1UHZA

Solution structure of dsrna binding domain in staufen homolog 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
GSSGSSGPISRLAQIQQARKEKEPDYILLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTSLQDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords staufen (RNA binding protein) homolog 2
publication title Solution structure of dsRNA binding domain in Staufen homolog 2
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1uhzA00
2KHXA 4M2ZA 2RTXA 1IBLE 1PKPA 4LF5E 2DB2A 4JI7E 4LFBE 2HHHE 3C4TA 4DUYE 2L3JA 4OOGC 4DR1E 2NUFA 3ADJA 1N33E 3ADIA 2UUCE 1IBME 4DV5E 4JI0E 4JI5E 4B3SE 4JI6E 4JI2E 2L2NA 4LF9E 4KHPE 3P1XA 4NXNE 4LFCE 2L33A 4YY3E 2CPNA 4JI8E 4DV3E 1UILA 1X49A 1XNRE 4GKKE 2JY9A 4X62E 3J7Yp 2DMYA 4B3ME 4GKJE 2NA2A 4DV6E 1N36E 1HNXE 5IWAE 2UXDE 1O0WA 4DV2E 2UXCE 2UU9E 4DV0E 5CFFE 4DR6E 2RSMA 2E5LE 2L2MA 2LUQA 4X65E 2VQEE 4DR2E 1HNWE 4DUZE 2NUEA 4M30A 3T1YE 4DV7E 4WYQB 1N34E 1I94E 4K0KE 1T4LB 3HTXA 2LTSA 1EKZA 1YYOA 5LMUE 3OTOE 1RC7A 2UUBE 4LF8E 4DV4E 1J26A 2N3HA 3VYYA 2NUGA 3ADLA 5LMNE 2YT4A 1HNZE 1X47A 1WHNA 1N32E 2B3TB 4LFAE 5BR8E 4LF4E 4OX9E 4NXME 4B3RE 2B7TA 1STUA 4LF6E 2N3GA 4DR7E 1T4OA 1XMOE 4JYAE 1GQEA 2UXBE 2LJHA 1QU6A 2B7VA 2IHR1 4WFTA 2LTRA 3VYXA 4X64E 4JI1E 4YHHE 2ZM6E 1ZBTA 3C4BA 2VQFE 1HR0E 4B3TE 4DKKA 4AQYE 2L2KB 1UHZA 4JI4E 1YYWA 4JV5E 3LLHA 2F4VE 4JI3E 1YYKA 4DV1E 1RQ0A 1XMQE 2LUPB 2RS6A 2RS7A 1DI2A 2L3CA 4LF7E 1YZ9A 1J5EE 1T4NA 4DR4E 2LBSB 4DR3E 4X8WA 3T1HE 1FJGE 4X66E 1X48A 1IBKE 2LRSA 2MDRA 1WHQA 2DIXA 1FKAE 3ADGA 4DR5E 1XNQE 2JVAA 2EZ6A 2UUAE
chains in the Genus database with same CATH superfamily
2EPOA 4M2ZA 4LF5E 2DB2A 2MC6A 4JI7E 5F3WA 2A25A 2LV2A 5AC5A 1ZAAC 2VRDA 4DUYE 2EN1A 1G2DC 2EPCA 3JU0A 1B69A 5T6JA 2DLKA 1N33E 3THNA 4N4RB 2L2NA 4LF9E 2EOXA 1YUIA 2L33A 2EL5A 5IT9C 2EPAA 3MSWA 2WCC3 4RHBB 3MHHC 2JXPA 1MEYC 1X49A 2HJJA 2LT7A 2G7HA 3J7Yp 3EPHA 4BMJA 3DJWA 2GPIA 2LCEA 1HNXE 2EOYA 2EMCA 2UXDE 4WPYA 2YRKA 2WBUA 4DV0E 2EOSA 4O43A 5CFFE 4F9BB 2WZOA 4DR2E 2CT1A 2EQ0A 4DUZE 1AH5A 1NCSA 4O4KA 4WYQB 2EN7A 2DMIA 2FTXB 1X6HA 1A1HA 2EOFA 4GEQB 1YYOA 4IS1C 1EKZA 1RC7A 2EPZA 4LF8E 4HEIA 2EPKX 5DNYA 4R03A 1BB8A 1X47A 1N32E 2B3TB 2L92A 4F54A 2ODRC 2VF1A 3VHTB 4OX9E 4NXME 1TF6A 2B7TA 2KONA 5FLXC 5A2QC 2UXBE 1QU6A 2EMZA 4MLQA 2ODRD 2LTRA 3VYXA 2EL6A 4JI1E 2EQ1A 2JOBA 4ZYHA 3KWRA 5IXMB 1ZBTA 2EMYA 3EPJA 1UBDC 2YTGA 2JR1A 1YUJA 1KJKA 2EOZA 4NHRA 4F6MA 1YYWA 1L4SA 1QNTA 2F4VE 2JYAA 2NABA 2YRHA 4R2EA 2RS6A 2LO3A 1IQOA 2L3CA 5A6BD 1TF3A 1YPNA 2EOMA 4L8NA 1Z1BA 2EPXA 2EPMX 5KL6A 2EMGA 5LL6R 2EMWA 4WSGA 2EN8A 2EM4A 2MDGA 4ZYDA 2HHHE 3DF6A 4BHCA 3EQ1A 5IV8B 2EMAA 3TQMA 2L3JA 5KL7A 4OOGC 3F6HA 2NUFA 2YSOA 2JPAA 3ADJA 2YTNA 2EM8A 4B3SE 2YTDA 4JI6E 2PRTA 1AAYA 2HC5A 1UN6B 2EMLA 1T38A 3VK6A 1A1FA 1GZ6A 2RPCA 1KYQA 3HPZA 4DV3E 1UILA 2YTPA 4GZNC 3AUZA 4GKKE 2MKDA 4LU9A 2DMYA 2H36X 3L00A 2M7QA 1T39A 4DV6E 2E1MA 5LLQA 1N36E 1O0WA 4F9AB 4DV2E 2UXCE 2DGCA 2EPRA 5KL3A 4R2PA 2D9HA 2E5LE 4IJDA 5A6KA 2L2MA 4X65E 1HNWE 2NUEA 4HTGA 4M30A 1WJPA 3F6GA 4DV7E 4BBYA 4DMIA 2MKNA 4P7DA 4O24A 2LTSA 5LMUE 4O5GA 2RQLA 2UUBE 3ECRA 2NUGA 3ADLA 2EOIA 4F2JC 1HNZE 2YTIA 1WHNA 2VE7C 4LFAE 5BR8E 4LF4E 1A1IA 4LF6E 4WXDA 1T4OA 4Q28A 1GQEA 4F6NA 2V83A 3FIGA 4ZYGA 1A1JA 2V87A 4B3TE 2L2KB 1UHZA 2YSPA 1WRJA 2ADRA 2V8QB 2YZTA 1X6EA 4NZVA 2RS7A 2EM9A 3IWDA 2V85A 4LF7E 3LMLA 5ADZA 1J5EE 2EWLA 4DR4E 3BIDA 4DR3E 1FJGE 2EOEA 2LRSA 2DIXA 5AE1A 4Q35B 3ADGA 3EPKA 2JVAA 5KL5A 2UUAE 1IMUA 2KHXA 1RMDA 3IWBA 5KL2A 1A1GA 1G2FC 2YTFA 4LFBE 2M1SA 2Q8UA 1PJQA 3C4TA 3RMPA 5AE3A 4R2RA 4DR1E 4R2CA 2F8BA 3QG5C 2YTEA 4DV5E 1MGTA 4JI5E 3ZOQB 2R1FA 1GTKA 3P1XA 4NXNE 1BBGA 4LFCE 2CPNA 5A6JA 4JI8E 2DRPA 2LVHA 1JK2A 2ELYA 4BC7A 1XNRE 2EMKA 5AC4A 4X62E 1JK1A 2ENAA 4J8ZA 5IWAE 3THOB 3J81C 4TUIA 2UU9E 1A1KA 2EQ3A 2RSMA 2EM2A 4R2AA 2EM3A 2L6MA 4LTYA 2M4IA 3T1YE 1SR9A 1N34E 1I94E 2GLIA 4K0KE 1SFEA 2ENHA 2WBTA 3JAMC 2CTDA 2YTOA 2J7JA 3OTOE 5A6AA 4DV4E 1J26A 2N3HA 5LMNE 2YT4A 1N3GA 2EORA 3H09A 4X9JA 4L5NC 3BF2A 2R76A 1BBOA 1NEIA 5A6BA 1X5WA 1PJSA 2BB8A 2N3GA 2EOOA 1XMOE 4JYAE 2EMIA 2B9DA 2LJHA 2IHR1 4WFTA 2CSHA 2DSYA 4YHHE 2EMBA 3C4BA 2VQFE 1EH7A 1HR0E 4AQYE 2EM7A 2EM6A 4JI4E 3J80C 4JI3E 4WXCA 4DV1E 1XMQE 2GHFA 3JTZA 3IWCA 4P78A 2YTQA 2EE8A 1EH8A 1DI2A 2YWQA 1YSAC 1T4NA 2LJUA 1DQ3A 2JP9A 2LBSB 3C6MA 1X48A 4KZSA 1P47A 2FV4B 1XNQE 2E72A 4R2DA 2RTXA 1IBLE 1PKPA 4FK5C 2EPLX 1ZU1A 2EMFA 2ENCA 4R2SA 3AV0A 3OMLA 3BGHA 2I13A 2EN3A 1X6FA 2UUCE 1IBME 3ADIA 2BBGA 4JI0E 1PJTA 1A1LA 4JI2E 2EM5A 4KHPE 5TSEA 4YY3E 2EMXA 2K4VA 1LLMC 2EOJA 2EL4A 4TUGA 2JY9A 2MC5A 3K6QA 4BS9A 2I9IA 4B3ME 4GKJE 2NA2A 4RH8A 1YFHA 4MLVA 3HXLA 4KWYA 2EN6A 2JWOA 3KZZA 2M9AA 3MHSC 4DR6E 2LUQA 2VQEE 1IQSA 4M0VA 4BHBA 2EPUA 2EOQA 1ZBQA 4I8OA 1T4LB 2YTJA 2EM0A 3HTXA 2EP3A 2ELZA 2EPPA 2YPNA 1ZR9A 5AASA 1PDAA 5A69A 3VYYA 1DGCA 3BBGA 5KL4A 3EPLA 2EMHA 3M99B 4BCAA 2YU5A 4R8OA 4B3RE 4F9CB 2DLQA 1STUA 2V89A 4DR7E 1EH6A 2KOUA 3UK3C 2EN2A 3KZYA 2B7VA 2FGGA 2V86A 4X64E 3HQ1A 2EN4A 1WXRA 2LMZA 2ZM6E 1F2IG 2N8XA 2EPNA 4DKKA 4JV5E 3LLHA 1YYKA 1RQ0A 4M9VC 4ZYEA 2LUPB 4BC9A 5AE2A 1TN9A 4R2QA 2YRMA 3C6KA 3HPSA 2EJ4A 2YU8A 1YZ9A 4WX9A 4WSPA 2WBSA 2V88A 2HGHA 4X8WA 3T1HE 2K7IA 4X66E 2LE2A 1IBKE 2MDRA 2EOHA 1WHQA 2JOXA 1X3CA 1FKAE 3J7AG 2L8TA 4DR5E 2RSIA 2EZ6A
chains in the Genus database with same CATH topology
2KHXA 3IWBA 4M2ZA 2RTXA 1IBLE 1PKPA 4LF5E 2DB2A 2MC6A 4JI7E 5F3WA 4LFBE 2M1SA 2HHHE 3VYXA 3DF6A 3C4TA 3RMPA 5AE3A 4DUYE 3AV0A 2L3JA 4OOGC 4DR1E 3F6HA 3JU0A 3OMLA 2NUFA 2F8BA 5T6JA 3ADJA 1N33E 3ADIA 2UUCE 1IBME 4DV5E 4JI0E 4JI5E 3ZOQB 4B3SE 4JI6E 4JI2E 2L2NA 4LF9E 4KHPE 3P1XA 3VK6A 4NXNE 4LFCE 2L33A 4YY3E 2CPNA 1GZ6A 4JI8E 2K4VA 5IT9C 3HPZA 3MSWA 4DV3E 1UILA 4BC7A 1X49A 4TUGA 1XNRE 3AUZA 2JY9A 4GKKE 4LU9A 2G7HA 2MC5A 3K6QA 4X62E 3J7Yp 2DMYA 2H36X 4BMJA 4BS9A 3DJWA 2M7QA 4B3ME 4GKJE 2NA2A 2E1MA 4DV6E 4J8ZA 1N36E 5IWAE 1HNXE 2UXDE 1O0WA 4F9AB 4DV2E 2UXCE 3HXLA 4WPYA 3J81C 4TUIA 2UU9E 4DV0E 2JWOA 5CFFE 4F9BB 4DR6E 2RSMA 2E5LE 2WZOA 2L2MA 2LUQA 4X65E 2VQEE 4DR2E 1HNWE 2L6MA 4M0VA 4DUZE 2NUEA 4LTYA 4M30A 2M4IA 3F6GA 4DV7E 3T1YE 4BBYA 4WYQB 4DMIA 1SR9A 4P7DA 1N34E 1I94E 1ZBQA 4K0KE 2FTXB 4I8OA 1T4LB 2LTSA 3HTXA 3JAMC 1EKZA 4GEQB 5LMUE 1YYOA 3OTOE 1RC7A 2UUBE 4LF8E 4DV4E 1J26A 5AASA 2N3HA 3VYYA 2NUGA 3ADLA 5DNYA 2YT4A 5LMNE 1HNZE 4R03A 1X47A 3H09A 1WHNA 1N32E 2B3TB 2VE7C 4L5NC 4LFAE 5BR8E 4BCAA 2L92A 4LF4E 4F54A 2ODRC 4R8OA 2VF1A 4OX9E 4NXME 4B3RE 4F9CB 2B7TA 2KONA 1STUA 2V89A 2N3GA 5FLXC 4LF6E 4DR7E 1T4OA 1XMOE 4JYAE 5A2QC 4Q28A 2B9DA 1GQEA 2KOUA 2UXBE 2LJHA 1QU6A 2B7VA 2FGGA 2IHR1 2LTRA 2ODRD 2V86A 3HQ1A 4WFTA 4X64E 2V83A 2DSYA 3FIGA 4YHHE 4JI1E 2JOBA 1WXRA 3KWRA 2LMZA 1ZBTA 2ZM6E 2V87A 3C4BA 2JR1A 2VQFE 1HR0E 4B3TE 4DKKA 4AQYE 2L2KB 1UHZA 4JI4E 1YYWA 3J80C 3LLHA 2F4VE 4JI3E 4JV5E 1YYKA 4DV1E 1RQ0A 1XMQE 3JTZA 3IWCA 2LUPB 4BC9A 2V8QB 2YZTA 5AE2A 2RS6A 4P78A 2RS7A 3HPSA 1DI2A 2L3CA 3IWDA 2V85A 4LF7E 3LMLA 1YZ9A 5ADZA 1J5EE 4L8NA 1T4NA 4WSPA 1DQ3A 2EWLA 2V88A 4DR4E 2LBSB 4DR3E 4X8WA 3T1HE 1FJGE 4X66E 1X48A 2LE2A 1IBKE 2LRSA 2MDRA 5LL6R 1WHQA 4KZSA 2JOXA 2DIXA 1FKAE 2FV4B 5AE1A 2L8TA 3J7AG 3ADGA 4DR5E 1XNQE 2JVAA 2EZ6A 2UUAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHX A;  4M2Z A;  2RTX A;  1IBL E;  1PKP A;  4LF5 E;  2DB2 A;  4JI7 E;  4LFB E;  2HHH E;  3C4T A;  4DUY E;  2L3J A;  4OOG C;  4DR1 E;  2NUF A;  3ADJ A;  1N33 E;  3ADI A;  2UUC E;  1IBM E;  4DV5 E;  4JI0 E;  4JI5 E;  4B3S E;  4JI6 E;  4JI2 E;  2L2N A;  4LF9 E;  4KHP E;  3P1X A;  4NXN E;  4LFC E;  2L33 A;  4YY3 E;  2CPN A;  4JI8 E;  4DV3 E;  1UIL A;  1X49 A;  1XNR E;  4GKK E;  2JY9 A;  4X62 E;  3J7Y p;  2DMY A;  4B3M E;  4GKJ E;  2NA2 A;  4DV6 E;  1N36 E;  1HNX E;  5IWA E;  2UXD E;  1O0W A;  4DV2 E;  2UXC E;  2UU9 E;  4DV0 E;  5CFF E;  4DR6 E;  2RSM A;  2E5L E;  2L2M A;  2LUQ A;  4X65 E;  2VQE E;  4DR2 E;  1HNW E;  4DUZ E;  2NUE A;  4M30 A;  3T1Y E;  4DV7 E;  4WYQ B;  1N34 E;  1I94 E;  4K0K E;  1T4L B;  3HTX A;  2LTS A;  1EKZ A;  1YYO A;  5LMU E;  3OTO E;  1RC7 A;  2UUB E;  4LF8 E;  4DV4 E;  1J26 A;  2N3H A;  3VYY A;  2NUG A;  3ADL A;  5LMN E;  2YT4 A;  1HNZ E;  1X47 A;  1WHN A;  1N32 E;  2B3T B;  4LFA E;  5BR8 E;  4LF4 E;  4OX9 E;  4NXM E;  4B3R E;  2B7T A;  1STU A;  4LF6 E;  2N3G A;  4DR7 E;  1T4O A;  1XMO E;  4JYA E;  1GQE A;  2UXB E;  2LJH A;  1QU6 A;  2B7V A;  2IHR 1;  4WFT A;  2LTR A;  3VYX A;  4X64 E;  4JI1 E;  4YHH E;  2ZM6 E;  1ZBT A;  3C4B A;  2VQF E;  1HR0 E;  4B3T E;  4DKK A;  4AQY E;  2L2K B;  1UHZ A;  4JI4 E;  1YYW A;  4JV5 E;  3LLH A;  2F4V E;  4JI3 E;  1YYK A;  4DV1 E;  1RQ0 A;  1XMQ E;  2LUP B;  2RS6 A;  2RS7 A;  1DI2 A;  2L3C A;  4LF7 E;  1YZ9 A;  1J5E E;  1T4N A;  4DR4 E;  2LBS B;  4DR3 E;  4X8W A;  3T1H E;  1FJG E;  4X66 E;  1X48 A;  1IBK E;  2LRS A;  2MDR A;  1WHQ A;  2DIX A;  1FKA E;  3ADG A;  4DR5 E;  1XNQ E;  2JVA A;  2EZ6 A;  2UUA E; 
#chains in the Genus database with same CATH topology
 2EPO A;  4M2Z A;  4LF5 E;  2DB2 A;  2MC6 A;  4JI7 E;  5F3W A;  2A25 A;  2LV2 A;  5AC5 A;  1ZAA C;  2VRD A;  4DUY E;  2EN1 A;  1G2D C;  2EPC A;  3JU0 A;  1B69 A;  5T6J A;  2DLK A;  1N33 E;  3THN A;  4N4R B;  2L2N A;  4LF9 E;  2EOX A;  1YUI A;  2L33 A;  2EL5 A;  5IT9 C;  2EPA A;  3MSW A;  2WCC 3;  4RHB B;  3MHH C;  2JXP A;  1MEY C;  1X49 A;  2HJJ A;  2LT7 A;  2G7H A;  3J7Y p;  3EPH A;  4BMJ A;  3DJW A;  2GPI A;  2LCE A;  1HNX E;  2EOY A;  2EMC A;  2UXD E;  4WPY A;  2YRK A;  2WBU A;  4DV0 E;  2EOS A;  4O43 A;  5CFF E;  4F9B B;  2WZO A;  4DR2 E;  2CT1 A;  2EQ0 A;  4DUZ E;  1AH5 A;  1NCS A;  4O4K A;  4WYQ B;  2EN7 A;  2DMI A;  2FTX B;  1X6H A;  1A1H A;  2EOF A;  4GEQ B;  1YYO A;  4IS1 C;  1EKZ A;  1RC7 A;  2EPZ A;  4LF8 E;  4HEI A;  2EPK X;  5DNY A;  4R03 A;  1BB8 A;  1X47 A;  1N32 E;  2B3T B;  2L92 A;  4F54 A;  2ODR C;  2VF1 A;  3VHT B;  4OX9 E;  4NXM E;  1TF6 A;  2B7T A;  2KON A;  5FLX C;  5A2Q C;  2UXB E;  1QU6 A;  2EMZ A;  4MLQ A;  2ODR D;  2LTR A;  3VYX A;  2EL6 A;  4JI1 E;  2EQ1 A;  2JOB A;  4ZYH A;  3KWR A;  5IXM B;  1ZBT A;  2EMY A;  3EPJ A;  1UBD C;  2YTG A;  2JR1 A;  1YUJ A;  1KJK A;  2EOZ A;  4NHR A;  4F6M A;  1YYW A;  1L4S A;  1QNT A;  2F4V E;  2JYA A;  2NAB A;  2YRH A;  4R2E A;  2RS6 A;  2LO3 A;  1IQO A;  2L3C A;  5A6B D;  1TF3 A;  1YPN A;  2EOM A;  4L8N A;  1Z1B A;  2EPX A;  2EPM X;  5KL6 A;  2EMG A;  5LL6 R;  2EMW A;  4WSG A;  2EN8 A;  2EM4 A;  2MDG A;  4ZYD A;  2HHH E;  3DF6 A;  4BHC A;  3EQ1 A;  5IV8 B;  2EMA A;  3TQM A;  2L3J A;  5KL7 A;  4OOG C;  3F6H A;  2NUF A;  2YSO A;  2JPA A;  3ADJ A;  2YTN A;  2EM8 A;  4B3S E;  2YTD A;  4JI6 E;  2PRT A;  1AAY A;  2HC5 A;  1UN6 B;  2EML A;  1T38 A;  3VK6 A;  1A1F A;  1GZ6 A;  2RPC A;  1KYQ A;  3HPZ A;  4DV3 E;  1UIL A;  2YTP A;  4GZN C;  3AUZ A;  4GKK E;  2MKD A;  4LU9 A;  2DMY A;  2H36 X;  3L00 A;  2M7Q A;  1T39 A;  4DV6 E;  2E1M A;  5LLQ A;  1N36 E;  1O0W A;  4F9A B;  4DV2 E;  2UXC E;  2DGC A;  2EPR A;  5KL3 A;  4R2P A;  2D9H A;  2E5L E;  4IJD A;  5A6K A;  2L2M A;  4X65 E;  1HNW E;  2NUE A;  4HTG A;  4M30 A;  1WJP A;  3F6G A;  4DV7 E;  4BBY A;  4DMI A;  2MKN A;  4P7D A;  4O24 A;  2LTS A;  5LMU E;  4O5G A;  2RQL A;  2UUB E;  3ECR A;  2NUG A;  3ADL A;  2EOI A;  4F2J C;  1HNZ E;  2YTI A;  1WHN A;  2VE7 C;  4LFA E;  5BR8 E;  4LF4 E;  1A1I A;  4LF6 E;  4WXD A;  1T4O A;  4Q28 A;  1GQE A;  4F6N A;  2V83 A;  3FIG A;  4ZYG A;  1A1J A;  2V87 A;  4B3T E;  2L2K B;  1UHZ A;  2YSP A;  1WRJ A;  2ADR A;  2V8Q B;  2YZT A;  1X6E A;  4NZV A;  2RS7 A;  2EM9 A;  3IWD A;  2V85 A;  4LF7 E;  3LML A;  5ADZ A;  1J5E E;  2EWL A;  4DR4 E;  3BID A;  4DR3 E;  1FJG E;  2EOE A;  2LRS A;  2DIX A;  5AE1 A;  4Q35 B;  3ADG A;  3EPK A;  2JVA A;  5KL5 A;  2UUA E;  1IMU A;  2KHX A;  1RMD A;  3IWB A;  5KL2 A;  1A1G A;  1G2F C;  2YTF A;  4LFB E;  2M1S A;  2Q8U A;  1PJQ A;  3C4T A;  3RMP A;  5AE3 A;  4R2R A;  4DR1 E;  4R2C A;  2F8B A;  3QG5 C;  2YTE A;  4DV5 E;  1MGT A;  4JI5 E;  3ZOQ B;  2R1F A;  1GTK A;  3P1X A;  4NXN E;  1BBG A;  4LFC E;  2CPN A;  5A6J A;  4JI8 E;  2DRP A;  2LVH A;  1JK2 A;  2ELY A;  4BC7 A;  1XNR E;  2EMK A;  5AC4 A;  4X62 E;  1JK1 A;  2ENA A;  4J8Z A;  5IWA E;  3THO B;  3J81 C;  4TUI A;  2UU9 E;  1A1K A;  2EQ3 A;  2RSM A;  2EM2 A;  4R2A A;  2EM3 A;  2L6M A;  4LTY A;  2M4I A;  3T1Y E;  1SR9 A;  1N34 E;  1I94 E;  2GLI A;  4K0K E;  1SFE A;  2ENH A;  2WBT A;  3JAM C;  2CTD A;  2YTO A;  2J7J A;  3OTO E;  5A6A A;  4DV4 E;  1J26 A;  2N3H A;  5LMN E;  2YT4 A;  1N3G A;  2EOR A;  3H09 A;  4X9J A;  4L5N C;  3BF2 A;  2R76 A;  1BBO A;  1NEI A;  5A6B A;  1X5W A;  1PJS A;  2BB8 A;  2N3G A;  2EOO A;  1XMO E;  4JYA E;  2EMI A;  2B9D A;  2LJH A;  2IHR 1;  4WFT A;  2CSH A;  2DSY A;  4YHH E;  2EMB A;  3C4B A;  2VQF E;  1EH7 A;  1HR0 E;  4AQY E;  2EM7 A;  2EM6 A;  4JI4 E;  3J80 C;  4JI3 E;  4WXC A;  4DV1 E;  1XMQ E;  2GHF A;  3JTZ A;  3IWC A;  4P78 A;  2YTQ A;  2EE8 A;  1EH8 A;  1DI2 A;  2YWQ A;  1YSA C;  1T4N A;  2LJU A;  1DQ3 A;  2JP9 A;  2LBS B;  3C6M A;  1X48 A;  4KZS A;  1P47 A;  2FV4 B;  1XNQ E;  2E72 A;  4R2D A;  2RTX A;  1IBL E;  1PKP A;  4FK5 C;  2EPL X;  1ZU1 A;  2EMF A;  2ENC A;  4R2S A;  3AV0 A;  3OML A;  3BGH A;  2I13 A;  2EN3 A;  1X6F A;  2UUC E;  1IBM E;  3ADI A;  2BBG A;  4JI0 E;  1PJT A;  1A1L A;  4JI2 E;  2EM5 A;  4KHP E;  5TSE A;  4YY3 E;  2EMX A;  2K4V A;  1LLM C;  2EOJ A;  2EL4 A;  4TUG A;  2JY9 A;  2MC5 A;  3K6Q A;  4BS9 A;  2I9I A;  4B3M E;  4GKJ E;  2NA2 A;  4RH8 A;  1YFH A;  4MLV A;  3HXL A;  4KWY A;  2EN6 A;  2JWO A;  3KZZ A;  2M9A A;  3MHS C;  4DR6 E;  2LUQ A;  2VQE E;  1IQS A;  4M0V A;  4BHB A;  2EPU A;  2EOQ A;  1ZBQ A;  4I8O A;  1T4L B;  2YTJ A;  2EM0 A;  3HTX A;  2EP3 A;  2ELZ A;  2EPP A;  2YPN A;  1ZR9 A;  5AAS A;  1PDA A;  5A69 A;  3VYY A;  1DGC A;  3BBG A;  5KL4 A;  3EPL A;  2EMH A;  3M99 B;  4BCA A;  2YU5 A;  4R8O A;  4B3R E;  4F9C B;  2DLQ A;  1STU A;  2V89 A;  4DR7 E;  1EH6 A;  2KOU A;  3UK3 C;  2EN2 A;  3KZY A;  2B7V A;  2FGG A;  2V86 A;  4X64 E;  3HQ1 A;  2EN4 A;  1WXR A;  2LMZ A;  2ZM6 E;  1F2I G;  2N8X A;  2EPN A;  4DKK A;  4JV5 E;  3LLH A;  1YYK A;  1RQ0 A;  4M9V C;  4ZYE A;  2LUP B;  4BC9 A;  5AE2 A;  1TN9 A;  4R2Q A;  2YRM A;  3C6K A;  3HPS A;  2EJ4 A;  2YU8 A;  1YZ9 A;  4WX9 A;  4WSP A;  2WBS A;  2V88 A;  2HGH A;  4X8W A;  3T1H E;  2K7I A;  4X66 E;  2LE2 A;  1IBK E;  2MDR A;  2EOH A;  1WHQ A;  2JOX A;  1X3C A;  1FKA E;  3J7A G;  2L8T A;  4DR5 E;  2RSI A;  2EZ6 A; 
#chains in the Genus database with same CATH homology
 2KHX A;  3IWB A;  4M2Z A;  2RTX A;  1IBL E;  1PKP A;  4LF5 E;  2DB2 A;  2MC6 A;  4JI7 E;  5F3W A;  4LFB E;  2M1S A;  2HHH E;  3VYX A;  3DF6 A;  3C4T A;  3RMP A;  5AE3 A;  4DUY E;  3AV0 A;  2L3J A;  4OOG C;  4DR1 E;  3F6H A;  3JU0 A;  3OML A;  2NUF A;  2F8B A;  5T6J A;  3ADJ A;  1N33 E;  3ADI A;  2UUC E;  1IBM E;  4DV5 E;  4JI0 E;  4JI5 E;  3ZOQ B;  4B3S E;  4JI6 E;  4JI2 E;  2L2N A;  4LF9 E;  4KHP E;  3P1X A;  3VK6 A;  4NXN E;  4LFC E;  2L33 A;  4YY3 E;  2CPN A;  1GZ6 A;  4JI8 E;  2K4V A;  5IT9 C;  3HPZ A;  3MSW A;  4DV3 E;  1UIL A;  4BC7 A;  1X49 A;  4TUG A;  1XNR E;  3AUZ A;  2JY9 A;  4GKK E;  4LU9 A;  2G7H A;  2MC5 A;  3K6Q A;  4X62 E;  3J7Y p;  2DMY A;  2H36 X;  4BMJ A;  4BS9 A;  3DJW A;  2M7Q A;  4B3M E;  4GKJ E;  2NA2 A;  2E1M A;  4DV6 E;  4J8Z A;  1N36 E;  5IWA E;  1HNX E;  2UXD E;  1O0W A;  4F9A B;  4DV2 E;  2UXC E;  3HXL A;  4WPY A;  3J81 C;  4TUI A;  2UU9 E;  4DV0 E;  2JWO A;  5CFF E;  4F9B B;  4DR6 E;  2RSM A;  2E5L E;  2WZO A;  2L2M A;  2LUQ A;  4X65 E;  2VQE E;  4DR2 E;  1HNW E;  2L6M A;  4M0V A;  4DUZ E;  2NUE A;  4LTY A;  4M30 A;  2M4I A;  3F6G A;  4DV7 E;  3T1Y E;  4BBY A;  4WYQ B;  4DMI A;  1SR9 A;  4P7D A;  1N34 E;  1I94 E;  1ZBQ A;  4K0K E;  2FTX B;  4I8O A;  1T4L B;  2LTS A;  3HTX A;  3JAM C;  1EKZ A;  4GEQ B;  5LMU E;  1YYO A;  3OTO E;  1RC7 A;  2UUB E;  4LF8 E;  4DV4 E;  1J26 A;  5AAS A;  2N3H A;  3VYY A;  2NUG A;  3ADL A;  5DNY A;  2YT4 A;  5LMN E;  1HNZ E;  4R03 A;  1X47 A;  3H09 A;  1WHN A;  1N32 E;  2B3T B;  2VE7 C;  4L5N C;  4LFA E;  5BR8 E;  4BCA A;  2L92 A;  4LF4 E;  4F54 A;  2ODR C;  4R8O A;  2VF1 A;  4OX9 E;  4NXM E;  4B3R E;  4F9C B;  2B7T A;  2KON A;  1STU A;  2V89 A;  2N3G A;  5FLX C;  4LF6 E;  4DR7 E;  1T4O A;  1XMO E;  4JYA E;  5A2Q C;  4Q28 A;  2B9D A;  1GQE A;  2KOU A;  2UXB E;  2LJH A;  1QU6 A;  2B7V A;  2FGG A;  2IHR 1;  2LTR A;  2ODR D;  2V86 A;  3HQ1 A;  4WFT A;  4X64 E;  2V83 A;  2DSY A;  3FIG A;  4YHH E;  4JI1 E;  2JOB A;  1WXR A;  3KWR A;  2LMZ A;  1ZBT A;  2ZM6 E;  2V87 A;  3C4B A;  2JR1 A;  2VQF E;  1HR0 E;  4B3T E;  4DKK A;  4AQY E;  2L2K B;  1UHZ A;  4JI4 E;  1YYW A;  3J80 C;  3LLH A;  2F4V E;  4JI3 E;  4JV5 E;  1YYK A;  4DV1 E;  1RQ0 A;  1XMQ E;  3JTZ A;  3IWC A;  2LUP B;  4BC9 A;  2V8Q B;  2YZT A;  5AE2 A;  2RS6 A;  4P78 A;  2RS7 A;  3HPS A;  1DI2 A;  2L3C A;  3IWD A;  2V85 A;  4LF7 E;  3LML A;  1YZ9 A;  5ADZ A;  1J5E E;  4L8N A;  1T4N A;  4WSP A;  1DQ3 A;  2EWL A;  2V88 A;  4DR4 E;  2LBS B;  4DR3 E;  4X8W A;  3T1H E;  1FJG E;  4X66 E;  1X48 A;  2LE2 A;  1IBK E;  2LRS A;  2MDR A;  5LL6 R;  1WHQ A;  4KZS A;  2JOX A;  2DIX A;  1FKA E;  2FV4 B;  5AE1 A;  2L8T A;  3J7A G;  3ADG A;  4DR5 E;  1XNQ E;  2JVA A;  2EZ6 A;  2UUA E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...