2EPRA

Solution structure of the secound zinc finger domain of zinc finger protein 278
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
48
Chain Sequence
GSSGSSGRTRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POZ-, AT hook-, and zinc finger-containing protein 1
publication title Solution structure of the secound zinc finger domain of Zinc finger protein 278
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eprA01
2M9AA 2EM2A 2WCC3 2EMKA 2YRHA 1A1KA 5KL2A 2ENCA 2EMWA 2EM0A 2EOZA 2YRKA 2YU5A 2A25A 2EN4A 2WBTA 5KL5A 2EM9A 1F2IG 2BB8A 2EMBA 2LT7A 1DGCA 1UBDC 2EOYA 2EMCA 4R2RA 2EP3A 2YSPA 2NABA 4R2PA 2EPAA 2HGHA 2EOHA 3MHHC 4R2DA 2EN2A 1NCSA 2YTPA 3EPHA 4M9VC 1P47A 2EORA 2YTFA 2DLQA 2VRDA 1ZR9A 2EMHA 2EMFA 2YTGA 2EOJA 2PRTA 1A1IA 2EOOA 2EOFA 1TN9A 2GLIA 2EJ4A 2LV2A 1BBOA 2YTJA 2EOXA 2EE8A 2EM3A 2EMGA 2EN1A 2EN3A 2EQ0A 2EM6A 2CSHA 1X6EA 2YTIA 4IS1C 2EQ3A 1X6FA 2CTDA 2EPZA 4R2CA 2EM4A 2MDGA 2MKNA 4R2AA 2LCEA 4WSGA 1TF3A 1Z1BA 2EM8A 2EL5A 2D9HA 2E72A 5KL3A 3EPLA 2LO3A 2EN6A 4R2EA 2CT1A 2WBSA 1JK2A 2YTDA 2YTEA 2YTQA 4F6MA 2EMAA 2EOMA 1A1LA 5KL7A 2LVHA 2DMIA 2WBUA 2YSOA 2EPRA 2EOQA 2J7JA 1JK1A 2RSIA 1KJKA 3MHSC 1G2DC 2I13A 4F6NA 1X3CA 2EMLA 1TF6A 2EL4A 1B69A 1G2FC 1WJPA 2EN7A 4GZNC 2ENHA 2ELYA 2MKDA 2ENAA 3EPKA 2EM7A 2EMZA 3VHTB 2EL6A 1ZAAC 1BB8A 2YU8A 1A1HA 1MEYC 2EOEA 4X9JA 4IJDA 5KL4A 4R2QA 4FK5C 1YUJA 2EQ1A 3M99B 1UN6B 2EPCA 2EN8A 2EMXA 5KL6A 4R2SA 2EMIA 2ADRA 2EM5A 1YSAC 2ELZA 2JPAA 2EPXA 2YTNA 2EPUA 1ZU1A 1YUIA 2YRMA 1X5WA 3UK3C 2YTOA 2DRPA 2R1FA 1AAYA 3EPJA 2GHFA 1X6HA 2RPCA 2EOSA 1LLMC 2DLKA 1A1JA 2EOIA 2EPPA 2EMYA 4F2JC 2DGCA 2JP9A 1A1GA 1A1FA 1RMDA
chains in the Genus database with same CATH superfamily
2EM2A 2L2MA 2EOZA 2YU5A 4F54A 2EM9A 4HTGA 1DGCA 2FGGA 4LFCE 5AE3A 3J80C 4DUYE 2M1SA 2EP3A 2NABA 4DR6E 2EPAA 4M0VA 2KOUA 1WXRA 1P47A 2BBGA 4DV2E 1IQOA 4X62E 2PRTA 3FIGA 4KWYA 1N34E 4NZVA 2H36X 2G7HA 2EWLA 1YZ9A 1X6EA 2YTIA 4IS1C 3VK6A 4O24A 1XMOE 2UUAE 2LUQA 4DV3E 2CTDA 2EPZA 3AV0A 2RSMA 3F6GA 2L8TA 2MDGA 4R2AA 4WSGA 4JI6E 2MDRA 2EM8A 2EL5A 2D9HA 4WXCA 4M30A 5KL3A 2LO3A 2EN6A 2CT1A 2WBSA 5LMNE 4F6MA 2DIXA 4L5NC 2LTRA 2LVHA 4JI5E 2LJHA 4JI1E 2EOQA 4DR3E 1KJKA 2VQFE 4R03A 3DF6A 1G2DC 2I13A 3RMPA 2EL4A 1PJQA 2EN7A 2ELYA 2MKDA 3ECRA 3IWCA 2RS6A 1UHZA 1ZAAC 4LF4E 3ADJA 4ZYEA 2YU8A 4BBYA 2CPNA 2EOEA 5F3WA 4JV5E 4MLVA 1ZBQA 1UN6B 2ODRC 4R2SA 4X65E 1YSAC 2EPXA 1YUIA 1N32E 1DI2A 3KWRA 1X48A 1EH7A 4O5GA 5A6KA 3UK3C 2R1FA 2L3JA 1LLMC 3J81C 2DLKA 3HPSA 1YYOA 2EPPA 3C4TA 3BF2A 2EMYA 1RC7A 3JAMC 1A1FA 5IWAE 2B3TB 1RMDA 3P1XA 2EPNA 3ZOQB 4BC9A 2EMKA 1A1KA 5KL2A 2JWOA 4O4KA 4ZYDA 4JI3E 4JI4E 2EM0A 2A25A 2K4VA 1PJSA 2WBTA 1MGTA 5KL5A 4GEQB 1EH6A 2EOYA 1BBGA 4KZSA 4R2PA 2YSPA 4OX9E 4R2DA 3MHHC 2EN2A 1YPNA 2UUCE 4LF9E 2V88A 3T1HE 4DKKA 2EORA 2VRDA 1ZR9A 2YTGA 1A1IA 2EOOA 4DR2E 5A6BD 1N3GA 2NUFA 2EMGA 2EN1A 2EN3A 5TSEA 2K7IA 2L2NA 2B7VA 5A2QC 2EQ3A 1X6FA 4R2CA 4YY3E 1YYKA 2EM4A 4TUIA 2MKNA 2M4IA 4F9BB 2KHXA 4LF5E 2ODRD 2EPKX 2VF1A 3ADGA 1IBKE 1JK2A 2YTDA 2LTSA 2YTQA 2VQEE 2WBUA 4LTYA 2J7JA 1EH8A 2N8XA 3QG5C 4P78A 1I94E 1GZ6A 4WX9A 2IHR1 2RTXA 2ENHA 3TQMA 3EPKA 3VHTB 2EL6A 4LF7E 2GPIA 4GKKE 4IJDA 4R2QA 5LMUE 1YUJA 2E1MA 1AH5A 2RS7A 3C6KA 5KL6A 2EMIA 3IWDA 4NXNE 5AC5A 3AUZA 2FV4B 4WXDA 2EPUA 1WHNA 3MSWA 4LU9A 3LMLA 2YTOA 2DRPA 4X66E 4B3TE 1X6HA 1XNRE 2VE7C 1YFHA 1X47A 2NUEA 1EKZA 1STUA 1IBME 4DMIA 1FKAE 1KYQA 2DGCA 2JY9A 3KZYA 4ZYHA 5FLXC 1T4NA 1J26A 5BR8E 2YRHA 4GKJE 4WFTA 2DMYA 2EZ6A 4BS9A 2EMWA 1F2IG 2BB8A 2F8BA 2JVAA 2EMBA 4J8ZA 2V83A 1DQ3A 2EMCA 4R2RA 4M2ZA 2HGHA 2EOHA 2EPLX 2V8QB 4NXME 1NCSA 2YTPA 4X64E 4LFAE 2EMHA 1HNXE 1QNTA 2GLIA 2EOFA 3DJWA 4JI2E 2EOXA 1X49A 5LL6R 1RQ0A 1UILA 3F6HA 2EM6A 3VYXA 5A69A 1NEIA 1FJGE 2L33A 4KHPE 2JR1A 2LCEA 2JYAA 2MC6A 3H09A 2I9IA 5ADZA 4R2EA 3THNA 2YTEA 2EMAA 2EOMA 2YT4A 1A1LA 5KL7A 4DR7E 4JYAE 3BIDA 3K6QA 4P7DA 2YSOA 1PDAA 4DR4E 1JK1A 2RSIA 3OMLA 4RHBB 3ADLA 4F6NA 2LE2A 2Q8UA 2B7TA 1WJPA 4F9CB 5DNYA 4L8NA 3EQ1A 4TUGA 3J7AG 5LLQA 1BB8A 1T4LB 4DV4E 2N3HA 1MEYC 2UUBE 3OTOE 2LMZA 2UXDE 5IXMB 4HEIA 2EQ1A 2EPCA 4AQYE 3HPZA 4WYQB 4DV1E 2EM5A 2ELZA 2L3CA 2YTNA 1ZU1A 4X8WA 1N36E 1GQEA 2YPNA 4R8OA 2HJJA 4B3RE 5A6BA 3EPJA 2GHFA 2RPCA 3C6MA 1J5EE 1L4SA 2EOSA 3JU0A 2JOBA 2EOIA 1PJTA 5IT9C 1SFEA 4BMJA 4JI8E 4ZYGA 2L2KB 2M9AA 2WCC3 4WPYA 2L6MA 2ZM6E 3THOB 2ENCA 4DUZE 2JOXA 5AE2A 1HR0E 2NUGA 2YRKA 2EN4A 3L00A 2LT7A 1UBDC 2B9DA 1QU6A 1T38A 1T4OA 2UXBE 1O0WA 4OOGC 3EPHA 4M9VC 4MLQA 2F4VE 2RQLA 1HNZE 2YTFA 2DLQA 2MC5A 5AC4A 1WRJA 2M7QA 2EMFA 2UXCE 2EOJA 1BBOA 1TN9A 2EJ4A 2LV2A 2DSYA 2YTJA 4O43A 4F9AB 4LF8E 2EE8A 2EM3A 1HNWE 4BHBA 4WSPA 5CFFE 4DV6E 2EQ0A 2HC5A 1IQSA 2CSHA 4JI7E 3C4BA 2YWQA 2WZOA 2YZTA 5AE1A 2LJUA 3T1YE 5A6AA 2N3GA 4NHRA 1ZBTA 1TF3A 1Z1BA 3BGHA 2V85A 5AASA 2E72A 4BCAA 3EPLA 2EPMX 4LF6E 3KZZA 3J7Yp 2E5LE 2HHHE 2UU9E 3HXLA 2DMIA 1SR9A 4RH8A 1XMQE 1T39A 2LRSA 2EPRA 4DV0E 3JTZA 2V89A 3IWBA 2LBSB 2L92A 3MHSC 1XNQE 2V86A 1X3CA 4LFBE 5IV8B 2EMLA 1TF6A 4N4RB 1B69A 1G2FC 4GZNC 4YHHE 3VYYA 2ENAA 2EM7A 2NA2A 2EMZA 1WHQA 2V87A 3BBGA 1IMUA 2JXPA 1A1HA 2R76A 2FTXB 3ADIA 2KONA 4X9JA 4K0KE 5KL4A 2LUPB 4FK5C 4B3SE 3LLHA 3M99B 2EPOA 4I8OA 4BHCA 2EN8A 2EMXA 2ADRA 4DR1E 2JPAA 4DR5E 2YRMA 4Q28A 1X5WA 1PKPA 4DV5E 1AAYA 4JI0E 4BC7A 1GTKA 2DB2A 1A1JA 4DV7E 1N33E 1YYWA 4Q35B 1IBLE 4F2JC 5T6JA 4B3ME 5A6JA 2JP9A 1A1GA 3HTXA 3HQ1A
chains in the Genus database with same CATH topology
2M9AA 2EM2A 2WCC3 2EMKA 2YRHA 1A1KA 5KL2A 2ENCA 2EMWA 2EM0A 2EOZA 2YRKA 2YU5A 2A25A 2EN4A 2WBTA 5KL5A 2EM9A 1F2IG 2BB8A 2EMBA 2LT7A 1DGCA 1UBDC 2EOYA 2EMCA 4R2RA 2EP3A 2YSPA 2NABA 4R2PA 2EPAA 2HGHA 2EOHA 3MHHC 4R2DA 2EN2A 1NCSA 2YTPA 3EPHA 4M9VC 1P47A 2EORA 2YTFA 2DLQA 2VRDA 1ZR9A 2EMHA 2EMFA 2YTGA 2EOJA 2PRTA 1A1IA 2EOOA 2EOFA 1TN9A 2GLIA 2EJ4A 2LV2A 1BBOA 2YTJA 2EOXA 2EE8A 2EM3A 2EMGA 2EN1A 2EN3A 2EQ0A 2EM6A 2CSHA 1X6EA 2YTIA 4IS1C 2EQ3A 1X6FA 2CTDA 2EPZA 4R2CA 2EM4A 2MDGA 2MKNA 4R2AA 2LCEA 4WSGA 1TF3A 1Z1BA 2EM8A 2EL5A 2D9HA 2E72A 5KL3A 3EPLA 2LO3A 2EN6A 4R2EA 2CT1A 2WBSA 1JK2A 2YTDA 2YTEA 2YTQA 4F6MA 2EMAA 2EOMA 1A1LA 5KL7A 2LVHA 2DMIA 2WBUA 2YSOA 2EPRA 2EOQA 2J7JA 1JK1A 2RSIA 1KJKA 3MHSC 1G2DC 2I13A 4F6NA 1X3CA 2EMLA 1TF6A 2EL4A 1B69A 1G2FC 1WJPA 2EN7A 4GZNC 2ENHA 2ELYA 2MKDA 2ENAA 3EPKA 2EM7A 2EMZA 3VHTB 2EL6A 1ZAAC 1BB8A 2YU8A 1A1HA 1MEYC 2EOEA 4X9JA 4IJDA 5KL4A 4R2QA 4FK5C 1YUJA 2EQ1A 3M99B 1UN6B 2EPCA 2EN8A 2EMXA 5KL6A 4R2SA 2EMIA 2ADRA 2EM5A 1YSAC 2ELZA 2JPAA 2EPXA 2YTNA 2EPUA 1ZU1A 1YUIA 2YRMA 1X5WA 3UK3C 2YTOA 2DRPA 2R1FA 1AAYA 3EPJA 2GHFA 1X6HA 2RPCA 2EOSA 1LLMC 2DLKA 1A1JA 2EOIA 2EPPA 2EMYA 4F2JC 2DGCA 2JP9A 1A1GA 1A1FA 1RMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9A A;  2EM2 A;  2WCC 3;  2EMK A;  2YRH A;  1A1K A;  5KL2 A;  2ENC A;  2EMW A;  2EM0 A;  2EOZ A;  2YRK A;  2YU5 A;  2A25 A;  2EN4 A;  2WBT A;  5KL5 A;  2EM9 A;  1F2I G;  2BB8 A;  2EMB A;  2LT7 A;  1DGC A;  1UBD C;  2EOY A;  2EMC A;  4R2R A;  2EP3 A;  2YSP A;  2NAB A;  4R2P A;  2EPA A;  2HGH A;  2EOH A;  3MHH C;  4R2D A;  2EN2 A;  1NCS A;  2YTP A;  3EPH A;  4M9V C;  1P47 A;  2EOR A;  2YTF A;  2DLQ A;  2VRD A;  1ZR9 A;  2EMH A;  2EMF A;  2YTG A;  2EOJ A;  2PRT A;  1A1I A;  2EOO A;  2EOF A;  1TN9 A;  2GLI A;  2EJ4 A;  2LV2 A;  1BBO A;  2YTJ A;  2EOX A;  2EE8 A;  2EM3 A;  2EMG A;  2EN1 A;  2EN3 A;  2EQ0 A;  2EM6 A;  2CSH A;  1X6E A;  2YTI A;  4IS1 C;  2EQ3 A;  1X6F A;  2CTD A;  2EPZ A;  4R2C A;  2EM4 A;  2MDG A;  2MKN A;  4R2A A;  2LCE A;  4WSG A;  1TF3 A;  1Z1B A;  2EM8 A;  2EL5 A;  2D9H A;  2E72 A;  5KL3 A;  3EPL A;  2LO3 A;  2EN6 A;  4R2E A;  2CT1 A;  2WBS A;  1JK2 A;  2YTD A;  2YTE A;  2YTQ A;  4F6M A;  2EMA A;  2EOM A;  1A1L A;  5KL7 A;  2LVH A;  2DMI A;  2WBU A;  2YSO A;  2EPR A;  2EOQ A;  2J7J A;  1JK1 A;  2RSI A;  1KJK A;  3MHS C;  1G2D C;  2I13 A;  4F6N A;  1X3C A;  2EML A;  1TF6 A;  2EL4 A;  1B69 A;  1G2F C;  1WJP A;  2EN7 A;  4GZN C;  2ENH A;  2ELY A;  2MKD A;  2ENA A;  3EPK A;  2EM7 A;  2EMZ A;  3VHT B;  2EL6 A;  1ZAA C;  1BB8 A;  2YU8 A;  1A1H A;  1MEY C;  2EOE A;  4X9J A;  4IJD A;  5KL4 A;  4R2Q A;  4FK5 C;  1YUJ A;  2EQ1 A;  3M99 B;  1UN6 B;  2EPC A;  2EN8 A;  2EMX A;  5KL6 A;  4R2S A;  2EMI A;  2ADR A;  2EM5 A;  1YSA C;  2ELZ A;  2JPA A;  2EPX A;  2YTN A;  2EPU A;  1ZU1 A;  1YUI A;  2YRM A;  1X5W A;  3UK3 C;  2YTO A;  2DRP A;  2R1F A;  1AAY A;  3EPJ A;  2GHF A;  1X6H A;  2RPC A;  2EOS A;  1LLM C;  2DLK A;  1A1J A;  2EOI A;  2EPP A;  2EMY A;  4F2J C;  2DGC A;  2JP9 A;  1A1G A;  1A1F A;  1RMD A; 
#chains in the Genus database with same CATH topology
 2EM2 A;  2L2M A;  2EOZ A;  2YU5 A;  4F54 A;  2EM9 A;  4HTG A;  1DGC A;  2FGG A;  4LFC E;  5AE3 A;  3J80 C;  4DUY E;  2M1S A;  2EP3 A;  2NAB A;  4DR6 E;  2EPA A;  4M0V A;  2KOU A;  1WXR A;  1P47 A;  2BBG A;  4DV2 E;  1IQO A;  4X62 E;  2PRT A;  3FIG A;  4KWY A;  1N34 E;  4NZV A;  2H36 X;  2G7H A;  2EWL A;  1YZ9 A;  1X6E A;  2YTI A;  4IS1 C;  3VK6 A;  4O24 A;  1XMO E;  2UUA E;  2LUQ A;  4DV3 E;  2CTD A;  2EPZ A;  3AV0 A;  2RSM A;  3F6G A;  2L8T A;  2MDG A;  4R2A A;  4WSG A;  4JI6 E;  2MDR A;  2EM8 A;  2EL5 A;  2D9H A;  4WXC A;  4M30 A;  5KL3 A;  2LO3 A;  2EN6 A;  2CT1 A;  2WBS A;  5LMN E;  4F6M A;  2DIX A;  4L5N C;  2LTR A;  2LVH A;  4JI5 E;  2LJH A;  4JI1 E;  2EOQ A;  4DR3 E;  1KJK A;  2VQF E;  4R03 A;  3DF6 A;  1G2D C;  2I13 A;  3RMP A;  2EL4 A;  1PJQ A;  2EN7 A;  2ELY A;  2MKD A;  3ECR A;  3IWC A;  2RS6 A;  1UHZ A;  1ZAA C;  4LF4 E;  3ADJ A;  4ZYE A;  2YU8 A;  4BBY A;  2CPN A;  2EOE A;  5F3W A;  4JV5 E;  4MLV A;  1ZBQ A;  1UN6 B;  2ODR C;  4R2S A;  4X65 E;  1YSA C;  2EPX A;  1YUI A;  1N32 E;  1DI2 A;  3KWR A;  1X48 A;  1EH7 A;  4O5G A;  5A6K A;  3UK3 C;  2R1F A;  2L3J A;  1LLM C;  3J81 C;  2DLK A;  3HPS A;  1YYO A;  2EPP A;  3C4T A;  3BF2 A;  2EMY A;  1RC7 A;  3JAM C;  1A1F A;  5IWA E;  2B3T B;  1RMD A;  3P1X A;  2EPN A;  3ZOQ B;  4BC9 A;  2EMK A;  1A1K A;  5KL2 A;  2JWO A;  4O4K A;  4ZYD A;  4JI3 E;  4JI4 E;  2EM0 A;  2A25 A;  2K4V A;  1PJS A;  2WBT A;  1MGT A;  5KL5 A;  4GEQ B;  1EH6 A;  2EOY A;  1BBG A;  4KZS A;  4R2P A;  2YSP A;  4OX9 E;  4R2D A;  3MHH C;  2EN2 A;  1YPN A;  2UUC E;  4LF9 E;  2V88 A;  3T1H E;  4DKK A;  2EOR A;  2VRD A;  1ZR9 A;  2YTG A;  1A1I A;  2EOO A;  4DR2 E;  5A6B D;  1N3G A;  2NUF A;  2EMG A;  2EN1 A;  2EN3 A;  5TSE A;  2K7I A;  2L2N A;  2B7V A;  5A2Q C;  2EQ3 A;  1X6F A;  4R2C A;  4YY3 E;  1YYK A;  2EM4 A;  4TUI A;  2MKN A;  2M4I A;  4F9B B;  2KHX A;  4LF5 E;  2ODR D;  2EPK X;  2VF1 A;  3ADG A;  1IBK E;  1JK2 A;  2YTD A;  2LTS A;  2YTQ A;  2VQE E;  2WBU A;  4LTY A;  2J7J A;  1EH8 A;  2N8X A;  3QG5 C;  4P78 A;  1I94 E;  1GZ6 A;  4WX9 A;  2IHR 1;  2RTX A;  2ENH A;  3TQM A;  3EPK A;  3VHT B;  2EL6 A;  4LF7 E;  2GPI A;  4GKK E;  4IJD A;  4R2Q A;  5LMU E;  1YUJ A;  2E1M A;  1AH5 A;  2RS7 A;  3C6K A;  5KL6 A;  2EMI A;  3IWD A;  4NXN E;  5AC5 A;  3AUZ A;  2FV4 B;  4WXD A;  2EPU A;  1WHN A;  3MSW A;  4LU9 A;  3LML A;  2YTO A;  2DRP A;  4X66 E;  4B3T E;  1X6H A;  1XNR E;  2VE7 C;  1YFH A;  1X47 A;  2NUE A;  1EKZ A;  1STU A;  1IBM E;  4DMI A;  1FKA E;  1KYQ A;  2DGC A;  2JY9 A;  3KZY A;  4ZYH A;  5FLX C;  1T4N A;  1J26 A;  5BR8 E;  2YRH A;  4GKJ E;  4WFT A;  2DMY A;  2EZ6 A;  4BS9 A;  2EMW A;  1F2I G;  2BB8 A;  2F8B A;  2JVA A;  2EMB A;  4J8Z A;  2V83 A;  1DQ3 A;  2EMC A;  4R2R A;  4M2Z A;  2HGH A;  2EOH A;  2EPL X;  2V8Q B;  4NXM E;  1NCS A;  2YTP A;  4X64 E;  4LFA E;  2EMH A;  1HNX E;  1QNT A;  2GLI A;  2EOF A;  3DJW A;  4JI2 E;  2EOX A;  1X49 A;  5LL6 R;  1RQ0 A;  1UIL A;  3F6H A;  2EM6 A;  3VYX A;  5A69 A;  1NEI A;  1FJG E;  2L33 A;  4KHP E;  2JR1 A;  2LCE A;  2JYA A;  2MC6 A;  3H09 A;  2I9I A;  5ADZ A;  4R2E A;  3THN A;  2YTE A;  2EMA A;  2EOM A;  2YT4 A;  1A1L A;  5KL7 A;  4DR7 E;  4JYA E;  3BID A;  3K6Q A;  4P7D A;  2YSO A;  1PDA A;  4DR4 E;  1JK1 A;  2RSI A;  3OML A;  4RHB B;  3ADL A;  4F6N A;  2LE2 A;  2Q8U A;  2B7T A;  1WJP A;  4F9C B;  5DNY A;  4L8N A;  3EQ1 A;  4TUG A;  3J7A G;  5LLQ A;  1BB8 A;  1T4L B;  4DV4 E;  2N3H A;  1MEY C;  2UUB E;  3OTO E;  2LMZ A;  2UXD E;  5IXM B;  4HEI A;  2EQ1 A;  2EPC A;  4AQY E;  3HPZ A;  4WYQ B;  4DV1 E;  2EM5 A;  2ELZ A;  2L3C A;  2YTN A;  1ZU1 A;  4X8W A;  1N36 E;  1GQE A;  2YPN A;  4R8O A;  2HJJ A;  4B3R E;  5A6B A;  3EPJ A;  2GHF A;  2RPC A;  3C6M A;  1J5E E;  1L4S A;  2EOS A;  3JU0 A;  2JOB A;  2EOI A;  1PJT A;  5IT9 C;  1SFE A;  4BMJ A;  4JI8 E;  4ZYG A;  2L2K B;  2M9A A;  2WCC 3;  4WPY A;  2L6M A;  2ZM6 E;  3THO B;  2ENC A;  4DUZ E;  2JOX A;  5AE2 A;  1HR0 E;  2NUG A;  2YRK A;  2EN4 A;  3L00 A;  2LT7 A;  1UBD C;  2B9D A;  1QU6 A;  1T38 A;  1T4O A;  2UXB E;  1O0W A;  4OOG C;  3EPH A;  4M9V C;  4MLQ A;  2F4V E;  2RQL A;  1HNZ E;  2YTF A;  2DLQ A;  2MC5 A;  5AC4 A;  1WRJ A;  2M7Q A;  2EMF A;  2UXC E;  2EOJ A;  1BBO A;  1TN9 A;  2EJ4 A;  2LV2 A;  2DSY A;  2YTJ A;  4O43 A;  4F9A B;  4LF8 E;  2EE8 A;  2EM3 A;  1HNW E;  4BHB A;  4WSP A;  5CFF E;  4DV6 E;  2EQ0 A;  2HC5 A;  1IQS A;  2CSH A;  4JI7 E;  3C4B A;  2YWQ A;  2WZO A;  2YZT A;  5AE1 A;  2LJU A;  3T1Y E;  5A6A A;  2N3G A;  4NHR A;  1ZBT A;  1TF3 A;  1Z1B A;  3BGH A;  2V85 A;  5AAS A;  2E72 A;  4BCA A;  3EPL A;  2EPM X;  4LF6 E;  3KZZ A;  3J7Y p;  2E5L E;  2HHH E;  2UU9 E;  3HXL A;  2DMI A;  1SR9 A;  4RH8 A;  1XMQ E;  1T39 A;  2LRS A;  2EPR A;  4DV0 E;  3JTZ A;  2V89 A;  3IWB A;  2LBS B;  2L92 A;  3MHS C;  1XNQ E;  2V86 A;  1X3C A;  4LFB E;  5IV8 B;  2EML A;  1TF6 A;  4N4R B;  1B69 A;  1G2F C;  4GZN C;  4YHH E;  3VYY A;  2ENA A;  2EM7 A;  2NA2 A;  2EMZ A;  1WHQ A;  2V87 A;  3BBG A;  1IMU A;  2JXP A;  1A1H A;  2R76 A;  2FTX B;  3ADI A;  2KON A;  4X9J A;  4K0K E;  5KL4 A;  2LUP B;  4FK5 C;  4B3S E;  3LLH A;  3M99 B;  2EPO A;  4I8O A;  4BHC A;  2EN8 A;  2EMX A;  2ADR A;  4DR1 E;  2JPA A;  4DR5 E;  2YRM A;  4Q28 A;  1X5W A;  1PKP A;  4DV5 E;  1AAY A;  4JI0 E;  4BC7 A;  1GTK A;  2DB2 A;  1A1J A;  4DV7 E;  1N33 E;  1YYW A;  4Q35 B;  1IBL E;  4F2J C;  5T6J A;  4B3M E;  5A6J A;  2JP9 A;  1A1G A;  3HTX A;  3HQ1 A; 
#chains in the Genus database with same CATH homology
 2M9A A;  2EM2 A;  2WCC 3;  2EMK A;  2YRH A;  1A1K A;  5KL2 A;  2ENC A;  2EMW A;  2EM0 A;  2EOZ A;  2YRK A;  2YU5 A;  2A25 A;  2EN4 A;  2WBT A;  5KL5 A;  2EM9 A;  1F2I G;  2BB8 A;  2EMB A;  2LT7 A;  1DGC A;  1UBD C;  2EOY A;  2EMC A;  4R2R A;  2EP3 A;  2YSP A;  2NAB A;  4R2P A;  2EPA A;  2HGH A;  2EOH A;  3MHH C;  4R2D A;  2EN2 A;  1NCS A;  2YTP A;  3EPH A;  4M9V C;  1P47 A;  2EOR A;  2YTF A;  2DLQ A;  2VRD A;  1ZR9 A;  2EMH A;  2EMF A;  2YTG A;  2EOJ A;  2PRT A;  1A1I A;  2EOO A;  2EOF A;  1TN9 A;  2GLI A;  2EJ4 A;  2LV2 A;  1BBO A;  2YTJ A;  2EOX A;  2EE8 A;  2EM3 A;  2EMG A;  2EN1 A;  2EN3 A;  2EQ0 A;  2EM6 A;  2CSH A;  1X6E A;  2YTI A;  4IS1 C;  2EQ3 A;  1X6F A;  2CTD A;  2EPZ A;  4R2C A;  2EM4 A;  2MDG A;  2MKN A;  4R2A A;  2LCE A;  4WSG A;  1TF3 A;  1Z1B A;  2EM8 A;  2EL5 A;  2D9H A;  2E72 A;  5KL3 A;  3EPL A;  2LO3 A;  2EN6 A;  4R2E A;  2CT1 A;  2WBS A;  1JK2 A;  2YTD A;  2YTE A;  2YTQ A;  4F6M A;  2EMA A;  2EOM A;  1A1L A;  5KL7 A;  2LVH A;  2DMI A;  2WBU A;  2YSO A;  2EPR A;  2EOQ A;  2J7J A;  1JK1 A;  2RSI A;  1KJK A;  3MHS C;  1G2D C;  2I13 A;  4F6N A;  1X3C A;  2EML A;  1TF6 A;  2EL4 A;  1B69 A;  1G2F C;  1WJP A;  2EN7 A;  4GZN C;  2ENH A;  2ELY A;  2MKD A;  2ENA A;  3EPK A;  2EM7 A;  2EMZ A;  3VHT B;  2EL6 A;  1ZAA C;  1BB8 A;  2YU8 A;  1A1H A;  1MEY C;  2EOE A;  4X9J A;  4IJD A;  5KL4 A;  4R2Q A;  4FK5 C;  1YUJ A;  2EQ1 A;  3M99 B;  1UN6 B;  2EPC A;  2EN8 A;  2EMX A;  5KL6 A;  4R2S A;  2EMI A;  2ADR A;  2EM5 A;  1YSA C;  2ELZ A;  2JPA A;  2EPX A;  2YTN A;  2EPU A;  1ZU1 A;  1YUI A;  2YRM A;  1X5W A;  3UK3 C;  2YTO A;  2DRP A;  2R1F A;  1AAY A;  3EPJ A;  2GHF A;  1X6H A;  2RPC A;  2EOS A;  1LLM C;  2DLK A;  1A1J A;  2EOI A;  2EPP A;  2EMY A;  4F2J C;  2DGC A;  2JP9 A;  1A1G A;  1A1F A;  1RMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...