E;  1NEI A;  4DR7 E;  4R8O A;  4DR2 E;  2EMX A;  4R2D A;  4R2Q A;  3DJW A;  2L3C A;  4LF7 E;  2VE7 C;  4YHH E;  2RTX A;  1IBK E;  1N34 E;  2EOE A;  3JAM C;  4DR6 E;  4JYA E;  2UXC E;  3IWC A;  3ECR A;  2YTE A;  4F9B B;  1A1G A;  1YYO A;  1XMQ E;  5A2Q C;  2RS6 A;  2KON A;  4M9V C;  4BCA A;  2E72 A;  2EPN A;  2V8Q B;  2PRT A;  2V87 A;  4B3S E;  3VYY A;  1N32 E;  5AC4 A;  4JI1 E;  1X3C A;  1XNR E;  4IJD A;  2JY9 A;  4RH8 A;  2EN6 A;  3C6M A;  2EOH A;  2M7Q A;  4ZYD A;  2GLI A;  2EPZ A;  5AE1 A;  1WHQ A;  3ADJ A; 
#chains in the Genus database with same CATH homology
 2YSP A;  2DLQ A;  2CSH A;  1WJP A;  4F2J C;  2EOY A;  2EM5 A;  2EPC A;  2EL4 A;  4R2P A;  2EOF A;  2EM8 A;  2ENA A;  1MEY C;  2DLK A;  2WBT A;  3UK3 C;  4GZN C;  2EPA A;  2EOM A;  1LLM C;  2YSO A;  5KL4 A;  2HGH A;  2YTI A;  1A1J A;  4F6M A;  2EPX A;  2EML A;  2ELY A;  2J7J A;  2EMZ A;  2EM9 A;  2MDG A;  2EN8 A;  2RPC A;  4R2A A;  1A1L A;  2MKN A;  2YTO A;  1DGC A;  2LO3 A;  2LT7 A;  2LCE A;  2EOZ A;  3MHH C;  5KL5 A;  1NCS A;  3EPJ A;  4F6N A;  1TF6 A;  2YTP A;  1YSA C;  2EMK A;  2ELZ A;  2EL6 A;  1AAY A;  2EM0 A;  2EOO A;  5KL2 A;  1X5W A;  1RMD A;  2EMW A;  2EOQ A;  2WBU A;  1UBD C;  1TF3 A;  1A1F A;  4R2E A;  1UN6 B;  2YRH A;  2D9H A;  2EOR A;  2EMA A;  2RSI A;  4FK5 C;  1F2I G;  2DMI A;  2EMG A;  2WCC 3;  2DGC A;  1X6F A;  3M99 B;  1Z1B A;  1X6E A;  2WBS A;  2EMY A;  4R2S A;  2JPA A;  3EPK A;  2YTN A;  1BB8 A;  2YU8 A;  2EN1 A;  2JP9 A;  2GHF A;  2EOI A;  2CT1 A;  2M9A A;  2YU5 A;  5KL3 A;  1X6H A;  2YTD A;  2ADR A;  2EQ0 A;  4IS1 C;  2EM4 A;  2EE8 A;  2EMC A;  2EOJ A;  2EN3 A;  2EMX A;  4R2D A;  2EMF A;  2YRM A;  4R2Q A;  1BBO A;  2R1F A;  1TN9 A;  2EN2 A;  2NAB A;  1YUJ A;  2I13 A;  3EPL A;  2DRP A;  2EMB A;  2EM2 A;  2EOE A;  1B69 A;  2EN7 A;  5KL6 A;  1A1G A;  1A1I A;  2YTE A;  5KL7 A;  2YTQ A;  2ENH A;  2YRK A;  4X9J A;  2LV2 A;  2EJ4 A;  1P47 A;  2EPR A;  2VRD A;  3VHT B;  2EQ1 A;  2EPU A;  2EPP A;  1JK1 A;  2EMI A;  4M9V C;  3EPH A;  2EQ3 A;  2EMH A;  2YTG A;  2E72 A;  4WSG A;  2BB8 A;  1ZR9 A;  2MKD A;  2YTF A;  2PRT A;  2EP3 A;  3MHS C;  2EOS A;  2ENC A;  2YTJ A;  2EOX A;  1G2D C;  2CTD A;  1ZAA C;  1X3C A;  2A25 A;  4IJD A;  2EN6 A;  1A1H A;  2EL5 A;  1G2F C;  2EOH A;  4R2C A;  2EN4 A;  1A1K A;  4R2R A;  2GLI A;  2EPZ A;  1ZU1 A;  2EM7 A;  2LVH A;  1YUI A;  1JK2 A;  2EM6 A;  2EM3 A;  1KJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...