2EPRA

Solution structure of the secound zinc finger domain of zinc finger protein 278
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
48
Chain Sequence
GSSGSSGRTRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the secound zinc finger domain of Zinc finger protein 278
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords POZ-, AT hook-, and zinc finger-containing protein 1
total genus 7
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eprA01
2LCEA 2EORA 2CSHA 2EMKA 2EOIA 1JK1A 2D9HA 2EMFA 4F6NA 2EPUA 2EOEA 2EMCA 4R2PA 2YTJA 2GLIA 2EPPA 1G2DC 2YTIA 2EPZA 4R2DA 1B69A 2EN6A 2EOFA 2YTDA 2GHFA 2EPCA 2EOHA 1A1GA 2ELYA 2EOZA 2DRPA 2ADRA 4R2QA 2I13A 1A1HA 1DGCA 3M99B 2EM2A 2YSOA 2DLQA 2RSIA 1LLMC 1Z1BA 2EN8A 2LT7A 3VHTB 2EM8A 2EMBA 2EMHA 3EPKA 2EMXA 2YU8A 4GZNC 1X6FA 2DGCA 2YRKA 1BBOA 1X6HA 2WBTA 1JK2A 1A1IA 2EOYA 2JPAA 5KL3A 1WJPA 2EL5A 2EM4A 2EMYA 2ENCA 2EOMA 2YSPA 4IJDA 4X9JA 2EN3A 3EPLA 2BB8A 1MEYC 2YTFA 2EPRA 1ZAAC 2WCC3 1RMDA 1ZR9A 1YUJA 2EMGA 4F6MA 2EL6A 2EM7A 1A1KA 1YUIA 2YU5A 2E72A 2EM9A 2YRHA 4R2EA 2LO3A 4R2RA 2EPXA 1ZU1A 4F2JC 4FK5C 2YTEA 2A25A 2J7JA 2EOQA 2PRTA 5KL4A 5KL7A 2DLKA 4R2AA 2YTNA 1A1LA 2EQ0A 2YTPA 4WSGA 2VRDA 2DMIA 1X3CA 4M9VC 2JP9A 2EMZA 1X6EA 2EL4A 2MDGA 2MKDA 5KL5A 2EMIA 2EM0A 2YTOA 2EM6A 2YTGA 2LV2A 2CT1A 5KL6A 2EMWA 4R2CA 2YTQA 3MHHC 1UBDC 2EOOA 1AAYA 1BB8A 1TF3A 1G2FC 1TF6A 2EE8A 2LVHA 2WBSA 2EM5A 5KL2A 1A1JA 2EMAA 2EN4A 1YSAC 1UN6B 4R2SA 1NCSA 1X5WA 2ELZA 2EOSA 1A1FA 2CTDA 2EPAA 3EPJA 2EQ3A 2EOXA 1P47A 1KJKA 2ENHA 2RPCA 2ENAA 2WBUA 2EQ1A 2EJ4A 2EN1A 1F2IG 2EN7A 2EN2A 3MHSC 2EP3A 2M9AA 4IS1C 1TN9A 2R1FA 2MKNA 2NABA 2EMLA 2HGHA 3EPHA 2YRMA 2EM3A 3UK3C 2EOJA
chains in the Genus database with same CATH superfamily
4F6NA 2EPUA 2EOEA 2EMCA 1B69A 5IT9C 4KWYA 2G7HA 2EOHA 2L3CA 3RMPA 2ADRA 3FIGA 4BCAA 1A1HA 2YSOA 2UXBE 5A6JA 3J81C 4DV5E 1Z1BA 4F9CB 4DV6E 4M30A 3F6GA 4TUGA 2LT7A 4BMJA 2B9DA 1STUA 2B3TB 3VHTB 4BS9A 4DMIA 5LMUE 4GZNC 1IBKE 4DR4E 2N3GA 2YRKA 3L00A 4DV3E 2WBTA 4JI7E 2EOYA 2YPNA 2K4VA 1P47A 2EMYA 2L2NA 2EN3A 4HTGA 2BB8A 3ZOQB 2EPNA 4GEQB 5AE3A 1EH6A 5ADZA 2WCC3 4DR3E 1PJQA 4F6MA 2EM7A 4JI8E 1SR9A 2YRHA 1N3GA 4R2EA 2JOBA 4F2JC 1ZU1A 2A25A 3K6QA 1IMUA 2PRTA 5KL7A 1T4OA 2IHR1 3THOB 2L92A 1IBLE 4R2AA 2LTSA 2YTNA 3JU0A 4TUIA 2LJUA 2L2KB 4DV7E 2VRDA 1X3CA 4RHBB 4ZYGA 4ZYDA 2UXCE 2MKDA 5TSEA 4X62E 2EMIA 3C4TA 2EM0A 2VQFE 2EM6A 5KL6A 1UBDC 2YTQA 2NUFA 2EOOA 2LE2A 1YZ9A 2UXDE 1FKAE 2LVHA 5KL2A 2EMAA 2EN4A 1T4NA 2BBGA 4DR1E 1PKPA 4LFAE 2ODRD 1X5WA 2CTDA 2I9IA 2EQ3A 2EOXA 4AQYE 1KJKA 2ENHA 4B3ME 2WBUA 3IWBA 2EQ1A 4F54A 4L8NA 2M4IA 2L3JA 3J7AG 2EP3A 4P78A 3KWRA 3HXLA 2HHHE 1TN9A 4P7DA 2RS6A 1WRJA 2EPOA 2YRMA 1T39A 3UK3C 2B7VA 2EOIA 2EPPA 1G2DC 2YTIA 2EPZA 3BBGA 2V85A 4BC9A 4X8WA 3VK6A 5AE1A 2WZOA 4GKKE 4BHCA 1ZBQA 1EH7A 4R2QA 2I13A 2LBSB 2EZ6A 1GTKA 2FGGA 3M99B 4R03A 2DLQA 4O43A 1YYWA 4NZVA 4YY3E 3ADIA 1X6FA 1PDAA 1N36E 4F9BB 1XNRE 5KL3A 2V83A 5A69A 3IWDA 2V89A 2LRSA 4DR2E 1PJTA 2E1MA 4WYQB 3EQ1A 4JI4E 1ZR9A 1A1KA 2YU5A 1DQ3A 4WXDA 2UUAE 2LO3A 4R2RA 2EPXA 4O4KA 2NUGA 2J7JA 4M0VA 2R76A 1UILA 2N3HA 2V8QB 3MSWA 1J5EE 3C6MA 4MLVA 1WHNA 2EQ0A 2FTXB 3H09A 4MLQA 1HNZE 1NEIA 1X6EA 5KL5A 4DUZE 2YTOA 1X49A 4LFBE 4X64E 2ODRC 1RQ0A 2EPKX 5AC4A 2B7TA 5IXMB 2EM5A 4JI5E 3AUZA 2JWOA 4NXME 2LUPB 1L4SA 4R2SA 2EOSA 1A1FA 4B3TE 4Q28A 3EPJA 2V86A 5IWAE 2EJ4A 4OX9E 3ECRA 2EOJA 2R1FA 2MKNA 3LMLA 2EMLA 3EPHA 4B3SE 2L33A 5A2QC 1YFHA 3KZYA 4M2ZA 4BBYA 3QG5C 2GPIA 2CSHA 2EMKA 1JK1A 2EMFA 3THNA 1BBGA 2YTJA 4I8OA 4OOGC 1EKZA 2YTDA 2EOFA 4DR6E 1KYQA 2GHFA 1T38A 3HQ1A 2ELYA 1DI2A 3J80C 1ZBTA 1MGTA 4R8OA 2M1SA 2DRPA 1UHZA 4BHBA 4K0KE 2LMZA 3DF6A 4JI1E 2EM2A 4BC7A 4KHPE 2EN8A 2LTRA 2JYAA 2RSMA 2MC6A 2Q8UA 2EMBA 5AC5A 4O5GA 2EMHA 2EPLX 2EMXA 3ADGA 2DGCA 4LF5E 3DJWA 1JK2A 1A1IA 4LTYA 5A6AA 2JPAA 2EWLA 1WJPA 2EL5A 2YSPA 4X9JA 2EOMA 2VQEE 2YTFA 2EPRA 3T1YE 4WX9A 4WXCA 5LLQA 3HTXA 3JTZA 4DR5E 5AE2A 1RMDA 1YUJA 2EL6A 4LF6E 2E72A 2EM9A 1HNXE 4DV4E 4JYAE 3OMLA 4FK5C 2EOQA 5KL4A 3JAMC 4F9AB 1AH5A 5A6KA 2JOXA 2KHXA 2YTPA 2M7QA 3ADLA 4ZYEA 2NA2A 1XMOE 2EL4A 2F8BA 2MDGA 1QU6A 2K7IA 3C4BA 3ADJA 1PJSA 2YTGA 2LV2A 4DV1E 4R2CA 3MHHC 3P1XA 4DUYE 3AV0A 3BF2A 1AAYA 1HR0E 1BB8A 1G2FC 1TF6A 2KOUA 2UUCE 2EE8A 2WBSA 1A1JA 4L5NC 5T6JA 1XNQE 2JVAA 2RS7A 2L2MA 1YPNA 1IQSA 2L6MA 2EPAA 2RQLA 2YWQA 1T4LB 1QNTA 2E5LE 1F2IG 1WHQA 2EN7A 2MC5A 1I94E 3OTOE 2JR1A 4IS1C 5A6BD 4X66E 2V88A 2EM3A 1EH8A 4LU9A 1GQEA 2LCEA 2EORA 2D9HA 1SFEA 2UU9E 3VYYA 4R2PA 2GLIA 2DMYA 2L8TA 1HNWE 4R2DA 2EN6A 1N32E 2EPCA 1A1GA 1O0WA 2EOZA 5F3WA 5IV8B 4JI0E 3T1HE 1DGCA 2UUBE 4B3RE 1LLMC 2RSIA 3BIDA 1WXRA 2VE7C 3J7Yp 2HJJA 2EM8A 2H36X 2V87A 3EPKA 1YYKA 2YU8A 2YT4A 4J8ZA 1BBOA 1X6HA 1IBME 2DSYA 2CPNA 4ZYHA 3HPSA 4N4RB 2EM4A 2ENCA 4IJDA 1RC7A 3EPLA 1MEYC 4WFTA 1ZAAC 4LF7E 5FLXC 3BGHA 5LL6R 1X48A 3VYXA 4NHRA 2N8XA 1XMQE 2EMGA 1YUIA 3KZZA 2RTXA 1J26A 4DV2E 3F6HA 1GZ6A 4NXNE 5DNYA 2YTEA 5A6BA 1X47A 4LF9E 1FJGE 4X65E 2ZM6E 4LF4E 2DLKA 4JV5E 1A1LA 4JI3E 2YZTA 4WSGA 2DMIA 4M9VC 1IQOA 2JP9A 3IWCA 2EMZA 4WSPA 4GKJE 2JY9A 5BR8E 2DB2A 4KZSA 2CT1A 4JI2E 2EMWA 4LFCE 2LJHA 2HC5A 3LLHA 1TF3A 3TQMA 2DIXA 4O24A 5LMNE 4DV0E 4YHHE 2EPMX 5AASA 4JI6E 1YSAC 2NUEA 1UN6B 1NCSA 2ELZA 2LUQA 4LF8E 2MDRA 2FV4B 1YYOA 2RPCA 2F4VE 2ENAA 4DR7E 4DKKA 2EN1A 2JXPA 4Q35B 2VF1A 2EN2A 2KONA 3MHSC 2M9AA 4RH8A 1N33E 2NABA 3C6KA 2HGHA 3HPZA 4WPYA 4HEIA 5CFFE 1N34E
chains in the Genus database with same CATH topology
2LCEA 2EORA 2CSHA 2EMKA 2EOIA 1JK1A 2D9HA 2EMFA 4F6NA 2EPUA 2EOEA 2EMCA 4R2PA 2YTJA 2GLIA 2EPPA 1G2DC 2YTIA 2EPZA 4R2DA 1B69A 2EN6A 2EOFA 2YTDA 2GHFA 2EPCA 2EOHA 1A1GA 2ELYA 2EOZA 2DRPA 2ADRA 4R2QA 2I13A 1A1HA 1DGCA 3M99B 2EM2A 2YSOA 2DLQA 2RSIA 1LLMC 1Z1BA 2EN8A 2LT7A 3VHTB 2EM8A 2EMBA 2EMHA 3EPKA 2EMXA 2YU8A 4GZNC 1X6FA 2DGCA 2YRKA 1BBOA 1X6HA 2WBTA 1JK2A 1A1IA 2EOYA 2JPAA 5KL3A 1WJPA 2EL5A 2EM4A 2EMYA 2ENCA 2EOMA 2YSPA 4IJDA 4X9JA 2EN3A 3EPLA 2BB8A 1MEYC 2YTFA 2EPRA 1ZAAC 2WCC3 1RMDA 1ZR9A 1YUJA 2EMGA 4F6MA 2EL6A 2EM7A 1A1KA 1YUIA 2YU5A 2E72A 2EM9A 2YRHA 4R2EA 2LO3A 4R2RA 2EPXA 1ZU1A 4F2JC 4FK5C 2YTEA 2A25A 2J7JA 2EOQA 2PRTA 5KL4A 5KL7A 2DLKA 4R2AA 2YTNA 1A1LA 2EQ0A 2YTPA 4WSGA 2VRDA 2DMIA 1X3CA 4M9VC 2JP9A 2EMZA 1X6EA 2EL4A 2MDGA 2MKDA 5KL5A 2EMIA 2EM0A 2YTOA 2EM6A 2YTGA 2LV2A 2CT1A 5KL6A 2EMWA 4R2CA 2YTQA 3MHHC 1UBDC 2EOOA 1AAYA 1BB8A 1TF3A 1G2FC 1TF6A 2EE8A 2LVHA 2WBSA 2EM5A 5KL2A 1A1JA 2EMAA 2EN4A 1YSAC 1UN6B 4R2SA 1NCSA 1X5WA 2ELZA 2EOSA 1A1FA 2CTDA 2EPAA 3EPJA 2EQ3A 2EOXA 1P47A 1KJKA 2ENHA 2RPCA 2ENAA 2WBUA 2EQ1A 2EJ4A 2EN1A 1F2IG 2EN7A 2EN2A 3MHSC 2EP3A 2M9AA 4IS1C 1TN9A 2R1FA 2MKNA 2NABA 2EMLA 2HGHA 3EPHA 2YRMA 2EM3A 3UK3C 2EOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCE A;  2EOR A;  2CSH A;  2EMK A;  2EOI A;  1JK1 A;  2D9H A;  2EMF A;  4F6N A;  2EPU A;  2EOE A;  2EMC A;  4R2P A;  2YTJ A;  2GLI A;  2EPP A;  1G2D C;  2YTI A;  2EPZ A;  4R2D A;  1B69 A;  2EN6 A;  2EOF A;  2YTD A;  2GHF A;  2EPC A;  2EOH A;  1A1G A;  2ELY A;  2EOZ A;  2DRP A;  2ADR A;  4R2Q A;  2I13 A;  1A1H A;  1DGC A;  3M99 B;  2EM2 A;  2YSO A;  2DLQ A;  2RSI A;  1LLM C;  1Z1B A;  2EN8 A;  2LT7 A;  3VHT B;  2EM8 A;  2EMB A;  2EMH A;  3EPK A;  2EMX A;  2YU8 A;  4GZN C;  1X6F A;  2DGC A;  2YRK A;  1BBO A;  1X6H A;  2WBT A;  1JK2 A;  1A1I A;  2EOY A;  2JPA A;  5KL3 A;  1WJP A;  2EL5 A;  2EM4 A;  2EMY A;  2ENC A;  2EOM A;  2YSP A;  4IJD A;  4X9J A;  2EN3 A;  3EPL A;  2BB8 A;  1MEY C;  2YTF A;  2EPR A;  1ZAA C;  2WCC 3;  1RMD A;  1ZR9 A;  1YUJ A;  2EMG A;  4F6M A;  2EL6 A;  2EM7 A;  1A1K A;  1YUI A;  2YU5 A;  2E72 A;  2EM9 A;  2YRH A;  4R2E A;  2LO3 A;  4R2R A;  2EPX A;  1ZU1 A;  4F2J C;  4FK5 C;  2YTE A;  2A25 A;  2J7J A;  2EOQ A;  2PRT A;  5KL4 A;  5KL7 A;  2DLK A;  4R2A A;  2YTN A;  1A1L A;  2EQ0 A;  2YTP A;  4WSG A;  2VRD A;  2DMI A;  1X3C A;  4M9V C;  2JP9 A;  2EMZ A;  1X6E A;  2EL4 A;  2MDG A;  2MKD A;  5KL5 A;  2EMI A;  2EM0 A;  2YTO A;  2EM6 A;  2YTG A;  2LV2 A;  2CT1 A;  5KL6 A;  2EMW A;  4R2C A;  2YTQ A;  3MHH C;  1UBD C;  2EOO A;  1AAY A;  1BB8 A;  1TF3 A;  1G2F C;  1TF6 A;  2EE8 A;  2LVH A;  2WBS A;  2EM5 A;  5KL2 A;  1A1J A;  2EMA A;  2EN4 A;  1YSA C;  1UN6 B;  4R2S A;  1NCS A;  1X5W A;  2ELZ A;  2EOS A;  1A1F A;  2CTD A;  2EPA A;  3EPJ A;  2EQ3 A;  2EOX A;  1P47 A;  1KJK A;  2ENH A;  2RPC A;  2ENA A;  2WBU A;  2EQ1 A;  2EJ4 A;  2EN1 A;  1F2I G;  2EN7 A;  2EN2 A;  3MHS C;  2EP3 A;  2M9A A;  4IS1 C;  1TN9 A;  2R1F A;  2MKN A;  2NAB A;  2EML A;  2HGH A;  3EPH A;  2YRM A;  2EM3 A;  3UK3 C;  2EOJ A; 
#chains in the Genus database with same CATH topology
 4F6N A;  2EPU A;  2EOE A;  2EMC A;  1B69 A;  5IT9 C;  4KWY A;  2G7H A;  2EOH A;  2L3C A;  3RMP A;  2ADR A;  3FIG A;  4BCA A;  1A1H A;  2YSO A;  2UXB E;  5A6J A;  3J81 C;  4DV5 E;  1Z1B A;  4F9C B;  4DV6 E;  4M30 A;  3F6G A;  4TUG A;  2LT7 A;  4BMJ A;  2B9D A;  1STU A;  2B3T B;  3VHT B;  4BS9 A;  4DMI A;  5LMU E;  4GZN C;  1IBK E;  4DR4 E;  2N3G A;  2YRK A;  3L00 A;  4DV3 E;  2WBT A;  4JI7 E;  2EOY A;  2YPN A;  2K4V A;  1P47 A;  2EMY A;  2L2N A;  2EN3 A;  4HTG A;  2BB8 A;  3ZOQ B;  2EPN A;  4GEQ B;  5AE3 A;  1EH6 A;  5ADZ A;  2WCC 3;  4DR3 E;  1PJQ A;  4F6M A;  2EM7 A;  4JI8 E;  1SR9 A;  2YRH A;  1N3G A;  4R2E A;  2JOB A;  4F2J C;  1ZU1 A;  2A25 A;  3K6Q A;  1IMU A;  2PRT A;  5KL7 A;  1T4O A;  2IHR 1;  3THO B;  2L92 A;  1IBL E;  4R2A A;  2LTS A;  2YTN A;  3JU0 A;  4TUI A;  2LJU A;  2L2K B;  4DV7 E;  2VRD A;  1X3C A;  4RHB B;  4ZYG A;  4ZYD A;  2UXC E;  2MKD A;  5TSE A;  4X62 E;  2EMI A;  3C4T A;  2EM0 A;  2VQF E;  2EM6 A;  5KL6 A;  1UBD C;  2YTQ A;  2NUF A;  2EOO A;  2LE2 A;  1YZ9 A;  2UXD E;  1FKA E;  2LVH A;  5KL2 A;  2EMA A;  2EN4 A;  1T4N A;  2BBG A;  4DR1 E;  1PKP A;  4LFA E;  2ODR D;  1X5W A;  2CTD A;  2I9I A;  2EQ3 A;  2EOX A;  4AQY E;  1KJK A;  2ENH A;  4B3M E;  2WBU A;  3IWB A;  2EQ1 A;  4F54 A;  4L8N A;  2M4I A;  2L3J A;  3J7A G;  2EP3 A;  4P78 A;  3KWR A;  3HXL A;  2HHH E;  1TN9 A;  4P7D A;  2RS6 A;  1WRJ A;  2EPO A;  2YRM A;  1T39 A;  3UK3 C;  2B7V A;  2EOI A;  2EPP A;  1G2D C;  2YTI A;  2EPZ A;  3BBG A;  2V85 A;  4BC9 A;  4X8W A;  3VK6 A;  5AE1 A;  2WZO A;  4GKK E;  4BHC A;  1ZBQ A;  1EH7 A;  4R2Q A;  2I13 A;  2LBS B;  2EZ6 A;  1GTK A;  2FGG A;  3M99 B;  4R03 A;  2DLQ A;  4O43 A;  1YYW A;  4NZV A;  4YY3 E;  3ADI A;  1X6F A;  1PDA A;  1N36 E;  4F9B B;  1XNR E;  5KL3 A;  2V83 A;  5A69 A;  3IWD A;  2V89 A;  2LRS A;  4DR2 E;  1PJT A;  2E1M A;  4WYQ B;  3EQ1 A;  4JI4 E;  1ZR9 A;  1A1K A;  2YU5 A;  1DQ3 A;  4WXD A;  2UUA E;  2LO3 A;  4R2R A;  2EPX A;  4O4K A;  2NUG A;  2J7J A;  4M0V A;  2R76 A;  1UIL A;  2N3H A;  2V8Q B;  3MSW A;  1J5E E;  3C6M A;  4MLV A;  1WHN A;  2EQ0 A;  2FTX B;  3H09 A;  4MLQ A;  1HNZ E;  1NEI A;  1X6E A;  5KL5 A;  4DUZ E;  2YTO A;  1X49 A;  4LFB E;  4X64 E;  2ODR C;  1RQ0 A;  2EPK X;  5AC4 A;  2B7T A;  5IXM B;  2EM5 A;  4JI5 E;  3AUZ A;  2JWO A;  4NXM E;  2LUP B;  1L4S A;  4R2S A;  2EOS A;  1A1F A;  4B3T E;  4Q28 A;  3EPJ A;  2V86 A;  5IWA E;  2EJ4 A;  4OX9 E;  3ECR A;  2EOJ A;  2R1F A;  2MKN A;  3LML A;  2EML A;  3EPH A;  4B3S E;  2L33 A;  5A2Q C;  1YFH A;  3KZY A;  4M2Z A;  4BBY A;  3QG5 C;  2GPI A;  2CSH A;  2EMK A;  1JK1 A;  2EMF A;  3THN A;  1BBG A;  2YTJ A;  4I8O A;  4OOG C;  1EKZ A;  2YTD A;  2EOF A;  4DR6 E;  1KYQ A;  2GHF A;  1T38 A;  3HQ1 A;  2ELY A;  1DI2 A;  3J80 C;  1ZBT A;  1MGT A;  4R8O A;  2M1S A;  2DRP A;  1UHZ A;  4BHB A;  4K0K E;  2LMZ A;  3DF6 A;  4JI1 E;  2EM2 A;  4BC7 A;  4KHP E;  2EN8 A;  2LTR A;  2JYA A;  2RSM A;  2MC6 A;  2Q8U A;  2EMB A;  5AC5 A;  4O5G A;  2EMH A;  2EPL X;  2EMX A;  3ADG A;  2DGC A;  4LF5 E;  3DJW A;  1JK2 A;  1A1I A;  4LTY A;  5A6A A;  2JPA A;  2EWL A;  1WJP A;  2EL5 A;  2YSP A;  4X9J A;  2EOM A;  2VQE E;  2YTF A;  2EPR A;  3T1Y E;  4WX9 A;  4WXC A;  5LLQ A;  3HTX A;  3JTZ A;  4DR5 E;  5AE2 A;  1RMD A;  1YUJ A;  2EL6 A;  4LF6 E;  2E72 A;  2EM9 A;  1HNX E;  4DV4 E;  4JYA E;  3OML A;  4FK5 C;  2EOQ A;  5KL4 A;  3JAM C;  4F9A B;  1AH5 A;  5A6K A;  2JOX A;  2KHX A;  2YTP A;  2M7Q A;  3ADL A;  4ZYE A;  2NA2 A;  1XMO E;  2EL4 A;  2F8B A;  2MDG A;  1QU6 A;  2K7I A;  3C4B A;  3ADJ A;  1PJS A;  2YTG A;  2LV2 A;  4DV1 E;  4R2C A;  3MHH C;  3P1X A;  4DUY E;  3AV0 A;  3BF2 A;  1AAY A;  1HR0 E;  1BB8 A;  1G2F C;  1TF6 A;  2KOU A;  2UUC E;  2EE8 A;  2WBS A;  1A1J A;  4L5N C;  5T6J A;  1XNQ E;  2JVA A;  2RS7 A;  2L2M A;  1YPN A;  1IQS A;  2L6M A;  2EPA A;  2RQL A;  2YWQ A;  1T4L B;  1QNT A;  2E5L E;  1F2I G;  1WHQ A;  2EN7 A;  2MC5 A;  1I94 E;  3OTO E;  2JR1 A;  4IS1 C;  5A6B D;  4X66 E;  2V88 A;  2EM3 A;  1EH8 A;  4LU9 A;  1GQE A;  2LCE A;  2EOR A;  2D9H A;  1SFE A;  2UU9 E;  3VYY A;  4R2P A;  2GLI A;  2DMY A;  2L8T A;  1HNW E;  4R2D A;  2EN6 A;  1N32 E;  2EPC A;  1A1G A;  1O0W A;  2EOZ A;  5F3W A;  5IV8 B;  4JI0 E;  3T1H E;  1DGC A;  2UUB E;  4B3R E;  1LLM C;  2RSI A;  3BID A;  1WXR A;  2VE7 C;  3J7Y p;  2HJJ A;  2EM8 A;  2H36 X;  2V87 A;  3EPK A;  1YYK A;  2YU8 A;  2YT4 A;  4J8Z A;  1BBO A;  1X6H A;  1IBM E;  2DSY A;  2CPN A;  4ZYH A;  3HPS A;  4N4R B;  2EM4 A;  2ENC A;  4IJD A;  1RC7 A;  3EPL A;  1MEY C;  4WFT A;  1ZAA C;  4LF7 E;  5FLX C;  3BGH A;  5LL6 R;  1X48 A;  3VYX A;  4NHR A;  2N8X A;  1XMQ E;  2EMG A;  1YUI A;  3KZZ A;  2RTX A;  1J26 A;  4DV2 E;  3F6H A;  1GZ6 A;  4NXN E;  5DNY A;  2YTE A;  5A6B A;  1X47 A;  4LF9 E;  1FJG E;  4X65 E;  2ZM6 E;  4LF4 E;  2DLK A;  4JV5 E;  1A1L A;  4JI3 E;  2YZT A;  4WSG A;  2DMI A;  4M9V C;  1IQO A;  2JP9 A;  3IWC A;  2EMZ A;  4WSP A;  4GKJ E;  2JY9 A;  5BR8 E;  2DB2 A;  4KZS A;  2CT1 A;  4JI2 E;  2EMW A;  4LFC E;  2LJH A;  2HC5 A;  3LLH A;  1TF3 A;  3TQM A;  2DIX A;  4O24 A;  5LMN E;  4DV0 E;  4YHH E;  2EPM X;  5AAS A;  4JI6 E;  1YSA C;  2NUE A;  1UN6 B;  1NCS A;  2ELZ A;  2LUQ A;  4LF8 E;  2MDR A;  2FV4 B;  1YYO A;  2RPC A;  2F4V E;  2ENA A;  4DR7 E;  4DKK A;  2EN1 A;  2JXP A;  4Q35 B;  2VF1 A;  2EN2 A;  2KON A;  3MHS C;  2M9A A;  4RH8 A;  1N33 E;  2NAB A;  3C6K A;  2HGH A;  3HPZ A;  4WPY A;  4HEI A;  5CFF E;  1N34 E; 
#chains in the Genus database with same CATH homology
 2LCE A;  2EOR A;  2CSH A;  2EMK A;  2EOI A;  1JK1 A;  2D9H A;  2EMF A;  4F6N A;  2EPU A;  2EOE A;  2EMC A;  4R2P A;  2YTJ A;  2GLI A;  2EPP A;  1G2D C;  2YTI A;  2EPZ A;  4R2D A;  1B69 A;  2EN6 A;  2EOF A;  2YTD A;  2GHF A;  2EPC A;  2EOH A;  1A1G A;  2ELY A;  2EOZ A;  2DRP A;  2ADR A;  4R2Q A;  2I13 A;  1A1H A;  1DGC A;  3M99 B;  2EM2 A;  2YSO A;  2DLQ A;  2RSI A;  1LLM C;  1Z1B A;  2EN8 A;  2LT7 A;  3VHT B;  2EM8 A;  2EMB A;  2EMH A;  3EPK A;  2EMX A;  2YU8 A;  4GZN C;  1X6F A;  2DGC A;  2YRK A;  1BBO A;  1X6H A;  2WBT A;  1JK2 A;  1A1I A;  2EOY A;  2JPA A;  5KL3 A;  1WJP A;  2EL5 A;  2EM4 A;  2EMY A;  2ENC A;  2EOM A;  2YSP A;  4IJD A;  4X9J A;  2EN3 A;  3EPL A;  2BB8 A;  1MEY C;  2YTF A;  2EPR A;  1ZAA C;  2WCC 3;  1RMD A;  1ZR9 A;  1YUJ A;  2EMG A;  4F6M A;  2EL6 A;  2EM7 A;  1A1K A;  1YUI A;  2YU5 A;  2E72 A;  2EM9 A;  2YRH A;  4R2E A;  2LO3 A;  4R2R A;  2EPX A;  1ZU1 A;  4F2J C;  4FK5 C;  2YTE A;  2A25 A;  2J7J A;  2EOQ A;  2PRT A;  5KL4 A;  5KL7 A;  2DLK A;  4R2A A;  2YTN A;  1A1L A;  2EQ0 A;  2YTP A;  4WSG A;  2VRD A;  2DMI A;  1X3C A;  4M9V C;  2JP9 A;  2EMZ A;  1X6E A;  2EL4 A;  2MDG A;  2MKD A;  5KL5 A;  2EMI A;  2EM0 A;  2YTO A;  2EM6 A;  2YTG A;  2LV2 A;  2CT1 A;  5KL6 A;  2EMW A;  4R2C A;  2YTQ A;  3MHH C;  1UBD C;  2EOO A;  1AAY A;  1BB8 A;  1TF3 A;  1G2F C;  1TF6 A;  2EE8 A;  2LVH A;  2WBS A;  2EM5 A;  5KL2 A;  1A1J A;  2EMA A;  2EN4 A;  1YSA C;  1UN6 B;  4R2S A;  1NCS A;  1X5W A;  2ELZ A;  2EOS A;  1A1F A;  2CTD A;  2EPA A;  3EPJ A;  2EQ3 A;  2EOX A;  1P47 A;  1KJK A;  2ENH A;  2RPC A;  2ENA A;  2WBU A;  2EQ1 A;  2EJ4 A;  2EN1 A;  1F2I G;  2EN7 A;  2EN2 A;  3MHS C;  2EP3 A;  2M9A A;  4IS1 C;  1TN9 A;  2R1F A;  2MKN A;  2NAB A;  2EML A;  2HGH A;  3EPH A;  2YRM A;  2EM3 A;  3UK3 C;  2EOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...