2EPRA

Solution structure of the secound zinc finger domain of zinc finger protein 278
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
48
Chain Sequence
GSSGSSGRTRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the secound zinc finger domain of Zinc finger protein 278
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords POZ-, AT hook-, and zinc finger-containing protein 1
total genus 7
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eprA01
1TF6A 4F6MA 2YTQA 1RMDA 1TN9A 2EOYA 3EPHA 2LO3A 2EM0A 2YU8A 2EL5A 2EN4A 2EMYA 2EORA 2LT7A 2DMIA 4R2DA 1DGCA 2RSIA 5KL7A 2EPXA 3VHTB 2EOMA 2D9HA 2EMAA 2EMIA 4R2SA 1JK2A 2YTIA 1ZR9A 2PRTA 2ENCA 2EM5A 2DGCA 2EE8A 3MHSC 4FK5C 4R2PA 1P47A 2EPZA 2YTGA 2EM4A 4GZNC 2NABA 1JK1A 1BB8A 2MDGA 4F2JC 2EOSA 2ELYA 1G2FC 1B69A 4M9VC 4IS1C 1ZAAC 2RPCA 2WBTA 2J7JA 1YUJA 2EMHA 2EM9A 2DLQA 2LV2A 2ELZA 2YSPA 4WSGA 1UBDC 2EPPA 4R2CA 2ENAA 2EOFA 3EPLA 1AAYA 2EOHA 1A1GA 1A1KA 2WCC3 1YUIA 4X9JA 2GLIA 2EM6A 2EN7A 1X6EA 2EPAA 2EPRA 1A1FA 2M9AA 2EN6A 2EQ1A 2EM2A 1MEYC 2YTOA 2JPAA 2DLKA 3UK3C 4R2QA 1X6FA 1X3CA 5KL5A 2EOJA 1A1IA 2VRDA 4R2RA 2YU5A 1X6HA 2LCEA 1A1LA 1F2IG 2JP9A 2CTDA 1Z1BA 2YTNA 2EOZA 5KL6A 2EMWA 2EL6A 2EQ0A 2EPUA 2GHFA 2YTJA 2WBUA 2E72A 1BBOA 1WJPA 5KL3A 2EMFA 2LVHA 2CT1A 2EN3A 2MKNA 4R2AA 2EMCA 2R1FA 1YSAC 2YRHA 1A1HA 2HGHA 2EM3A 2EOEA 2EP3A 2EM8A 1G2DC 2EMGA 2EJ4A 2EN1A 2YTPA 2WBSA 1KJKA 2EN2A 2YTFA 1LLMC 1A1JA 5KL4A 2MKDA 2EMBA 2EMKA 2EOQA 2EMXA 4F6NA 2YSOA 3MHHC 5KL2A 2EQ3A 2EOOA 2EOXA 2EM7A 1ZU1A 2CSHA 2YTEA 3M99B 2EMLA 2EN8A 4R2EA 2EPCA 2YRKA 2ENHA 2DRPA 2YRMA 1NCSA 2BB8A 1TF3A 1X5WA 1UN6B 2I13A 2A25A 3EPJA 2EL4A 2YTDA 4IJDA 3EPKA 2ADRA 2EMZA 2EOIA
chains in the Genus database with same CATH superfamily
3J81C 4GEQB 4Q35B 1TN9A 2EOYA 3EPHA 2LO3A 2EM0A 2YU8A 3HQ1A 2EPOA 1L4SA 2FGGA 2DMIA 3J80C 5AC5A 2EPXA 3KWRA 4BHBA 2D9HA 2EOMA 1PJSA 4OOGC 1GZ6A 4JI7E 1JK2A 2K4VA 4ZYGA 2EM5A 1EH7A 2EE8A 1PJQA 5A6BA 4FK5C 4DUYE 1P47A 2EPZA 1BB8A 2EPLX 3THOB 2EOSA 2WZOA 1G2FC 4F9CB 1WXRA 1B69A 4JI6E 2V83A 5A69A 4DV5E 2L92A 1IQOA 2RPCA 2WBTA 2J7JA 2DLQA 2LV2A 2EPPA 4L5NC 4BBYA 1AAYA 1IQSA 4RHBB 5LMUE 3J7Yp 1N33E 4DR7E 4M30A 2JR1A 2M9AA 2EM2A 2DLKA 1PJTA 5A6JA 1X6FA 5KL5A 2VRDA 3AV0A 1DI2A 2VE7C 2MC6A 2JP9A 2KOUA 5TSEA 1DQ3A 2YTNA 3JTZA 2EL6A 3HXLA 2E1MA 4R03A 2EN3A 3QG5C 2EMCA 2R76A 1X47A 2NA2A 4X65E 2R1FA 3L00A 1UILA 2EOEA 3BIDA 1T38A 2V86A 2EN1A 1QU6A 1YYKA 3ADJA 2MC5A 4DV1E 5KL4A 2MKDA 2EMBA 2YSOA 4LF6E 4F9AB 2EOOA 3J7AG 2CSHA 2V8QB 2YRKA 2NUEA 2K7IA 3DF6A 4ZYHA 4JI2E 5FLXC 1IBME 2UXBE 3EPJA 2FV4B 1HR0E 2YTDA 2RSMA 4F9BB 2JWOA 2HHHE 4LFAE 2EMZA 4JYAE 4P78A 1TF6A 2RS7A 3JAMC 2YTQA 2LE2A 4I8OA 2N3GA 3KZZA 3ADLA 3MSWA 4J8ZA 2EN4A 5LL6R 2G7HA 2RSIA 4JI3E 4L8NA 2LUQA 1GQEA 4O4KA 2EWLA 2L2KB 3VHTB 4R2SA 2EMAA 5LMNE 2F8BA 2ENCA 2UXCE 2B7VA 3MHSC 2YTGA 4GZNC 2IHR1 1JK1A 2MDGA 3C4BA 4GKKE 2ELYA 4BC7A 4LF4E 1IBKE 4DKKA 4DR5E 1ZAAC 3ECRA 2LBSB 2EMHA 2EM9A 2LMZA 2YSPA 4WSGA 2ENAA 2EOFA 2F4VE 1A1KA 1YYWA 2WCC3 2B3TB 3FIGA 4NXNE 2EM6A 2EN7A 3ADGA 4B3ME 4JI8E 2EPAA 2JYAA 3BGHA 1A1FA 4WXCA 3IWBA 1MGTA 2EQ1A 2L6MA 2DB2A 1X3CA 4R2RA 2YU5A 1X6HA 4YHHE 2ODRC 2LCEA 4DV3E 1A1LA 4DR1E 4K0KE 4KWYA 4BMJA 2CTDA 3C6KA 4LFBE 4GKJE 2EMWA 2GHFA 4BC9A 2WBUA 2V85A 4DV0E 1IMUA 5A6AA 1BBOA 5KL3A 4WPYA 4P7DA 2V89A 4WX9A 2UUBE 1FJGE 2MKNA 3T1HE 1YSAC 4MLVA 4O43A 3P1XA 1QNTA 2EM3A 2RS6A 2EP3A 2EM8A 2YT4A 2EMGA 5AASA 4DR2E 4LF9E 2I9IA 1KJKA 2EN2A 2EPMX 2H36X 1LLMC 1HNZE 3VYXA 2JOBA 3KZYA 1WRJA 1UHZA 2EMKA 2YZTA 2EMXA 1X48A 3LLHA 4F6NA 3MHHC 2NUFA 1BBGA 1T4OA 2EQ3A 4RH8A 1J26A 1N34E 2B9DA 4DR6E 2YTEA 3M99B 4TUIA 2EMLA 2EPCA 2ENHA 2YRMA 4DR4E 2HC5A 1EH6A 1EKZA 5A6KA 2KHXA 2I13A 3LMLA 1HNWE 3EPKA 1X49A 1XNRE 2EOIA 1RMDA 1NEIA 2EPKX 1YZ9A 2EPNA 4YY3E 4R2DA 1XNQE 2UUCE 5KL7A 2L8TA 2EMIA 4KZSA 2YTIA 2PRTA 4R8OA 3H09A 2DGCA 2N8XA 3C4TA 3VK6A 2LUPB 4WXDA 5IXMB 4R2PA 1RQ0A 2M1SA 4NHRA 4NZVA 4JI0E 2NABA 1N36E 4F2JC 3IWDA 1IBLE 4M9VC 3F6GA 4IS1C 2L33A 3HPSA 4WYQB 2M7QA 3THNA 5CFFE 2JOXA 4MLQA 1YPNA 3TQMA 1YUJA 1SR9A 1N3GA 5AE2A 3EPLA 2CPNA 1A1GA 4LTYA 1T4LB 2HJJA 2GLIA 4ZYDA 2L3CA 4LF7E 2EN6A 4OX9E 2NUGA 2L2NA 2JPAA 2M4IA 2YTOA 2VQFE 3UK3C 2DSYA 1O0WA 4B3TE 2V88A 2EOJA 2JY9A 4X64E 1A1IA 1YFHA 2MDRA 2JVAA 2GPIA 2N3HA 2YPNA 1Z1BA 4LF8E 3DJWA 5KL6A 2EQ0A 1WJPA 4B3RE 1FKAE 4M0VA 3RMPA 1PKPA 3VYYA 4R2AA 2JXPA 2YRHA 1A1HA 3ADIA 3OTOE 3HPZA 1G2DC 2YTPA 4O5GA 3F6HA 4DMIA 2YTFA 1A1JA 3T1YE 2EOQA 1J5EE 4DV2E 2BBGA 4BCAA 2EOXA 2DMYA 1ZU1A 4B3SE 2KONA 4HTGA 4WFTA 2BB8A 1TF3A 1X5WA 4Q28A 4NXME 1UN6B 1ZBTA 2ZM6E 2A25A 5AE1A 3IWCA 4IJDA 4AQYE 2L2MA 2ADRA 4DV7E 4F6MA 1ZBQA 5IT9C 2DIXA 5LLQA 1XMOE 4BS9A 4LF5E 2EL5A 2EORA 2EMYA 2LT7A 4LFCE 1DGCA 5F3WA 4X66E 1PDAA 1WHNA 1KYQA 2YWQA 4DV6E 1ZR9A 1HNXE 2UXDE 2EZ6A 2FTXB 4BHCA 2VF1A 2EM4A 4F54A 4JI5E 3K6QA 1XMQE 2E5LE 2Q8UA 1UBDC 1I94E 2ELZA 4R2CA 2RQLA 2EOHA 2LRSA 4M2ZA 1AH5A 1YUIA 2LTRA 4X9JA 1X6EA 1RC7A 2EPRA 1MEYC 4TUGA 4HEIA 4R2QA 2ODRD 4DV4E 1F2IG 4ZYEA 3ZOQB 2LJUA 3HTXA 2EOZA 2LTSA 2EPUA 2YTJA 2E72A 3BF2A 1SFEA 1T4NA 3EQ1A 2EMFA 5IV8B 2L3JA 2LVHA 2CT1A 2B7TA 4JI1E 5DNYA 2HGHA 2RTXA 4JV5E 5T6JA 1STUA 1EH8A 2EJ4A 2WBSA 1YYOA 5AE3A 1T39A 2UU9E 1N32E 3C6MA 4N4RB 1GTKA 4KHPE 4DR3E 4JI4E 2LJHA 3AUZA 5KL2A 2VQEE 5AC4A 4O24A 1WHQA 2EM7A 2V87A 2UUAE 2EN8A 4R2EA 5IWAE 5ADZA 4LU9A 5A2QC 3BBGA 2DRPA 1NCSA 5A6BD 4X62E 3OMLA 4X8WA 2EL4A 4WSPA 3JU0A 5BR8E 4DUZE
chains in the Genus database with same CATH topology
1TF6A 4F6MA 2YTQA 1RMDA 1TN9A 2EOYA 3EPHA 2LO3A 2EM0A 2YU8A 2EL5A 2EN4A 2EMYA 2EORA 2LT7A 2DMIA 4R2DA 1DGCA 2RSIA 5KL7A 2EPXA 3VHTB 2EOMA 2D9HA 2EMAA 2EMIA 4R2SA 1JK2A 2YTIA 1ZR9A 2PRTA 2ENCA 2EM5A 2DGCA 2EE8A 3MHSC 4FK5C 4R2PA 1P47A 2EPZA 2YTGA 2EM4A 4GZNC 2NABA 1JK1A 1BB8A 2MDGA 4F2JC 2EOSA 2ELYA 1G2FC 1B69A 4M9VC 4IS1C 1ZAAC 2RPCA 2WBTA 2J7JA 1YUJA 2EMHA 2EM9A 2DLQA 2LV2A 2ELZA 2YSPA 4WSGA 1UBDC 2EPPA 4R2CA 2ENAA 2EOFA 3EPLA 1AAYA 2EOHA 1A1GA 1A1KA 2WCC3 1YUIA 4X9JA 2GLIA 2EM6A 2EN7A 1X6EA 2EPAA 2EPRA 1A1FA 2M9AA 2EN6A 2EQ1A 2EM2A 1MEYC 2YTOA 2JPAA 2DLKA 3UK3C 4R2QA 1X6FA 1X3CA 5KL5A 2EOJA 1A1IA 2VRDA 4R2RA 2YU5A 1X6HA 2LCEA 1A1LA 1F2IG 2JP9A 2CTDA 1Z1BA 2YTNA 2EOZA 5KL6A 2EMWA 2EL6A 2EQ0A 2EPUA 2GHFA 2YTJA 2WBUA 2E72A 1BBOA 1WJPA 5KL3A 2EMFA 2LVHA 2CT1A 2EN3A 2MKNA 4R2AA 2EMCA 2R1FA 1YSAC 2YRHA 1A1HA 2HGHA 2EM3A 2EOEA 2EP3A 2EM8A 1G2DC 2EMGA 2EJ4A 2EN1A 2YTPA 2WBSA 1KJKA 2EN2A 2YTFA 1LLMC 1A1JA 5KL4A 2MKDA 2EMBA 2EMKA 2EOQA 2EMXA 4F6NA 2YSOA 3MHHC 5KL2A 2EQ3A 2EOOA 2EOXA 2EM7A 1ZU1A 2CSHA 2YTEA 3M99B 2EMLA 2EN8A 4R2EA 2EPCA 2YRKA 2ENHA 2DRPA 2YRMA 1NCSA 2BB8A 1TF3A 1X5WA 1UN6B 2I13A 2A25A 3EPJA 2EL4A 2YTDA 4IJDA 3EPKA 2ADRA 2EMZA 2EOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TF6 A;  4F6M A;  2YTQ A;  1RMD A;  1TN9 A;  2EOY A;  3EPH A;  2LO3 A;  2EM0 A;  2YU8 A;  2EL5 A;  2EN4 A;  2EMY A;  2EOR A;  2LT7 A;  2DMI A;  4R2D A;  1DGC A;  2RSI A;  5KL7 A;  2EPX A;  3VHT B;  2EOM A;  2D9H A;  2EMA A;  2EMI A;  4R2S A;  1JK2 A;  2YTI A;  1ZR9 A;  2PRT A;  2ENC A;  2EM5 A;  2DGC A;  2EE8 A;  3MHS C;  4FK5 C;  4R2P A;  1P47 A;  2EPZ A;  2YTG A;  2EM4 A;  4GZN C;  2NAB A;  1JK1 A;  1BB8 A;  2MDG A;  4F2J C;  2EOS A;  2ELY A;  1G2F C;  1B69 A;  4M9V C;  4IS1 C;  1ZAA C;  2RPC A;  2WBT A;  2J7J A;  1YUJ A;  2EMH A;  2EM9 A;  2DLQ A;  2LV2 A;  2ELZ A;  2YSP A;  4WSG A;  1UBD C;  2EPP A;  4R2C A;  2ENA A;  2EOF A;  3EPL A;  1AAY A;  2EOH A;  1A1G A;  1A1K A;  2WCC 3;  1YUI A;  4X9J A;  2GLI A;  2EM6 A;  2EN7 A;  1X6E A;  2EPA A;  2EPR A;  1A1F A;  2M9A A;  2EN6 A;  2EQ1 A;  2EM2 A;  1MEY C;  2YTO A;  2JPA A;  2DLK A;  3UK3 C;  4R2Q A;  1X6F A;  1X3C A;  5KL5 A;  2EOJ A;  1A1I A;  2VRD A;  4R2R A;  2YU5 A;  1X6H A;  2LCE A;  1A1L A;  1F2I G;  2JP9 A;  2CTD A;  1Z1B A;  2YTN A;  2EOZ A;  5KL6 A;  2EMW A;  2EL6 A;  2EQ0 A;  2EPU A;  2GHF A;  2YTJ A;  2WBU A;  2E72 A;  1BBO A;  1WJP A;  5KL3 A;  2EMF A;  2LVH A;  2CT1 A;  2EN3 A;  2MKN A;  4R2A A;  2EMC A;  2R1F A;  1YSA C;  2YRH A;  1A1H A;  2HGH A;  2EM3 A;  2EOE A;  2EP3 A;  2EM8 A;  1G2D C;  2EMG A;  2EJ4 A;  2EN1 A;  2YTP A;  2WBS A;  1KJK A;  2EN2 A;  2YTF A;  1LLM C;  1A1J A;  5KL4 A;  2MKD A;  2EMB A;  2EMK A;  2EOQ A;  2EMX A;  4F6N A;  2YSO A;  3MHH C;  5KL2 A;  2EQ3 A;  2EOO A;  2EOX A;  2EM7 A;  1ZU1 A;  2CSH A;  2YTE A;  3M99 B;  2EML A;  2EN8 A;  4R2E A;  2EPC A;  2YRK A;  2ENH A;  2DRP A;  2YRM A;  1NCS A;  2BB8 A;  1TF3 A;  1X5W A;  1UN6 B;  2I13 A;  2A25 A;  3EPJ A;  2EL4 A;  2YTD A;  4IJD A;  3EPK A;  2ADR A;  2EMZ A;  2EOI A; 
#chains in the Genus database with same CATH topology
 3J81 C;  4GEQ B;  4Q35 B;  1TN9 A;  2EOY A;  3EPH A;  2LO3 A;  2EM0 A;  2YU8 A;  3HQ1 A;  2EPO A;  1L4S A;  2FGG A;  2DMI A;  3J80 C;  5AC5 A;  2EPX A;  3KWR A;  4BHB A;  2D9H A;  2EOM A;  1PJS A;  4OOG C;  1GZ6 A;  4JI7 E;  1JK2 A;  2K4V A;  4ZYG A;  2EM5 A;  1EH7 A;  2EE8 A;  1PJQ A;  5A6B A;  4FK5 C;  4DUY E;  1P47 A;  2EPZ A;  1BB8 A;  2EPL X;  3THO B;  2EOS A;  2WZO A;  1G2F C;  4F9C B;  1WXR A;  1B69 A;  4JI6 E;  2V83 A;  5A69 A;  4DV5 E;  2L92 A;  1IQO A;  2RPC A;  2WBT A;  2J7J A;  2DLQ A;  2LV2 A;  2EPP A;  4L5N C;  4BBY A;  1AAY A;  1IQS A;  4RHB B;  5LMU E;  3J7Y p;  1N33 E;  4DR7 E;  4M30 A;  2JR1 A;  2M9A A;  2EM2 A;  2DLK A;  1PJT A;  5A6J A;  1X6F A;  5KL5 A;  2VRD A;  3AV0 A;  1DI2 A;  2VE7 C;  2MC6 A;  2JP9 A;  2KOU A;  5TSE A;  1DQ3 A;  2YTN A;  3JTZ A;  2EL6 A;  3HXL A;  2E1M A;  4R03 A;  2EN3 A;  3QG5 C;  2EMC A;  2R76 A;  1X47 A;  2NA2 A;  4X65 E;  2R1F A;  3L00 A;  1UIL A;  2EOE A;  3BID A;  1T38 A;  2V86 A;  2EN1 A;  1QU6 A;  1YYK A;  3ADJ A;  2MC5 A;  4DV1 E;  5KL4 A;  2MKD A;  2EMB A;  2YSO A;  4LF6 E;  4F9A B;  2EOO A;  3J7A G;  2CSH A;  2V8Q B;  2YRK A;  2NUE A;  2K7I A;  3DF6 A;  4ZYH A;  4JI2 E;  5FLX C;  1IBM E;  2UXB E;  3EPJ A;  2FV4 B;  1HR0 E;  2YTD A;  2RSM A;  4F9B B;  2JWO A;  2HHH E;  4LFA E;  2EMZ A;  4JYA E;  4P78 A;  1TF6 A;  2RS7 A;  3JAM C;  2YTQ A;  2LE2 A;  4I8O A;  2N3G A;  3KZZ A;  3ADL A;  3MSW A;  4J8Z A;  2EN4 A;  5LL6 R;  2G7H A;  2RSI A;  4JI3 E;  4L8N A;  2LUQ A;  1GQE A;  4O4K A;  2EWL A;  2L2K B;  3VHT B;  4R2S A;  2EMA A;  5LMN E;  2F8B A;  2ENC A;  2UXC E;  2B7V A;  3MHS C;  2YTG A;  4GZN C;  2IHR 1;  1JK1 A;  2MDG A;  3C4B A;  4GKK E;  2ELY A;  4BC7 A;  4LF4 E;  1IBK E;  4DKK A;  4DR5 E;  1ZAA C;  3ECR A;  2LBS B;  2EMH A;  2EM9 A;  2LMZ A;  2YSP A;  4WSG A;  2ENA A;  2EOF A;  2F4V E;  1A1K A;  1YYW A;  2WCC 3;  2B3T B;  3FIG A;  4NXN E;  2EM6 A;  2EN7 A;  3ADG A;  4B3M E;  4JI8 E;  2EPA A;  2JYA A;  3BGH A;  1A1F A;  4WXC A;  3IWB A;  1MGT A;  2EQ1 A;  2L6M A;  2DB2 A;  1X3C A;  4R2R A;  2YU5 A;  1X6H A;  4YHH E;  2ODR C;  2LCE A;  4DV3 E;  1A1L A;  4DR1 E;  4K0K E;  4KWY A;  4BMJ A;  2CTD A;  3C6K A;  4LFB E;  4GKJ E;  2EMW A;  2GHF A;  4BC9 A;  2WBU A;  2V85 A;  4DV0 E;  1IMU A;  5A6A A;  1BBO A;  5KL3 A;  4WPY A;  4P7D A;  2V89 A;  4WX9 A;  2UUB E;  1FJG E;  2MKN A;  3T1H E;  1YSA C;  4MLV A;  4O43 A;  3P1X A;  1QNT A;  2EM3 A;  2RS6 A;  2EP3 A;  2EM8 A;  2YT4 A;  2EMG A;  5AAS A;  4DR2 E;  4LF9 E;  2I9I A;  1KJK A;  2EN2 A;  2EPM X;  2H36 X;  1LLM C;  1HNZ E;  3VYX A;  2JOB A;  3KZY A;  1WRJ A;  1UHZ A;  2EMK A;  2YZT A;  2EMX A;  1X48 A;  3LLH A;  4F6N A;  3MHH C;  2NUF A;  1BBG A;  1T4O A;  2EQ3 A;  4RH8 A;  1J26 A;  1N34 E;  2B9D A;  4DR6 E;  2YTE A;  3M99 B;  4TUI A;  2EML A;  2EPC A;  2ENH A;  2YRM A;  4DR4 E;  2HC5 A;  1EH6 A;  1EKZ A;  5A6K A;  2KHX A;  2I13 A;  3LML A;  1HNW E;  3EPK A;  1X49 A;  1XNR E;  2EOI A;  1RMD A;  1NEI A;  2EPK X;  1YZ9 A;  2EPN A;  4YY3 E;  4R2D A;  1XNQ E;  2UUC E;  5KL7 A;  2L8T A;  2EMI A;  4KZS A;  2YTI A;  2PRT A;  4R8O A;  3H09 A;  2DGC A;  2N8X A;  3C4T A;  3VK6 A;  2LUP B;  4WXD A;  5IXM B;  4R2P A;  1RQ0 A;  2M1S A;  4NHR A;  4NZV A;  4JI0 E;  2NAB A;  1N36 E;  4F2J C;  3IWD A;  1IBL E;  4M9V C;  3F6G A;  4IS1 C;  2L33 A;  3HPS A;  4WYQ B;  2M7Q A;  3THN A;  5CFF E;  2JOX A;  4MLQ A;  1YPN A;  3TQM A;  1YUJ A;  1SR9 A;  1N3G A;  5AE2 A;  3EPL A;  2CPN A;  1A1G A;  4LTY A;  1T4L B;  2HJJ A;  2GLI A;  4ZYD A;  2L3C A;  4LF7 E;  2EN6 A;  4OX9 E;  2NUG A;  2L2N A;  2JPA A;  2M4I A;  2YTO A;  2VQF E;  3UK3 C;  2DSY A;  1O0W A;  4B3T E;  2V88 A;  2EOJ A;  2JY9 A;  4X64 E;  1A1I A;  1YFH A;  2MDR A;  2JVA A;  2GPI A;  2N3H A;  2YPN A;  1Z1B A;  4LF8 E;  3DJW A;  5KL6 A;  2EQ0 A;  1WJP A;  4B3R E;  1FKA E;  4M0V A;  3RMP A;  1PKP A;  3VYY A;  4R2A A;  2JXP A;  2YRH A;  1A1H A;  3ADI A;  3OTO E;  3HPZ A;  1G2D C;  2YTP A;  4O5G A;  3F6H A;  4DMI A;  2YTF A;  1A1J A;  3T1Y E;  2EOQ A;  1J5E E;  4DV2 E;  2BBG A;  4BCA A;  2EOX A;  2DMY A;  1ZU1 A;  4B3S E;  2KON A;  4HTG A;  4WFT A;  2BB8 A;  1TF3 A;  1X5W A;  4Q28 A;  4NXM E;  1UN6 B;  1ZBT A;  2ZM6 E;  2A25 A;  5AE1 A;  3IWC A;  4IJD A;  4AQY E;  2L2M A;  2ADR A;  4DV7 E;  4F6M A;  1ZBQ A;  5IT9 C;  2DIX A;  5LLQ A;  1XMO E;  4BS9 A;  4LF5 E;  2EL5 A;  2EOR A;  2EMY A;  2LT7 A;  4LFC E;  1DGC A;  5F3W A;  4X66 E;  1PDA A;  1WHN A;  1KYQ A;  2YWQ A;  4DV6 E;  1ZR9 A;  1HNX E;  2UXD E;  2EZ6 A;  2FTX B;  4BHC A;  2VF1 A;  2EM4 A;  4F54 A;  4JI5 E;  3K6Q A;  1XMQ E;  2E5L E;  2Q8U A;  1UBD C;  1I94 E;  2ELZ A;  4R2C A;  2RQL A;  2EOH A;  2LRS A;  4M2Z A;  1AH5 A;  1YUI A;  2LTR A;  4X9J A;  1X6E A;  1RC7 A;  2EPR A;  1MEY C;  4TUG A;  4HEI A;  4R2Q A;  2ODR D;  4DV4 E;  1F2I G;  4ZYE A;  3ZOQ B;  2LJU A;  3HTX A;  2EOZ A;  2LTS A;  2EPU A;  2YTJ A;  2E72 A;  3BF2 A;  1SFE A;  1T4N A;  3EQ1 A;  2EMF A;  5IV8 B;  2L3J A;  2LVH A;  2CT1 A;  2B7T A;  4JI1 E;  5DNY A;  2HGH A;  2RTX A;  4JV5 E;  5T6J A;  1STU A;  1EH8 A;  2EJ4 A;  2WBS A;  1YYO A;  5AE3 A;  1T39 A;  2UU9 E;  1N32 E;  3C6M A;  4N4R B;  1GTK A;  4KHP E;  4DR3 E;  4JI4 E;  2LJH A;  3AUZ A;  5KL2 A;  2VQE E;  5AC4 A;  4O24 A;  1WHQ A;  2EM7 A;  2V87 A;  2UUA E;  2EN8 A;  4R2E A;  5IWA E;  5ADZ A;  4LU9 A;  5A2Q C;  3BBG A;  2DRP A;  1NCS A;  5A6B D;  4X62 E;  3OML A;  4X8W A;  2EL4 A;  4WSP A;  3JU0 A;  5BR8 E;  4DUZ E; 
#chains in the Genus database with same CATH homology
 1TF6 A;  4F6M A;  2YTQ A;  1RMD A;  1TN9 A;  2EOY A;  3EPH A;  2LO3 A;  2EM0 A;  2YU8 A;  2EL5 A;  2EN4 A;  2EMY A;  2EOR A;  2LT7 A;  2DMI A;  4R2D A;  1DGC A;  2RSI A;  5KL7 A;  2EPX A;  3VHT B;  2EOM A;  2D9H A;  2EMA A;  2EMI A;  4R2S A;  1JK2 A;  2YTI A;  1ZR9 A;  2PRT A;  2ENC A;  2EM5 A;  2DGC A;  2EE8 A;  3MHS C;  4FK5 C;  4R2P A;  1P47 A;  2EPZ A;  2YTG A;  2EM4 A;  4GZN C;  2NAB A;  1JK1 A;  1BB8 A;  2MDG A;  4F2J C;  2EOS A;  2ELY A;  1G2F C;  1B69 A;  4M9V C;  4IS1 C;  1ZAA C;  2RPC A;  2WBT A;  2J7J A;  1YUJ A;  2EMH A;  2EM9 A;  2DLQ A;  2LV2 A;  2ELZ A;  2YSP A;  4WSG A;  1UBD C;  2EPP A;  4R2C A;  2ENA A;  2EOF A;  3EPL A;  1AAY A;  2EOH A;  1A1G A;  1A1K A;  2WCC 3;  1YUI A;  4X9J A;  2GLI A;  2EM6 A;  2EN7 A;  1X6E A;  2EPA A;  2EPR A;  1A1F A;  2M9A A;  2EN6 A;  2EQ1 A;  2EM2 A;  1MEY C;  2YTO A;  2JPA A;  2DLK A;  3UK3 C;  4R2Q A;  1X6F A;  1X3C A;  5KL5 A;  2EOJ A;  1A1I A;  2VRD A;  4R2R A;  2YU5 A;  1X6H A;  2LCE A;  1A1L A;  1F2I G;  2JP9 A;  2CTD A;  1Z1B A;  2YTN A;  2EOZ A;  5KL6 A;  2EMW A;  2EL6 A;  2EQ0 A;  2EPU A;  2GHF A;  2YTJ A;  2WBU A;  2E72 A;  1BBO A;  1WJP A;  5KL3 A;  2EMF A;  2LVH A;  2CT1 A;  2EN3 A;  2MKN A;  4R2A A;  2EMC A;  2R1F A;  1YSA C;  2YRH A;  1A1H A;  2HGH A;  2EM3 A;  2EOE A;  2EP3 A;  2EM8 A;  1G2D C;  2EMG A;  2EJ4 A;  2EN1 A;  2YTP A;  2WBS A;  1KJK A;  2EN2 A;  2YTF A;  1LLM C;  1A1J A;  5KL4 A;  2MKD A;  2EMB A;  2EMK A;  2EOQ A;  2EMX A;  4F6N A;  2YSO A;  3MHH C;  5KL2 A;  2EQ3 A;  2EOO A;  2EOX A;  2EM7 A;  1ZU1 A;  2CSH A;  2YTE A;  3M99 B;  2EML A;  2EN8 A;  4R2E A;  2EPC A;  2YRK A;  2ENH A;  2DRP A;  2YRM A;  1NCS A;  2BB8 A;  1TF3 A;  1X5W A;  1UN6 B;  2I13 A;  2A25 A;  3EPJ A;  2EL4 A;  2YTD A;  4IJD A;  3EPK A;  2ADR A;  2EMZ A;  2EOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...