2EPRA

Solution structure of the secound zinc finger domain of zinc finger protein 278
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
48
Chain Sequence
b'GSSGSSGRTRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POZ-, AT hook-, and zinc finger-containing protein 1
publication title Solution structure of the secound zinc finger domain of Zinc finger protein 278
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eprA01
2WCC3 2EL4A 2YTPA 2DRPA 2E72A 4F2JC 2ELZA 2CTDA 2EQ0A 2YRKA 1MEYC 2NABA 5KL3A 4R2PA 1ZAAC 2EPAA 4GZNC 2EPXA 2ELYA 2YTQA 5KL2A 1X5WA 2EJ4A 1TF6A 2EMCA 3UK3C 2MDGA 1B69A 1YUJA 2YRMA 2DLQA 1JK2A 2CSHA 2EOXA 4R2CA 2YU5A 4IS1C 1AAYA 2EOOA 2EOJA 1X3CA 2LT7A 2YSOA 2EN8A 2EPCA 1NCSA 4F6NA 4R2DA 2EOQA 2LO3A 5KL5A 2EPZA 3MHHC 1ZR9A 2VRDA 2DMIA 5KL6A 1A1KA 2EOSA 3M99B 2R1FA 2YTNA 1A1HA 1YSAC 1JK1A 1ZU1A 2EMKA 2EPPA 4R2AA 2EM8A 2LVHA 3EPJA 2A25A 2EN2A 2EMLA 1X6HA 2ADRA 1A1IA 2EM7A 2EN3A 2ENAA 2EL6A 2WBSA 2EOZA 2EMFA 2EN1A 2LV2A 1P47A 1A1LA 1LLMC 2EMYA 2RSIA 2EN4A 2HGHA 1DGCA 2EMIA 1UBDC 2EQ1A 1Z1BA 2EPRA 2YTIA 4M9VC 1X6EA 2DLKA 2M9AA 2YTJA 2JPAA 2EM4A 4F6MA 1G2DC 2ENCA 5KL4A 3EPHA 1X6FA 2EM6A 4R2QA 2RPCA 2LCEA 5KL7A 4R2RA 2EOFA 2MKNA 2EQ3A 4WSGA 2YTEA 2EN6A 2YTOA 2EMGA 2YTFA 1A1FA 2EM3A 2EOIA 4FK5C 2EPUA 2EM2A 2EN7A 1YUIA 1TF3A 3MHSC 1UN6B 4R2SA 1G2FC 2EORA 2J7JA 1A1GA 2EM9A 2CT1A 2EMXA 1WJPA 2EMHA 2ENHA 2GHFA 2EMZA 2PRTA 1BBOA 2EP3A 2YRHA 2EOMA 2DGCA 2EOEA 2EE8A 2YTDA 2JP9A 4R2EA 2BB8A 1BB8A 3VHTB 3EPLA 2EOHA 2GLIA 2EMWA 1A1JA 2EL5A 2EM0A 2MKDA 2WBUA 2YSPA 1KJKA 4IJDA 2D9HA 1F2IG 4X9JA 2EOYA 2I13A 2EMBA 3EPKA 2EMAA 2WBTA 2YTGA 1TN9A 2YU8A 1RMDA 2EM5A
chains in the Genus database with same CATH superfamily
4WX9A 2YTPA 3HPZA 4O43A 4F2JC 2ELZA 2CTDA 1MEYC 5IV8B 1PJSA 5KL2A 1ZBQA 4LFBE 2RSMA 4JI3E 1B69A 4M0VA 1N33E 2G7HA 4GKKE 3J80C 2EOOA 2EOJA 4L8NA 2LT7A 2MDRA 3BGHA 4R2DA 3VYXA 2EOQA 2EPZA 1AH5A 2B3TB 3C4TA 1ZR9A 2DMIA 3BIDA 2JYAA 5LMNE 5AASA 2RS6A 4DR1E 2EMKA 2EPPA 2WZOA 3KWRA 4LF6E 2IHR1 4F54A 3EPJA 2LTRA 2EN2A 1WXRA 2FGGA 2ADRA 2KONA 2ENAA 4KHPE 3F6GA 1QNTA 4O24A 2B7VA 1DQ3A 1PKPA 1P47A 4JI5E 3C6MA 4DR7E 1LLMC 4M2ZA 4TUGA 4JI1E 1DGCA 4O4KA 2K7IA 2LUQA 1X6EA 2LMZA 5AE2A 3LMLA 2DB2A 4DV5E 2LBSB 4R2QA 4LFAE 2L6MA 5IXMB 4OX9E 3OTOE 4WSGA 2FTXB 2JOBA 4R8OA 4I8OA 2YTFA 3IWCA 2EPLX 2NUGA 4FK5C 2VQEE 2RTXA 2DSYA 1T4NA 1WHNA 3MHSC 2DIXA 1YUIA 1UN6B 2L2NA 2V87A 3KZYA 1G2FC 2EORA 4WXCA 2L2KB 2LUPB 2EM9A 2M4IA 4F9AB 4X64E 2B7TA 2V88A 3C6KA 3HPSA 2EOMA 1SR9A 4P78A 2L3JA 5AC4A 5F3WA 4YY3E 3EQ1A 4R2EA 2BB8A 2UXBE 1YPNA 4B3RE 2EMWA 2UUBE 2B9DA 3HXLA 5A2QC 1FKAE 4JV5E 4BBYA 4LF4E 4DUZE 3ADLA 2ZM6E 2RS7A 4HEIA 4F9CB 2YU8A 1RMDA 1MGTA 2EPOA 1KYQA 2NABA 5KL3A 1T38A 3AV0A 3JAMC 4DR5E 2EJ4A 1TF6A 2EPMX 4JI4E 2JVAA 2MDGA 4B3SE 4B3TE 3DF6A 4RH8A 4IS1C 1AAYA 4DR6E 4X65E 2YSOA 2EN8A 2Q8UA 1A1KA 1SFEA 1A1HA 4J8ZA 1ZU1A 2V85A 3THNA 2L92A 1X6HA 1A1IA 2GPIA 2EL6A 2ODRC 5IWAE 2EMFA 2EN1A 3K6QA 1BBGA 4DR2E 4BHCA 4X62E 3ADIA 2RSIA 5A6BD 2EMIA 5A6KA 1HNZE 4JI8E 2EPRA 4M9VC 1PJTA 2DLKA 2YTJA 4JI2E 2JPAA 5LL6R 4L5NC 3J7AG 5KL4A 4DV2E 5ADZA 3P1XA 2EM6A 4NXNE 1XNQE 4JI0E 2UXCE 2JR1A 4R2RA 2MKNA 3T1HE 2EQ3A 1EH8A 5AE1A 2EN6A 2YTOA 2EMGA 4MLVA 2EM3A 2EOIA 4KWYA 3F6HA 2EN7A 1TF3A 1IMUA 3LLHA 4WYQB 2NUEA 3IWDA 3J81C 2HC5A 3TQMA 2CT1A 2EMXA 2EMHA 1IQSA 1BBOA 2DMYA 2YRHA 2K4VA 4LF8E 5LLQA 4WXDA 2DGCA 2RQLA 3IWBA 1IBKE 2EE8A 5T6JA 2JP9A 1GZ6A 1X48A 3VHTB 2GLIA 1A1JA 4WSPA 2EL5A 2EM0A 2MKDA 2WBUA 2L3CA 2D9HA 1F2IG 2N3GA 4X9JA 4JI6E 2WBTA 3ECRA 2FV4B 4BC7A 1YFHA 2WCC3 2DRPA 4B3ME 2E72A 5BR8E 4O5GA 1I94E 2EQ0A 2YRKA 1T4LB 2V8QB 1ZAAC 2EPAA 4GZNC 2YTQA 1EH6A 2ELYA 2NUFA 1X5WA 3H09A 3UK3C 1YUJA 2DLQA 1JK2A 2CSHA 1PDAA 5A6JA 2I9IA 1WRJA 5IT9C 2LTSA 5KL5A 4YHHE 4F9BB 5KL6A 2L2MA 4KZSA 4LF5E 4M30A 4R2AA 2EM8A 4BC9A 2A25A 1UILA 4DKKA 2EN3A 4WPYA 4JI7E 4X8WA 1X47A 2EWLA 2M1SA 4BHBA 1EKZA 2HGHA 3BF2A 1FJGE 2EQ1A 2ODRD 1YZ9A 3T1YE 2EM4A 4F6MA 2ENCA 3EPHA 1X6FA 4NZVA 1T4OA 3OMLA 2V86A 2LCEA 5KL7A 4DV4E 2EOFA 2YTEA 4GKJE 1L4SA 1N36E 4DV6E 4BCAA 1A1FA 4DMIA 5DNYA 4K0KE 1XMOE 2F4VE 2VQFE 4TUIA 4R2SA 2N8XA 1QU6A 1XNRE 1A1GA 4BMJA 2EPNA 2PRTA 1HNXE 2H36X 3JTZA 2KHXA 3MSWA 3ADGA 2V83A 4DR4E 1NEIA 4DUYE 4JYAE 2EOEA 1N32E 2CPNA 2LE2A 2YTDA 3JU0A 2HJJA 1IBME 1RC7A 2MC5A 2MC6A 1BB8A 4LFCE 3EPLA 2HHHE 4R03A 3VK6A 1KJKA 4AQYE 2VE7C 2EOYA 2LRSA 2I13A 2EMBA 3EPKA 1DI2A 4OOGC 4DV3E 5AC5A 2EM5A 4DV7E 1ZBTA 2EL4A 4NXME 2JOXA 1STUA 2YT4A 4R2PA 5A6BA 2EPXA 2UUAE 2R76A 2EPKX 1HR0E 4N4RB 3AUZA 2EMCA 4LF7E 3DJWA 2V89A 2YRMA 1YYWA 1EH7A 4R2CA 2EOXA 2YU5A 5TSEA 3HTXA 1X3CA 2JXPA 4HTGA 2N3HA 3VYYA 2EPCA 1NCSA 4LU9A 4F6NA 1YYKA 2LO3A 3MHHC 5AE3A 2M7QA 2VRDA 2EOSA 3M99B 2LJUA 2R1FA 2YTNA 2L33A 4Q35B 2UU9E 1YSAC 2YPNA 2E5LE 2F8BA 1JK1A 2LVHA 3HQ1A 2EMLA 1UHZA 2EM7A 5A69A 4ZYGA 2WBSA 2EOZA 2VF1A 2LV2A 2YZTA 4NHRA 4ZYDA 3J7Yp 1A1LA 2EMYA 2UUCE 5LMUE 2EN4A 2L8TA 1N3GA 3ADJA 4ZYHA 1UBDC 2JY9A 1Z1BA 2YTIA 4DV0E 2KOUA 3KZZA 4LF9E 1HNWE 2JWOA 1G2DC 2NA2A 2YWQA 2RPCA 3C4BA 5FLXC 1IQOA 4P7DA 4RHBB 2EZ6A 1IBLE 1X49A 4MLQA 4ZYEA 2EPUA 3RMPA 2EM2A 1T39A 4BS9A 1J5EE 3L00A 1GQEA 1PJQA 4Q28A 1XMQE 2J7JA 2LJHA 1WJPA 2ENHA 4LTYA 2GHFA 2EMZA 2UXDE 2EP3A 5A6AA 2E1MA 3FIGA 1GTKA 1J26A 3QG5C 2EOHA 1WHQA 4DR3E 4DV1E 5CFFE 2BBGA 1YYOA 4X66E 2YSPA 1O0WA 1RQ0A 4IJDA 3BBGA 4WFTA 4GEQB 2EMAA 2YTGA 1N34E 1TN9A 3ZOQB 2M9AA 3THOB
chains in the Genus database with same CATH topology
2WCC3 2EL4A 2YTPA 2DRPA 2E72A 4F2JC 2ELZA 2CTDA 2EQ0A 2YRKA 1MEYC 2NABA 5KL3A 4R2PA 1ZAAC 2EPAA 4GZNC 2EPXA 2ELYA 2YTQA 5KL2A 1X5WA 2EJ4A 1TF6A 2EMCA 3UK3C 2MDGA 1B69A 1YUJA 2YRMA 2DLQA 1JK2A 2CSHA 2EOXA 4R2CA 2YU5A 4IS1C 1AAYA 2EOOA 2EOJA 1X3CA 2LT7A 2YSOA 2EN8A 2EPCA 1NCSA 4F6NA 4R2DA 2EOQA 2LO3A 5KL5A 2EPZA 3MHHC 1ZR9A 2VRDA 2DMIA 5KL6A 1A1KA 2EOSA 3M99B 2R1FA 2YTNA 1A1HA 1YSAC 1JK1A 1ZU1A 2EMKA 2EPPA 4R2AA 2EM8A 2LVHA 3EPJA 2A25A 2EN2A 2EMLA 1X6HA 2ADRA 1A1IA 2EM7A 2EN3A 2ENAA 2EL6A 2WBSA 2EOZA 2EMFA 2EN1A 2LV2A 1P47A 1A1LA 1LLMC 2EMYA 2RSIA 2EN4A 2HGHA 1DGCA 2EMIA 1UBDC 2EQ1A 1Z1BA 2EPRA 2YTIA 4M9VC 1X6EA 2DLKA 2M9AA 2YTJA 2JPAA 2EM4A 4F6MA 1G2DC 2ENCA 5KL4A 3EPHA 1X6FA 2EM6A 4R2QA 2RPCA 2LCEA 5KL7A 4R2RA 2EOFA 2MKNA 2EQ3A 4WSGA 2YTEA 2EN6A 2YTOA 2EMGA 2YTFA 1A1FA 2EM3A 2EOIA 4FK5C 2EPUA 2EM2A 2EN7A 1YUIA 1TF3A 3MHSC 1UN6B 4R2SA 1G2FC 2EORA 2J7JA 1A1GA 2EM9A 2CT1A 2EMXA 1WJPA 2EMHA 2ENHA 2GHFA 2EMZA 2PRTA 1BBOA 2EP3A 2YRHA 2EOMA 2DGCA 2EOEA 2EE8A 2YTDA 2JP9A 4R2EA 2BB8A 1BB8A 3VHTB 3EPLA 2EOHA 2GLIA 2EMWA 1A1JA 2EL5A 2EM0A 2MKDA 2WBUA 2YSPA 1KJKA 4IJDA 2D9HA 1F2IG 4X9JA 2EOYA 2I13A 2EMBA 3EPKA 2EMAA 2WBTA 2YTGA 1TN9A 2YU8A 1RMDA 2EM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCC 3;  2EL4 A;  2YTP A;  2DRP A;  2E72 A;  4F2J C;  2ELZ A;  2CTD A;  2EQ0 A;  2YRK A;  1MEY C;  2NAB A;  5KL3 A;  4R2P A;  1ZAA C;  2EPA A;  4GZN C;  2EPX A;  2ELY A;  2YTQ A;  5KL2 A;  1X5W A;  2EJ4 A;  1TF6 A;  2EMC A;  3UK3 C;  2MDG A;  1B69 A;  1YUJ A;  2YRM A;  2DLQ A;  1JK2 A;  2CSH A;  2EOX A;  4R2C A;  2YU5 A;  4IS1 C;  1AAY A;  2EOO A;  2EOJ A;  1X3C A;  2LT7 A;  2YSO A;  2EN8 A;  2EPC A;  1NCS A;  4F6N A;  4R2D A;  2EOQ A;  2LO3 A;  5KL5 A;  2EPZ A;  3MHH C;  1ZR9 A;  2VRD A;  2DMI A;  5KL6 A;  1A1K A;  2EOS A;  3M99 B;  2R1F A;  2YTN A;  1A1H A;  1YSA C;  1JK1 A;  1ZU1 A;  2EMK A;  2EPP A;  4R2A A;  2EM8 A;  2LVH A;  3EPJ A;  2A25 A;  2EN2 A;  2EML A;  1X6H A;  2ADR A;  1A1I A;  2EM7 A;  2EN3 A;  2ENA A;  2EL6 A;  2WBS A;  2EOZ A;  2EMF A;  2EN1 A;  2LV2 A;  1P47 A;  1A1L A;  1LLM C;  2EMY A;  2RSI A;  2EN4 A;  2HGH A;  1DGC A;  2EMI A;  1UBD C;  2EQ1 A;  1Z1B A;  2EPR A;  2YTI A;  4M9V C;  1X6E A;  2DLK A;  2M9A A;  2YTJ A;  2JPA A;  2EM4 A;  4F6M A;  1G2D C;  2ENC A;  5KL4 A;  3EPH A;  1X6F A;  2EM6 A;  4R2Q A;  2RPC A;  2LCE A;  5KL7 A;  4R2R A;  2EOF A;  2MKN A;  2EQ3 A;  4WSG A;  2YTE A;  2EN6 A;  2YTO A;  2EMG A;  2YTF A;  1A1F A;  2EM3 A;  2EOI A;  4FK5 C;  2EPU A;  2EM2 A;  2EN7 A;  1YUI A;  1TF3 A;  3MHS C;  1UN6 B;  4R2S A;  1G2F C;  2EOR A;  2J7J A;  1A1G A;  2EM9 A;  2CT1 A;  2EMX A;  1WJP A;  2EMH A;  2ENH A;  2GHF A;  2EMZ A;  2PRT A;  1BBO A;  2EP3 A;  2YRH A;  2EOM A;  2DGC A;  2EOE A;  2EE8 A;  2YTD A;  2JP9 A;  4R2E A;  2BB8 A;  1BB8 A;  3VHT B;  3EPL A;  2EOH A;  2GLI A;  2EMW A;  1A1J A;  2EL5 A;  2EM0 A;  2MKD A;  2WBU A;  2YSP A;  1KJK A;  4IJD A;  2D9H A;  1F2I G;  4X9J A;  2EOY A;  2I13 A;  2EMB A;  3EPK A;  2EMA A;  2WBT A;  2YTG A;  1TN9 A;  2YU8 A;  1RMD A;  2EM5 A; 
#chains in the Genus database with same CATH topology
 4WX9 A;  2YTP A;  3HPZ A;  4O43 A;  4F2J C;  2ELZ A;  2CTD A;  1MEY C;  5IV8 B;  1PJS A;  5KL2 A;  1ZBQ A;  4LFB E;  2RSM A;  4JI3 E;  1B69 A;  4M0V A;  1N33 E;  2G7H A;  4GKK E;  3J80 C;  2EOO A;  2EOJ A;  4L8N A;  2LT7 A;  2MDR A;  3BGH A;  4R2D A;  3VYX A;  2EOQ A;  2EPZ A;  1AH5 A;  2B3T B;  3C4T A;  1ZR9 A;  2DMI A;  3BID A;  2JYA A;  5LMN E;  5AAS A;  2RS6 A;  4DR1 E;  2EMK A;  2EPP A;  2WZO A;  3KWR A;  4LF6 E;  2IHR 1;  4F54 A;  3EPJ A;  2LTR A;  2EN2 A;  1WXR A;  2FGG A;  2ADR A;  2KON A;  2ENA A;  4KHP E;  3F6G A;  1QNT A;  4O24 A;  2B7V A;  1DQ3 A;  1PKP A;  1P47 A;  4JI5 E;  3C6M A;  4DR7 E;  1LLM C;  4M2Z A;  4TUG A;  4JI1 E;  1DGC A;  4O4K A;  2K7I A;  2LUQ A;  1X6E A;  2LMZ A;  5AE2 A;  3LML A;  2DB2 A;  4DV5 E;  2LBS B;  4R2Q A;  4LFA E;  2L6M A;  5IXM B;  4OX9 E;  3OTO E;  4WSG A;  2FTX B;  2JOB A;  4R8O A;  4I8O A;  2YTF A;  3IWC A;  2EPL X;  2NUG A;  4FK5 C;  2VQE E;  2RTX A;  2DSY A;  1T4N A;  1WHN A;  3MHS C;  2DIX A;  1YUI A;  1UN6 B;  2L2N A;  2V87 A;  3KZY A;  1G2F C;  2EOR A;  4WXC A;  2L2K B;  2LUP B;  2EM9 A;  2M4I A;  4F9A B;  4X64 E;  2B7T A;  2V88 A;  3C6K A;  3HPS A;  2EOM A;  1SR9 A;  4P78 A;  2L3J A;  5AC4 A;  5F3W A;  4YY3 E;  3EQ1 A;  4R2E A;  2BB8 A;  2UXB E;  1YPN A;  4B3R E;  2EMW A;  2UUB E;  2B9D A;  3HXL A;  5A2Q C;  1FKA E;  4JV5 E;  4BBY A;  4LF4 E;  4DUZ E;  3ADL A;  2ZM6 E;  2RS7 A;  4HEI A;  4F9C B;  2YU8 A;  1RMD A;  1MGT A;  2EPO A;  1KYQ A;  2NAB A;  5KL3 A;  1T38 A;  3AV0 A;  3JAM C;  4DR5 E;  2EJ4 A;  1TF6 A;  2EPM X;  4JI4 E;  2JVA A;  2MDG A;  4B3S E;  4B3T E;  3DF6 A;  4RH8 A;  4IS1 C;  1AAY A;  4DR6 E;  4X65 E;  2YSO A;  2EN8 A;  2Q8U A;  1A1K A;  1SFE A;  1A1H A;  4J8Z A;  1ZU1 A;  2V85 A;  3THN A;  2L92 A;  1X6H A;  1A1I A;  2GPI A;  2EL6 A;  2ODR C;  5IWA E;  2EMF A;  2EN1 A;  3K6Q A;  1BBG A;  4DR2 E;  4BHC A;  4X62 E;  3ADI A;  2RSI A;  5A6B D;  2EMI A;  5A6K A;  1HNZ E;  4JI8 E;  2EPR A;  4M9V C;  1PJT A;  2DLK A;  2YTJ A;  4JI2 E;  2JPA A;  5LL6 R;  4L5N C;  3J7A G;  5KL4 A;  4DV2 E;  5ADZ A;  3P1X A;  2EM6 A;  4NXN E;  1XNQ E;  4JI0 E;  2UXC E;  2JR1 A;  4R2R A;  2MKN A;  3T1H E;  2EQ3 A;  1EH8 A;  5AE1 A;  2EN6 A;  2YTO A;  2EMG A;  4MLV A;  2EM3 A;  2EOI A;  4KWY A;  3F6H A;  2EN7 A;  1TF3 A;  1IMU A;  3LLH A;  4WYQ B;  2NUE A;  3IWD A;  3J81 C;  2HC5 A;  3TQM A;  2CT1 A;  2EMX A;  2EMH A;  1IQS A;  1BBO A;  2DMY A;  2YRH A;  2K4V A;  4LF8 E;  5LLQ A;  4WXD A;  2DGC A;  2RQL A;  3IWB A;  1IBK E;  2EE8 A;  5T6J A;  2JP9 A;  1GZ6 A;  1X48 A;  3VHT B;  2GLI A;  1A1J A;  4WSP A;  2EL5 A;  2EM0 A;  2MKD A;  2WBU A;  2L3C A;  2D9H A;  1F2I G;  2N3G A;  4X9J A;  4JI6 E;  2WBT A;  3ECR A;  2FV4 B;  4BC7 A;  1YFH A;  2WCC 3;  2DRP A;  4B3M E;  2E72 A;  5BR8 E;  4O5G A;  1I94 E;  2EQ0 A;  2YRK A;  1T4L B;  2V8Q B;  1ZAA C;  2EPA A;  4GZN C;  2YTQ A;  1EH6 A;  2ELY A;  2NUF A;  1X5W A;  3H09 A;  3UK3 C;  1YUJ A;  2DLQ A;  1JK2 A;  2CSH A;  1PDA A;  5A6J A;  2I9I A;  1WRJ A;  5IT9 C;  2LTS A;  5KL5 A;  4YHH E;  4F9B B;  5KL6 A;  2L2M A;  4KZS A;  4LF5 E;  4M30 A;  4R2A A;  2EM8 A;  4BC9 A;  2A25 A;  1UIL A;  4DKK A;  2EN3 A;  4WPY A;  4JI7 E;  4X8W A;  1X47 A;  2EWL A;  2M1S A;  4BHB A;  1EKZ A;  2HGH A;  3BF2 A;  1FJG E;  2EQ1 A;  2ODR D;  1YZ9 A;  3T1Y E;  2EM4 A;  4F6M A;  2ENC A;  3EPH A;  1X6F A;  4NZV A;  1T4O A;  3OML A;  2V86 A;  2LCE A;  5KL7 A;  4DV4 E;  2EOF A;  2YTE A;  4GKJ E;  1L4S A;  1N36 E;  4DV6 E;  4BCA A;  1A1F A;  4DMI A;  5DNY A;  4K0K E;  1XMO E;  2F4V E;  2VQF E;  4TUI A;  4R2S A;  2N8X A;  1QU6 A;  1XNR E;  1A1G A;  4BMJ A;  2EPN A;  2PRT A;  1HNX E;  2H36 X;  3JTZ A;  2KHX A;  3MSW A;  3ADG A;  2V83 A;  4DR4 E;  1NEI A;  4DUY E;  4JYA E;  2EOE A;  1N32 E;  2CPN A;  2LE2 A;  2YTD A;  3JU0 A;  2HJJ A;  1IBM E;  1RC7 A;  2MC5 A;  2MC6 A;  1BB8 A;  4LFC E;  3EPL A;  2HHH E;  4R03 A;  3VK6 A;  1KJK A;  4AQY E;  2VE7 C;  2EOY A;  2LRS A;  2I13 A;  2EMB A;  3EPK A;  1DI2 A;  4OOG C;  4DV3 E;  5AC5 A;  2EM5 A;  4DV7 E;  1ZBT A;  2EL4 A;  4NXM E;  2JOX A;  1STU A;  2YT4 A;  4R2P A;  5A6B A;  2EPX A;  2UUA E;  2R76 A;  2EPK X;  1HR0 E;  4N4R B;  3AUZ A;  2EMC A;  4LF7 E;  3DJW A;  2V89 A;  2YRM A;  1YYW A;  1EH7 A;  4R2C A;  2EOX A;  2YU5 A;  5TSE A;  3HTX A;  1X3C A;  2JXP A;  4HTG A;  2N3H A;  3VYY A;  2EPC A;  1NCS A;  4LU9 A;  4F6N A;  1YYK A;  2LO3 A;  3MHH C;  5AE3 A;  2M7Q A;  2VRD A;  2EOS A;  3M99 B;  2LJU A;  2R1F A;  2YTN A;  2L33 A;  4Q35 B;  2UU9 E;  1YSA C;  2YPN A;  2E5L E;  2F8B A;  1JK1 A;  2LVH A;  3HQ1 A;  2EML A;  1UHZ A;  2EM7 A;  5A69 A;  4ZYG A;  2WBS A;  2EOZ A;  2VF1 A;  2LV2 A;  2YZT A;  4NHR A;  4ZYD A;  3J7Y p;  1A1L A;  2EMY A;  2UUC E;  5LMU E;  2EN4 A;  2L8T A;  1N3G A;  3ADJ A;  4ZYH A;  1UBD C;  2JY9 A;  1Z1B A;  2YTI A;  4DV0 E;  2KOU A;  3KZZ A;  4LF9 E;  1HNW E;  2JWO A;  1G2D C;  2NA2 A;  2YWQ A;  2RPC A;  3C4B A;  5FLX C;  1IQO A;  4P7D A;  4RHB B;  2EZ6 A;  1IBL E;  1X49 A;  4MLQ A;  4ZYE A;  2EPU A;  3RMP A;  2EM2 A;  1T39 A;  4BS9 A;  1J5E E;  3L00 A;  1GQE A;  1PJQ A;  4Q28 A;  1XMQ E;  2J7J A;  2LJH A;  1WJP A;  2ENH A;  4LTY A;  2GHF A;  2EMZ A;  2UXD E;  2EP3 A;  5A6A A;  2E1M A;  3FIG A;  1GTK A;  1J26 A;  3QG5 C;  2EOH A;  1WHQ A;  4DR3 E;  4DV1 E;  5CFF E;  2BBG A;  1YYO A;  4X66 E;  2YSP A;  1O0W A;  1RQ0 A;  4IJD A;  3BBG A;  4WFT A;  4GEQ B;  2EMA A;  2YTG A;  1N34 E;  1TN9 A;  3ZOQ B;  2M9A A;  3THO B; 
#chains in the Genus database with same CATH homology
 2WCC 3;  2EL4 A;  2YTP A;  2DRP A;  2E72 A;  4F2J C;  2ELZ A;  2CTD A;  2EQ0 A;  2YRK A;  1MEY C;  2NAB A;  5KL3 A;  4R2P A;  1ZAA C;  2EPA A;  4GZN C;  2EPX A;  2ELY A;  2YTQ A;  5KL2 A;  1X5W A;  2EJ4 A;  1TF6 A;  2EMC A;  3UK3 C;  2MDG A;  1B69 A;  1YUJ A;  2YRM A;  2DLQ A;  1JK2 A;  2CSH A;  2EOX A;  4R2C A;  2YU5 A;  4IS1 C;  1AAY A;  2EOO A;  2EOJ A;  1X3C A;  2LT7 A;  2YSO A;  2EN8 A;  2EPC A;  1NCS A;  4F6N A;  4R2D A;  2EOQ A;  2LO3 A;  5KL5 A;  2EPZ A;  3MHH C;  1ZR9 A;  2VRD A;  2DMI A;  5KL6 A;  1A1K A;  2EOS A;  3M99 B;  2R1F A;  2YTN A;  1A1H A;  1YSA C;  1JK1 A;  1ZU1 A;  2EMK A;  2EPP A;  4R2A A;  2EM8 A;  2LVH A;  3EPJ A;  2A25 A;  2EN2 A;  2EML A;  1X6H A;  2ADR A;  1A1I A;  2EM7 A;  2EN3 A;  2ENA A;  2EL6 A;  2WBS A;  2EOZ A;  2EMF A;  2EN1 A;  2LV2 A;  1P47 A;  1A1L A;  1LLM C;  2EMY A;  2RSI A;  2EN4 A;  2HGH A;  1DGC A;  2EMI A;  1UBD C;  2EQ1 A;  1Z1B A;  2EPR A;  2YTI A;  4M9V C;  1X6E A;  2DLK A;  2M9A A;  2YTJ A;  2JPA A;  2EM4 A;  4F6M A;  1G2D C;  2ENC A;  5KL4 A;  3EPH A;  1X6F A;  2EM6 A;  4R2Q A;  2RPC A;  2LCE A;  5KL7 A;  4R2R A;  2EOF A;  2MKN A;  2EQ3 A;  4WSG A;  2YTE A;  2EN6 A;  2YTO A;  2EMG A;  2YTF A;  1A1F A;  2EM3 A;  2EOI A;  4FK5 C;  2EPU A;  2EM2 A;  2EN7 A;  1YUI A;  1TF3 A;  3MHS C;  1UN6 B;  4R2S A;  1G2F C;  2EOR A;  2J7J A;  1A1G A;  2EM9 A;  2CT1 A;  2EMX A;  1WJP A;  2EMH A;  2ENH A;  2GHF A;  2EMZ A;  2PRT A;  1BBO A;  2EP3 A;  2YRH A;  2EOM A;  2DGC A;  2EOE A;  2EE8 A;  2YTD A;  2JP9 A;  4R2E A;  2BB8 A;  1BB8 A;  3VHT B;  3EPL A;  2EOH A;  2GLI A;  2EMW A;  1A1J A;  2EL5 A;  2EM0 A;  2MKD A;  2WBU A;  2YSP A;  1KJK A;  4IJD A;  2D9H A;  1F2I G;  4X9J A;  2EOY A;  2I13 A;  2EMB A;  3EPK A;  2EMA A;  2WBT A;  2YTG A;  1TN9 A;  2YU8 A;  1RMD A;  2EM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...