3TQMA

Structure of an ribosomal subunit interface protein from coxiella burnetii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MHIQMTGQGVDISPALRELTEKKLHRIQPCRDEISNIHIIFHINKLKKIVDANVKLPGSTINAQAESDDMYKTVDLLMHKLETQLSKYKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-associated factor Y
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Protein binding
total genus 24
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 3tqmA00
1L4SA 4HEIA 1N3GA 2YWQA 3TQMA 1IMUA 2RQLA
chains in the Genus database with same CATH superfamily
4MLVA 2Q8UA 1N3GA 4BC7A 2EL5A 1ZBQA 2JR1A 4BS9A 1YUIA 4TUGA 2EOMA 4WPYA 4IJDA 2NUFA 4JI2E 4NXNE 3P1XA 3THNA 4BC9A 4LFCE 2RS7A 3C4BA 2KHXA 5LMUE 3MSWA 2EPRA 5IXMB 1BBGA 3MHHC 2K7IA 3EPLA 1FJGE 4OOGC 2MDRA 2YU8A 3DF6A 2EOXA 1ZBTA 2EMBA 2WBUA 2EMLA 2WZOA 3HQ1A 1G2DC 3BF2A 3KZYA 4OX9E 2E5LE 1WRJA 5KL4A 1IQSA 3HPSA 1AH5A 3LMLA 2EPMX 2VE7C 2V85A 4GKKE 2JXPA 5IWAE 1PDAA 4ZYGA 3IWBA 2WCC3 2VQFE 3LLHA 2I13A 4RHBB 4LF6E 3C4TA 1STUA 2J7JA 4DR4E 2NUEA 3F6GA 1EH6A 5BR8E 1YYOA 3J81C 3AV0A 2KONA 1UILA 2EPXA 4X8WA 4F2JC 1YYKA 4L8NA 4R2CA 2L92A 2EOQA 2ENHA 4R2EA 2L33A 4YHHE 1EKZA 2YU5A 1YSAC 4MLQA 5A6BD 1YUJA 2EM9A 3QG5C 1TF3A 4N4RB 2YRHA 1LLMC 2L3CA 1G2FC 4R2DA 2V89A 2EPCA 2LV2A 2DLQA 4NHRA 2D9HA 2R1FA 2ODRC 2EMFA 4R2SA 3BIDA 2M7QA 4F9BB 2NABA 2EM5A 4O4KA 2JWOA 2MC6A 2EQ1A 4R2RA 3HTXA 2EN7A 3ZOQB 4LF5E 4GZNC 4R2QA 2EMWA 1MEYC 4O43A 1NCSA 4O5GA 2B7VA 4L5NC 4B3ME 2F4VE 1T4LB 4LU9A 2EL4A 3OTOE 1FKAE 2HGHA 2YSPA 2EMGA 2E1MA 2RSIA 3T1YE 2LTSA 4LFAE 2EM7A 5T6JA 3OMLA 4NZVA 1X47A 4WYQB 2EQ0A 5TSEA 2EE8A 5AE2A 2G7HA 1A1LA 4JI6E 1EH7A 3ECRA 1Z1BA 1TF6A 4Q35B 2I9IA 4AQYE 4F6NA 3VYYA 3BBGA 2EP3A 5FLXC 2DB2A 2YTOA 1RMDA 5F3WA 5ADZA 4R2PA 3VHTB 4DR2E 4DUZE 4LF8E 1AAYA 5KL3A 4LF9E 4JV5E 2YTGA 1X6EA 1EH8A 4JI8E 3HPZA 1WHNA 4BHCA 1BB8A 2EWLA 4ZYEA 4X9JA 1N33E 1X48A 2YTJA 4DMIA 3ADGA 2F8BA 1DQ3A 5KL7A 1RQ0A 1O0WA 2JPAA 3EPJA 2EOEA 1KYQA 5AC4A 5CFFE 2K4VA 1YFHA 1IMUA 5A2QC 3IWCA 2BBGA 2LT7A 4F6MA 2RTXA 1MGTA 2ELZA 3H09A 2YTFA 4KWYA 2YZTA 4WSGA 1A1KA 2MC5A 2MDGA 4KZSA 4R8OA 2VF1A 3FIGA 2EOYA 2WBTA 2EPUA 2YWQA 4F9CB 2EM8A 2LCEA 2MKDA 4RH8A 2DSYA 5LMNE 2EM3A 4X65E 2YSOA 3EPKA 4LF4E 4HTGA 2EM6A 1ZAAC 1HNZE 2EN8A 3C6MA 1BBOA 2UUBE 4O24A 2VRDA 2EOZA 1SR9A 5KL2A 2H36X 2DRPA 5IV8B 4BHBA 1IBME 4JI0E 1YYWA 5KL6A 1XMQE 1N32E 1UHZA 2YTIA 2EM0A 2JY9A 1X3CA 2R76A 2EMIA 2ELYA 4IS1C 1UN6B 2EOJA 2EPPA 4WX9A 4LTYA 4HEIA 4KHPE 2L3JA 1PKPA 2EN4A 2HJJA 2YTPA 2N3GA 3BGHA 2EMKA 2ZM6E 5LLQA 2LJHA 1X49A 5A6JA 2N3HA 2EN3A 1F2IG 2EN1A 2EMXA 4B3RE 3DJWA 4JI1E 4DR5E 1L4SA 4DV3E 1PJQA 4DR1E 4B3SE 2DMYA 1X5WA 3TQMA 2L2KB 1J5EE 2PRTA 1QU6A 2EJ4A 2JYAA 4B3TE 4DV2E 2ENAA 5AC5A 1HNXE 3C6KA 2V87A 5LL6R 2LUPB 1T4NA 1X6HA 1SFEA 2DIXA 1UBDC 3JU0A 2IHR1 4YY3E 1X6FA 2EOSA 2LO3A 4K0KE 4DV4E 2V86A 4X64E 4GEQB 3RMPA 2NUGA 2M1SA 2V83A 4M0VA 4R03A 2YPNA 2HHHE 3J7AG 3MHSC 4WSPA 4ZYHA 1XNQE 2FV4B 2L8TA 2RS6A 3JTZA 2EMCA 2UXDE 4BCAA 3JAMC 2L2MA 1RC7A 2EPOA 2LTRA 2YTNA 3J80C 1PJTA 2EMAA 2UXCE 3L00A 1JK1A 1WXRA 4WXDA 4DV5E 4JI4E 1A1JA 4LF7E 2JVAA 4DV1E 1WHQA 2DMIA 1GZ6A 3VYXA 1A1FA 2GPIA 1B69A 2EN6A 2UU9E 3T1HE 4Q28A 2DLKA 2UUAE 2ENCA 1NEIA 1TN9A 2V88A 2YTDA 1T38A 2YT4A 4P78A 3M99B 4DKKA 3EPHA 1GTKA 4DV0E 2CSHA 2EMHA 3HXLA 1T39A 4BBYA 2GHFA 2EORA 1DI2A 2MKNA 4X62E 1HR0E 2LUQA 4F9AB 1YPNA 2EM2A 1IBLE 3ADIA 2RPCA 2N8XA 2EZ6A 4DR6E 4DV7E 4DUYE 1JK2A 5AE1A 3VK6A 2VQEE 2LE2A 4JI3E 4BMJA 2EMYA 2RQLA 1DGCA 1XNRE 3IWDA 2EM4A 3F6HA 2UUCE 2CT1A 1IBKE 4M9VC 2EPKX 1KJKA 5AE3A 2JOBA 1N34E 5IT9C 3KWRA 1N36E 2EPNA 2EPLX 2RSMA 3ADJA 2A25A 2CTDA 2M4IA 2NA2A 1HNWE 4DR3E 4DR7E 2BB8A 3K6QA 1J26A 2EN2A 4JI5E 4F54A 2LVHA 4M2ZA 2B9DA 3EQ1A 3AUZA 1PJSA 2L6MA 5A6AA 3UK3C 2KOUA 2YTQA 1GQEA 3ADLA 4JI7E 2L2NA 2HC5A 2EQ3A 1WJPA 5DNYA 2WBSA 2EPZA 1P47A 2EOIA 1ZU1A 2B7TA 2GLIA 4GKJE 4ZYDA 2CPNA 2YTEA 2M9AA 2EPAA 2ODRD 4FK5C 4DV6E 2UXBE 2B3TB 4NXME 2LMZA 5KL5A 2LBSB 5A6KA 2FTXB 2E72A 2EOOA 1XMOE 4P7DA 2FGGA 1IQOA 1A1HA 2DGCA 5A69A 4LFBE 5AASA 5A6BA 2JP9A 1YZ9A 2V8QB 4M30A 2YRMA 4TUIA 3THOB 4J8ZA 4WXCA 1A1IA 1QNTA 2EL6A 2EOFA 2JOXA 2LRSA 4WFTA 2LJUA 4I8OA 4JYAE 1ZR9A 4R2AA 4X66E 1T4OA 2EOHA 2ADRA 2YRKA 3KZZA 3J7Yp 1A1GA 2EMZA 1I94E
chains in the Genus database with same CATH topology
1L4SA 4HEIA 1N3GA 2YWQA 3TQMA 1IMUA 2RQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4S A;  4HEI A;  1N3G A;  2YWQ A;  3TQM A;  1IMU A;  2RQL A; 
#chains in the Genus database with same CATH topology
 4MLV A;  2Q8U A;  1N3G A;  4BC7 A;  2EL5 A;  1ZBQ A;  2JR1 A;  4BS9 A;  1YUI A;  4TUG A;  2EOM A;  4WPY A;  4IJD A;  2NUF A;  4JI2 E;  4NXN E;  3P1X A;  3THN A;  4BC9 A;  4LFC E;  2RS7 A;  3C4B A;  2KHX A;  5LMU E;  3MSW A;  2EPR A;  5IXM B;  1BBG A;  3MHH C;  2K7I A;  3EPL A;  1FJG E;  4OOG C;  2MDR A;  2YU8 A;  3DF6 A;  2EOX A;  1ZBT A;  2EMB A;  2WBU A;  2EML A;  2WZO A;  3HQ1 A;  1G2D C;  3BF2 A;  3KZY A;  4OX9 E;  2E5L E;  1WRJ A;  5KL4 A;  1IQS A;  3HPS A;  1AH5 A;  3LML A;  2EPM X;  2VE7 C;  2V85 A;  4GKK E;  2JXP A;  5IWA E;  1PDA A;  4ZYG A;  3IWB A;  2WCC 3;  2VQF E;  3LLH A;  2I13 A;  4RHB B;  4LF6 E;  3C4T A;  1STU A;  2J7J A;  4DR4 E;  2NUE A;  3F6G A;  1EH6 A;  5BR8 E;  1YYO A;  3J81 C;  3AV0 A;  2KON A;  1UIL A;  2EPX A;  4X8W A;  4F2J C;  1YYK A;  4L8N A;  4R2C A;  2L92 A;  2EOQ A;  2ENH A;  4R2E A;  2L33 A;  4YHH E;  1EKZ A;  2YU5 A;  1YSA C;  4MLQ A;  5A6B D;  1YUJ A;  2EM9 A;  3QG5 C;  1TF3 A;  4N4R B;  2YRH A;  1LLM C;  2L3C A;  1G2F C;  4R2D A;  2V89 A;  2EPC A;  2LV2 A;  2DLQ A;  4NHR A;  2D9H A;  2R1F A;  2ODR C;  2EMF A;  4R2S A;  3BID A;  2M7Q A;  4F9B B;  2NAB A;  2EM5 A;  4O4K A;  2JWO A;  2MC6 A;  2EQ1 A;  4R2R A;  3HTX A;  2EN7 A;  3ZOQ B;  4LF5 E;  4GZN C;  4R2Q A;  2EMW A;  1MEY C;  4O43 A;  1NCS A;  4O5G A;  2B7V A;  4L5N C;  4B3M E;  2F4V E;  1T4L B;  4LU9 A;  2EL4 A;  3OTO E;  1FKA E;  2HGH A;  2YSP A;  2EMG A;  2E1M A;  2RSI A;  3T1Y E;  2LTS A;  4LFA E;  2EM7 A;  5T6J A;  3OML A;  4NZV A;  1X47 A;  4WYQ B;  2EQ0 A;  5TSE A;  2EE8 A;  5AE2 A;  2G7H A;  1A1L A;  4JI6 E;  1EH7 A;  3ECR A;  1Z1B A;  1TF6 A;  4Q35 B;  2I9I A;  4AQY E;  4F6N A;  3VYY A;  3BBG A;  2EP3 A;  5FLX C;  2DB2 A;  2YTO A;  1RMD A;  5F3W A;  5ADZ A;  4R2P A;  3VHT B;  4DR2 E;  4DUZ E;  4LF8 E;  1AAY A;  5KL3 A;  4LF9 E;  4JV5 E;  2YTG A;  1X6E A;  1EH8 A;  4JI8 E;  3HPZ A;  1WHN A;  4BHC A;  1BB8 A;  2EWL A;  4ZYE A;  4X9J A;  1N33 E;  1X48 A;  2YTJ A;  4DMI A;  3ADG A;  2F8B A;  1DQ3 A;  5KL7 A;  1RQ0 A;  1O0W A;  2JPA A;  3EPJ A;  2EOE A;  1KYQ A;  5AC4 A;  5CFF E;  2K4V A;  1YFH A;  1IMU A;  5A2Q C;  3IWC A;  2BBG A;  2LT7 A;  4F6M A;  2RTX A;  1MGT A;  2ELZ A;  3H09 A;  2YTF A;  4KWY A;  2YZT A;  4WSG A;  1A1K A;  2MC5 A;  2MDG A;  4KZS A;  4R8O A;  2VF1 A;  3FIG A;  2EOY A;  2WBT A;  2EPU A;  2YWQ A;  4F9C B;  2EM8 A;  2LCE A;  2MKD A;  4RH8 A;  2DSY A;  5LMN E;  2EM3 A;  4X65 E;  2YSO A;  3EPK A;  4LF4 E;  4HTG A;  2EM6 A;  1ZAA C;  1HNZ E;  2EN8 A;  3C6M A;  1BBO A;  2UUB E;  4O24 A;  2VRD A;  2EOZ A;  1SR9 A;  5KL2 A;  2H36 X;  2DRP A;  5IV8 B;  4BHB A;  1IBM E;  4JI0 E;  1YYW A;  5KL6 A;  1XMQ E;  1N32 E;  1UHZ A;  2YTI A;  2EM0 A;  2JY9 A;  1X3C A;  2R76 A;  2EMI A;  2ELY A;  4IS1 C;  1UN6 B;  2EOJ A;  2EPP A;  4WX9 A;  4LTY A;  4HEI A;  4KHP E;  2L3J A;  1PKP A;  2EN4 A;  2HJJ A;  2YTP A;  2N3G A;  3BGH A;  2EMK A;  2ZM6 E;  5LLQ A;  2LJH A;  1X49 A;  5A6J A;  2N3H A;  2EN3 A;  1F2I G;  2EN1 A;  2EMX A;  4B3R E;  3DJW A;  4JI1 E;  4DR5 E;  1L4S A;  4DV3 E;  1PJQ A;  4DR1 E;  4B3S E;  2DMY A;  1X5W A;  3TQM A;  2L2K B;  1J5E E;  2PRT A;  1QU6 A;  2EJ4 A;  2JYA A;  4B3T E;  4DV2 E;  2ENA A;  5AC5 A;  1HNX E;  3C6K A;  2V87 A;  5LL6 R;  2LUP B;  1T4N A;  1X6H A;  1SFE A;  2DIX A;  1UBD C;  3JU0 A;  2IHR 1;  4YY3 E;  1X6F A;  2EOS A;  2LO3 A;  4K0K E;  4DV4 E;  2V86 A;  4X64 E;  4GEQ B;  3RMP A;  2NUG A;  2M1S A;  2V83 A;  4M0V A;  4R03 A;  2YPN A;  2HHH E;  3J7A G;  3MHS C;  4WSP A;  4ZYH A;  1XNQ E;  2FV4 B;  2L8T A;  2RS6 A;  3JTZ A;  2EMC A;  2UXD E;  4BCA A;  3JAM C;  2L2M A;  1RC7 A;  2EPO A;  2LTR A;  2YTN A;  3J80 C;  1PJT A;  2EMA A;  2UXC E;  3L00 A;  1JK1 A;  1WXR A;  4WXD A;  4DV5 E;  4JI4 E;  1A1J A;  4LF7 E;  2JVA A;  4DV1 E;  1WHQ A;  2DMI A;  1GZ6 A;  3VYX A;  1A1F A;  2GPI A;  1B69 A;  2EN6 A;  2UU9 E;  3T1H E;  4Q28 A;  2DLK A;  2UUA E;  2ENC A;  1NEI A;  1TN9 A;  2V88 A;  2YTD A;  1T38 A;  2YT4 A;  4P78 A;  3M99 B;  4DKK A;  3EPH A;  1GTK A;  4DV0 E;  2CSH A;  2EMH A;  3HXL A;  1T39 A;  4BBY A;  2GHF A;  2EOR A;  1DI2 A;  2MKN A;  4X62 E;  1HR0 E;  2LUQ A;  4F9A B;  1YPN A;  2EM2 A;  1IBL E;  3ADI A;  2RPC A;  2N8X A;  2EZ6 A;  4DR6 E;  4DV7 E;  4DUY E;  1JK2 A;  5AE1 A;  3VK6 A;  2VQE E;  2LE2 A;  4JI3 E;  4BMJ A;  2EMY A;  2RQL A;  1DGC A;  1XNR E;  3IWD A;  2EM4 A;  3F6H A;  2UUC E;  2CT1 A;  1IBK E;  4M9V C;  2EPK X;  1KJK A;  5AE3 A;  2JOB A;  1N34 E;  5IT9 C;  3KWR A;  1N36 E;  2EPN A;  2EPL X;  2RSM A;  3ADJ A;  2A25 A;  2CTD A;  2M4I A;  2NA2 A;  1HNW E;  4DR3 E;  4DR7 E;  2BB8 A;  3K6Q A;  1J26 A;  2EN2 A;  4JI5 E;  4F54 A;  2LVH A;  4M2Z A;  2B9D A;  3EQ1 A;  3AUZ A;  1PJS A;  2L6M A;  5A6A A;  3UK3 C;  2KOU A;  2YTQ A;  1GQE A;  3ADL A;  4JI7 E;  2L2N A;  2HC5 A;  2EQ3 A;  1WJP A;  5DNY A;  2WBS A;  2EPZ A;  1P47 A;  2EOI A;  1ZU1 A;  2B7T A;  2GLI A;  4GKJ E;  4ZYD A;  2CPN A;  2YTE A;  2M9A A;  2EPA A;  2ODR D;  4FK5 C;  4DV6 E;  2UXB E;  2B3T B;  4NXM E;  2LMZ A;  5KL5 A;  2LBS B;  5A6K A;  2FTX B;  2E72 A;  2EOO A;  1XMO E;  4P7D A;  2FGG A;  1IQO A;  1A1H A;  2DGC A;  5A69 A;  4LFB E;  5AAS A;  5A6B A;  2JP9 A;  1YZ9 A;  2V8Q B;  4M30 A;  2YRM A;  4TUI A;  3THO B;  4J8Z A;  4WXC A;  1A1I A;  1QNT A;  2EL6 A;  2EOF A;  2JOX A;  2LRS A;  4WFT A;  2LJU A;  4I8O A;  4JYA E;  1ZR9 A;  4R2A A;  4X66 E;  1T4O A;  2EOH A;  2ADR A;  2YRK A;  3KZZ A;  3J7Y p;  1A1G A;  2EMZ A;  1I94 E; 
#chains in the Genus database with same CATH homology
 1L4S A;  4HEI A;  1N3G A;  2YWQ A;  3TQM A;  1IMU A;  2RQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...