3TQMA

Structure of an ribosomal subunit interface protein from coxiella burnetii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MHIQMTGQGVDISPALRELTEKKLHRIQPCRDEISNIHIIFHINKLKKIVDANVKLPGSTINAQAESDDMYKTVDLLMHKLETQLSKYKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-associated factor Y
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Protein binding
total genus 24
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 3tqmA00
3TQMA 1L4SA 2YWQA 4HEIA 2RQLA 1IMUA 1N3GA
chains in the Genus database with same CATH superfamily
1SR9A 2JWOA 2MDGA 2LE2A 3HPSA 2DSYA 3LLHA 4R2DA 4NXME 1BB8A 1HNZE 3ZOQB 1RC7A 1DGCA 5DNYA 1UILA 1X3CA 3J80C 5A6BD 1Z1BA 2RQLA 1KYQA 3T1YE 2F4VE 1N3GA 3HTXA 1XNQE 2EOZA 3THOB 2EOSA 2NUGA 3C6KA 1T39A 3AUZA 4Q35B 4LU9A 2NUEA 2LTRA 1AH5A 4DV7E 1T4OA 2EN3A 4KWYA 2UU9E 2VRDA 2EPRA 4DR1E 2DMYA 4DV4E 2YT4A 4DKKA 4X9JA 2BB8A 4M30A 2UUCE 2YTGA 4O5GA 3ADGA 1PDAA 5A6BA 3K6QA 1T4LB 2EPMX 4X65E 2YTOA 2R1FA 4DV1E 2EL4A 5AE3A 1WXRA 1EH6A 4KHPE 1T38A 2ZM6E 2N3GA 2EM9A 2JXPA 2ODRD 2EN7A 4MLVA 1A1IA 2EN1A 2YZTA 2MKNA 1WHQA 3FIGA 5ADZA 2YU5A 4DV3E 1PKPA 1TN9A 1EH8A 2EQ3A 4DR2E 3KWRA 3P1XA 1I94E 3C4BA 1JK1A 2YRKA 2LCEA 4R2QA 1EH7A 2V8QB 3OMLA 2ENCA 3C6MA 4Q28A 1G2FC 2EMLA 4RH8A 1NCSA 2YRHA 4BC7A 2PRTA 4LFCE 1UBDC 4NZVA 2KONA 3EPJA 1N33E 2L33A 2JPAA 4JI4E 1IBME 3AV0A 5A6JA 1X48A 5A69A 3VK6A 4O4KA 2I9IA 4DMIA 2A25A 4JI7E 4JI8E 1ZR9A 1O0WA 4OOGC 2KOUA 1STUA 4DV6E 1XMOE 1ZAAC 2N8XA 4M0VA 3LMLA 2FGGA 1YZ9A 1LLMC 4BC9A 1X49A 1HNXE 2B9DA 5KL7A 2RS6A 3THNA 2EOOA 2EOXA 2EMHA 4OX9E 2RSIA 2L2KB 1B69A 2JR1A 2L92A 1TF3A 1QU6A 5AASA 4R2SA 5LMUE 1PJQA 2CT1A 2EMXA 2V89A 3F6GA 4DV0E 4JV5E 2K4VA 2CSHA 4WX9A 3IWCA 4BCAA 1XMQE 2B7TA 3ADLA 2ADRA 3UK3C 2EOJA 5IWAE 2MC5A 2V87A 3L00A 4LF4E 2JY9A 2CTDA 4NXNE 5IV8B 2EOQA 4IJDA 4RHBB 4LFAE 2FTXB 2VE7C 4R2AA 1P47A 2D9HA 3J7AG 4HTGA 2DIXA 2NUFA 1YFHA 4BMJA 3J81C 2WZOA 4GEQB 2UXBE 1PJTA 1UHZA 4DR4E 5F3WA 2YSPA 2YWQA 3VYYA 2EL6A 4LF7E 3JU0A 2E1MA 4JI0E 2N3HA 5LL6R 3BIDA 5TSEA 2MKDA 1RMDA 1A1JA 2EOEA 2V86A 2L2NA 4DUZE 2ENAA 3MHHC 2LUPB 4GKKE 2HGHA 1X47A 2HHHE 2RS7A 4WSGA 4B3RE 1EKZA 5LMNE 2EM5A 1PJSA 2M9AA 2WBUA 4NHRA 4KZSA 2JYAA 4N4RB 4LFBE 2EPAA 4JI1E 4F9BB 2EMAA 1YYKA 4WXCA 2E5LE 2JP9A 2EM3A 2I13A 2DGCA 4GZNC 2EOHA 2GPIA 2EMWA 1XNRE 2E72A 2DRPA 2EOFA 3HQ1A 1FJGE 2DLKA 4DR6E 2MC6A 2LJHA 2EN6A 1J26A 4LF5E 1T4NA 4P78A 1YUIA 4DR5E 1RQ0A 2YTFA 4P7DA 4BHCA 1YSAC 4F54A 2GHFA 4F2JC 2LVHA 1IBKE 1QNTA 2YRMA 5KL6A 2LBSB 2YTNA 2EQ1A 1X6EA 1A1HA 5IXMB 2EOIA 4F9CB 3DF6A 4ZYDA 3ADIA 2M7QA 2JOXA 1X5WA 5BR8E 4JI5E 2L3CA 1IQSA 3IWBA 2R76A 2EPUA 3J7Yp 2WBSA 3EPLA 1KJKA 2J7JA 2K7IA 2VQFE 1WHNA 1WRJA 1YYOA 2V85A 5KL4A 2WBTA 2EPCA 5FLXC 1YYWA 2EMYA 4O24A 4ZYGA 2YTIA 1ZBTA 5KL5A 2KHXA 2EMZA 3EQ1A 3C4TA 4JI6E 1L4SA 4DR7E 2EPNA 4B3TE 3BBGA 2EM4A 4TUIA 2DLQA 2BBGA 3M99B 4LTYA 4R2EA 2YU8A 2HJJA 4WFTA 4FK5C 1N34E 2DB2A 2L3JA 3MHSC 2EPLX 2EN8A 3HXLA 5AC4A 1AAYA 3HPZA 2YPNA 3H09A 2EN4A 2EE8A 2EMFA 2EMCA 2JVAA 2ENHA 2IHR1 3EPHA 4L8NA 2MDRA 4JI2E 5CFFE 2B7VA 4GKJE 2YTQA 4LF8E 2M1SA 2EM2A 1BBOA 3JTZA 4HEIA 2YTDA 2ODRC 1A1FA 2RPCA 2LUQA 2F8BA 1MGTA 2VQEE 1SFEA 5LLQA 4ZYHA 1G2DC 5T6JA 4BBYA 2V88A 3VHTB 4BHBA 3OTOE 3F6HA 1WJPA 3TQMA 3JAMC 4R2RA 2YTEA 2LTSA 1YPNA 2EMKA 3IWDA 5AC5A 1J5EE 4YY3E 4AQYE 2VF1A 3ADJA 1A1KA 1IQOA 2EOYA 4DV5E 3BGHA 2EMBA 2RSMA 2EOMA 4M9VC 5AE1A 2EM6A 4R2PA 1IBLE 2EN2A 4ZYEA 2LJUA 2JOBA 4LF6E 3MSWA 2UXCE 3QG5C 1NEIA 2EMGA 2G7HA 4MLQA 4X64E 5A6KA 4F6NA 2YTJA 4F9AB 2LMZA 4J8ZA 3RMPA 4B3SE 4DV2E 2EPPA 4JYAE 2GLIA 3VYXA 2EMIA 2RTXA 5KL2A 4L5NC 4WYQB 2ELZA 2L6MA 2YSOA 2EPKX 1UN6B 2EM7A 1DQ3A 4YHHE 2H36X 2EM0A 1JK2A 4DUYE 2EPXA 1X6HA 5A6AA 2ELYA 3ECRA 2YTPA 2LRSA 2Q8UA 4I8OA 2NABA 5IT9C 2EP3A 3KZZA 2L2MA 2EQ0A 1FKAE 2EZ6A 2WCC3 4O43A 2UXDE 4JI3E 4TUGA 1N36E 1GTKA 1DI2A 2UUAE 5AE2A 2DMIA 2EJ4A 3KZYA 1HNWE 4BS9A 2LV2A 2FV4B 4X66E 4IS1C 1TF6A 4B3ME 5A2QC 4M2ZA 1X6FA 2B3TB 4WSPA 1A1GA 2NA2A 4R2CA 1ZBQA 2EORA 4WPYA 3DJWA 1N32E 2HC5A 2V83A 2EPZA 2LO3A 4DR3E 2M4IA 2EM8A 2EWLA 1YUJA 2EPOA 3BF2A 1HR0E 2EL5A 2LT7A 4LF9E 1A1LA 1ZU1A 4X8WA 4R8OA 2UUBE 4X62E 3EPKA 3T1HE 4WXDA 1IMUA 4F6MA 1F2IG 1GQEA 2CPNA 1BBGA 1GZ6A 5KL3A 4R03A 1MEYC 4K0KE 2L8TA
chains in the Genus database with same CATH topology
3TQMA 1L4SA 2YWQA 4HEIA 2RQLA 1IMUA 1N3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQM A;  1L4S A;  2YWQ A;  4HEI A;  2RQL A;  1IMU A;  1N3G A; 
#chains in the Genus database with same CATH topology
 1SR9 A;  2JWO A;  2MDG A;  2LE2 A;  3HPS A;  2DSY A;  3LLH A;  4R2D A;  4NXM E;  1BB8 A;  1HNZ E;  3ZOQ B;  1RC7 A;  1DGC A;  5DNY A;  1UIL A;  1X3C A;  3J80 C;  5A6B D;  1Z1B A;  2RQL A;  1KYQ A;  3T1Y E;  2F4V E;  1N3G A;  3HTX A;  1XNQ E;  2EOZ A;  3THO B;  2EOS A;  2NUG A;  3C6K A;  1T39 A;  3AUZ A;  4Q35 B;  4LU9 A;  2NUE A;  2LTR A;  1AH5 A;  4DV7 E;  1T4O A;  2EN3 A;  4KWY A;  2UU9 E;  2VRD A;  2EPR A;  4DR1 E;  2DMY A;  4DV4 E;  2YT4 A;  4DKK A;  4X9J A;  2BB8 A;  4M30 A;  2UUC E;  2YTG A;  4O5G A;  3ADG A;  1PDA A;  5A6B A;  3K6Q A;  1T4L B;  2EPM X;  4X65 E;  2YTO A;  2R1F A;  4DV1 E;  2EL4 A;  5AE3 A;  1WXR A;  1EH6 A;  4KHP E;  1T38 A;  2ZM6 E;  2N3G A;  2EM9 A;  2JXP A;  2ODR D;  2EN7 A;  4MLV A;  1A1I A;  2EN1 A;  2YZT A;  2MKN A;  1WHQ A;  3FIG A;  5ADZ A;  2YU5 A;  4DV3 E;  1PKP A;  1TN9 A;  1EH8 A;  2EQ3 A;  4DR2 E;  3KWR A;  3P1X A;  1I94 E;  3C4B A;  1JK1 A;  2YRK A;  2LCE A;  4R2Q A;  1EH7 A;  2V8Q B;  3OML A;  2ENC A;  3C6M A;  4Q28 A;  1G2F C;  2EML A;  4RH8 A;  1NCS A;  2YRH A;  4BC7 A;  2PRT A;  4LFC E;  1UBD C;  4NZV A;  2KON A;  3EPJ A;  1N33 E;  2L33 A;  2JPA A;  4JI4 E;  1IBM E;  3AV0 A;  5A6J A;  1X48 A;  5A69 A;  3VK6 A;  4O4K A;  2I9I A;  4DMI A;  2A25 A;  4JI7 E;  4JI8 E;  1ZR9 A;  1O0W A;  4OOG C;  2KOU A;  1STU A;  4DV6 E;  1XMO E;  1ZAA C;  2N8X A;  4M0V A;  3LML A;  2FGG A;  1YZ9 A;  1LLM C;  4BC9 A;  1X49 A;  1HNX E;  2B9D A;  5KL7 A;  2RS6 A;  3THN A;  2EOO A;  2EOX A;  2EMH A;  4OX9 E;  2RSI A;  2L2K B;  1B69 A;  2JR1 A;  2L92 A;  1TF3 A;  1QU6 A;  5AAS A;  4R2S A;  5LMU E;  1PJQ A;  2CT1 A;  2EMX A;  2V89 A;  3F6G A;  4DV0 E;  4JV5 E;  2K4V A;  2CSH A;  4WX9 A;  3IWC A;  4BCA A;  1XMQ E;  2B7T A;  3ADL A;  2ADR A;  3UK3 C;  2EOJ A;  5IWA E;  2MC5 A;  2V87 A;  3L00 A;  4LF4 E;  2JY9 A;  2CTD A;  4NXN E;  5IV8 B;  2EOQ A;  4IJD A;  4RHB B;  4LFA E;  2FTX B;  2VE7 C;  4R2A A;  1P47 A;  2D9H A;  3J7A G;  4HTG A;  2DIX A;  2NUF A;  1YFH A;  4BMJ A;  3J81 C;  2WZO A;  4GEQ B;  2UXB E;  1PJT A;  1UHZ A;  4DR4 E;  5F3W A;  2YSP A;  2YWQ A;  3VYY A;  2EL6 A;  4LF7 E;  3JU0 A;  2E1M A;  4JI0 E;  2N3H A;  5LL6 R;  3BID A;  5TSE A;  2MKD A;  1RMD A;  1A1J A;  2EOE A;  2V86 A;  2L2N A;  4DUZ E;  2ENA A;  3MHH C;  2LUP B;  4GKK E;  2HGH A;  1X47 A;  2HHH E;  2RS7 A;  4WSG A;  4B3R E;  1EKZ A;  5LMN E;  2EM5 A;  1PJS A;  2M9A A;  2WBU A;  4NHR A;  4KZS A;  2JYA A;  4N4R B;  4LFB E;  2EPA A;  4JI1 E;  4F9B B;  2EMA A;  1YYK A;  4WXC A;  2E5L E;  2JP9 A;  2EM3 A;  2I13 A;  2DGC A;  4GZN C;  2EOH A;  2GPI A;  2EMW A;  1XNR E;  2E72 A;  2DRP A;  2EOF A;  3HQ1 A;  1FJG E;  2DLK A;  4DR6 E;  2MC6 A;  2LJH A;  2EN6 A;  1J26 A;  4LF5 E;  1T4N A;  4P78 A;  1YUI A;  4DR5 E;  1RQ0 A;  2YTF A;  4P7D A;  4BHC A;  1YSA C;  4F54 A;  2GHF A;  4F2J C;  2LVH A;  1IBK E;  1QNT A;  2YRM A;  5KL6 A;  2LBS B;  2YTN A;  2EQ1 A;  1X6E A;  1A1H A;  5IXM B;  2EOI A;  4F9C B;  3DF6 A;  4ZYD A;  3ADI A;  2M7Q A;  2JOX A;  1X5W A;  5BR8 E;  4JI5 E;  2L3C A;  1IQS A;  3IWB A;  2R76 A;  2EPU A;  3J7Y p;  2WBS A;  3EPL A;  1KJK A;  2J7J A;  2K7I A;  2VQF E;  1WHN A;  1WRJ A;  1YYO A;  2V85 A;  5KL4 A;  2WBT A;  2EPC A;  5FLX C;  1YYW A;  2EMY A;  4O24 A;  4ZYG A;  2YTI A;  1ZBT A;  5KL5 A;  2KHX A;  2EMZ A;  3EQ1 A;  3C4T A;  4JI6 E;  1L4S A;  4DR7 E;  2EPN A;  4B3T E;  3BBG A;  2EM4 A;  4TUI A;  2DLQ A;  2BBG A;  3M99 B;  4LTY A;  4R2E A;  2YU8 A;  2HJJ A;  4WFT A;  4FK5 C;  1N34 E;  2DB2 A;  2L3J A;  3MHS C;  2EPL X;  2EN8 A;  3HXL A;  5AC4 A;  1AAY A;  3HPZ A;  2YPN A;  3H09 A;  2EN4 A;  2EE8 A;  2EMF A;  2EMC A;  2JVA A;  2ENH A;  2IHR 1;  3EPH A;  4L8N A;  2MDR A;  4JI2 E;  5CFF E;  2B7V A;  4GKJ E;  2YTQ A;  4LF8 E;  2M1S A;  2EM2 A;  1BBO A;  3JTZ A;  4HEI A;  2YTD A;  2ODR C;  1A1F A;  2RPC A;  2LUQ A;  2F8B A;  1MGT A;  2VQE E;  1SFE A;  5LLQ A;  4ZYH A;  1G2D C;  5T6J A;  4BBY A;  2V88 A;  3VHT B;  4BHB A;  3OTO E;  3F6H A;  1WJP A;  3TQM A;  3JAM C;  4R2R A;  2YTE A;  2LTS A;  1YPN A;  2EMK A;  3IWD A;  5AC5 A;  1J5E E;  4YY3 E;  4AQY E;  2VF1 A;  3ADJ A;  1A1K A;  1IQO A;  2EOY A;  4DV5 E;  3BGH A;  2EMB A;  2RSM A;  2EOM A;  4M9V C;  5AE1 A;  2EM6 A;  4R2P A;  1IBL E;  2EN2 A;  4ZYE A;  2LJU A;  2JOB A;  4LF6 E;  3MSW A;  2UXC E;  3QG5 C;  1NEI A;  2EMG A;  2G7H A;  4MLQ A;  4X64 E;  5A6K A;  4F6N A;  2YTJ A;  4F9A B;  2LMZ A;  4J8Z A;  3RMP A;  4B3S E;  4DV2 E;  2EPP A;  4JYA E;  2GLI A;  3VYX A;  2EMI A;  2RTX A;  5KL2 A;  4L5N C;  4WYQ B;  2ELZ A;  2L6M A;  2YSO A;  2EPK X;  1UN6 B;  2EM7 A;  1DQ3 A;  4YHH E;  2H36 X;  2EM0 A;  1JK2 A;  4DUY E;  2EPX A;  1X6H A;  5A6A A;  2ELY A;  3ECR A;  2YTP A;  2LRS A;  2Q8U A;  4I8O A;  2NAB A;  5IT9 C;  2EP3 A;  3KZZ A;  2L2M A;  2EQ0 A;  1FKA E;  2EZ6 A;  2WCC 3;  4O43 A;  2UXD E;  4JI3 E;  4TUG A;  1N36 E;  1GTK A;  1DI2 A;  2UUA E;  5AE2 A;  2DMI A;  2EJ4 A;  3KZY A;  1HNW E;  4BS9 A;  2LV2 A;  2FV4 B;  4X66 E;  4IS1 C;  1TF6 A;  4B3M E;  5A2Q C;  4M2Z A;  1X6F A;  2B3T B;  4WSP A;  1A1G A;  2NA2 A;  4R2C A;  1ZBQ A;  2EOR A;  4WPY A;  3DJW A;  1N32 E;  2HC5 A;  2V83 A;  2EPZ A;  2LO3 A;  4DR3 E;  2M4I A;  2EM8 A;  2EWL A;  1YUJ A;  2EPO A;  3BF2 A;  1HR0 E;  2EL5 A;  2LT7 A;  4LF9 E;  1A1L A;  1ZU1 A;  4X8W A;  4R8O A;  2UUB E;  4X62 E;  3EPK A;  3T1H E;  4WXD A;  1IMU A;  4F6M A;  1F2I G;  1GQE A;  2CPN A;  1BBG A;  1GZ6 A;  5KL3 A;  4R03 A;  1MEY C;  4K0K E;  2L8T A; 
#chains in the Genus database with same CATH homology
 3TQM A;  1L4S A;  2YWQ A;  4HEI A;  2RQL A;  1IMU A;  1N3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...