1UHZA

Solution structure of dsrna binding domain in staufen homolog 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
GSSGSSGPISRLAQIQQARKEKEPDYILLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTSLQDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords staufen (RNA binding protein) homolog 2
publication title Solution structure of dsRNA binding domain in Staufen homolog 2
rcsb
source organism Mus musculus
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1uhzA00
2L33A 2LRSA 1HNXE 2L2MA 4DR6E 1IBLE 2RS7A 1PKPA 2MDRA 5LMNE 2NA2A 4DV2E 1N33E 2L3CA 2HHHE 1XMOE 4K0KE 4B3RE 4JYAE 1FKAE 2RSMA 1XMQE 3ADLA 4X65E 4OX9E 1T4OA 4X64E 1IBME 4JI1E 2LUQA 2UUBE 4GKJE 2UXDE 2NUGA 2B3TB 1T4LB 4LFCE 2E5LE 2ZM6E 4DUZE 3LLHA 3T1HE 2IHR1 4X8WA 2NUEA 1T4NA 1RQ0A 1WHQA 4WFTA 2UUCE 2NUFA 1RC7A 2CPNA 2UU9E 1XNRE 1QU6A 2UXBE 1FJGE 4WYQB 1XNQE 2B7VA 2JVAA 2RS6A 4JI2E 1EKZA 3C4BA 4DR7E 1J5EE 4DV1E 2L3JA 4DV0E 1UILA 2VQEE 2LUPB 4LF5E 2DMYA 2LTSA 3C4TA 4DV4E 1X48A 1DI2A 5CFFE 2UXCE 2B7TA 4JI0E 2LTRA 3ADJA 4DR2E 1N36E 1J26A 4B3SE 2EZ6A 1N34E 3VYYA 4JI7E 5LMUE 1UHZA 4AQYE 1WHNA 3P1XA 2VQFE 1HNZE 1YYKA 4LF8E 3OTOE 2L2KB 4OOGC 4LF9E 4DV5E 4JV5E 4NXME 4DKKA 4JI5E 1O0WA 4B3TE 4LFBE 2LJHA 1GQEA 4YHHE 1I94E 3ADGA 2RTXA 1IBKE 4DR4E 4NXNE 2JY9A 1N32E 1STUA 4B3ME 3ADIA 2L2NA 3VYXA 4DR3E 2N3HA 1YZ9A 4GKKE 3J7Yp 1X49A 2N3GA 5BR8E 3T1YE 2UUAE 4LFAE 5IWAE 4JI8E 4DR5E 2DB2A 4JI3E 3HTXA 1HNWE 4JI4E 2F4VE 2KHXA 4DR1E 4LF4E 4DUYE 1ZBTA 4LF6E 1HR0E 4DV3E 1YYOA 4YY3E 4M2ZA 4X62E 4JI6E 4DV7E 2LBSB 4X66E 4LF7E 2YT4A 2DIXA 1YYWA 4DV6E 1X47A 4KHPE 4M30A
chains in the Genus database with same CATH superfamily
2L33A 3IWDA 5AC5A 4DR6E 2L2MA 5LLQA 5LMNE 2EOFA 2YSPA 2V8QB 3K6QA 4B3RE 3FIGA 4JYAE 4F6MA 1GZ6A 4MLQA 3HPSA 4OX9E 2EMAA 4X64E 3EPKA 2I13A 3DF6A 3J80C 2UUBE 2UXDE 3MSWA 2NUGA 2EPOA 4R03A 2G7HA 2V87A 2GHFA 2LE2A 4R2PA 4X8WA 3MHHC 1T4NA 2EPCA 3KWRA 3EPJA 2EOXA 2EQ0A 1ZAAC 2CPNA 2D9HA 2UU9E 1A1LA 1QU6A 1YFHA 4TUIA 2V89A 3C4BA 2EOZA 5A2QC 2E72A 2L3JA 1P47A 2EN8A 2L92A 2WBUA 4LF5E 1LLMC 2JWOA 2EMKA 1X48A 2YTEA 2YPNA 2M1SA 2CSHA 3M99B 1J26A 1X5WA 4BMJA 1N34E 2YTQA 3AUZA 4JI7E 3C6KA 4WPYA 1BBGA 1Z1BA 4AQYE 1DGCA 2EN4A 2YTOA 4ZYDA 3OTOE 4R2CA 1A1HA 4DV5E 1YUIA 2EOQA 2KOUA 4JV5E 4DKKA 4JI5E 4B3TE 4LFBE 2EQ1A 1GQEA 3IWCA 4WSPA 1IMUA 4YHHE 2LO3A 1X6HA 2L8TA 4NXNE 1N32E 3HPZA 1STUA 2EOMA 4ZYEA 3QG5C 1L4SA 5BR8E 2R76A 4LFAE 4DR5E 2DB2A 4JI3E 4DMIA 2WBSA 3KZYA 2KHXA 4F9CB 4DR1E 2RQLA 2K4VA 2DGCA 1ZBTA 1A1GA 2EM3A 4DV3E 3J7AG 1F2IG 3VK6A 1T39A 4JI6E 2YWQA 3HQ1A 4X66E 3LMLA 4TUGA 2EN1A 4MLVA 1X47A 1A1IA 4KHPE 4R2RA 3BF2A 2LCEA 5IV8B 1HNXE 3EPLA 2I9IA 2RS7A 1NEIA 4F2JC 2HHHE 1X6FA 4K0KE 1GTKA 2YTDA 1A1JA 2ODRD 2RSMA 5KL6A 1UBDC 5F3WA 2KONA 2LUQA 2MDGA 2ENHA 1T38A 1YUJA 4GKJE 2ODRC 2ELYA 5T6JA 1G2FC 1TF6A 2NUEA 4WFTA 1RC7A 2YTGA 2EOYA 5A6BA 1KJKA 2RS6A 4JI2E 4O24A 2LV2A 1JK1A 3ECRA 4I8OA 2VQEE 2LUPB 2WCC3 1G2DC 1IQOA 2LTSA 3C4TA 1DI2A 1A1KA 2UXCE 1IQSA 2EOHA 2LT7A 2ENAA 2V83A 2VRDA 1BBOA 2LTRA 4DR2E 2J7JA 2EMIA 2EM6A 2HGHA 3MHSC 4BCAA 2RSIA 2EQ3A 2EMBA 1WHNA 2EMGA 2JPAA 2M9AA 1TN9A 4LF8E 1YYKA 4BC7A 3THOB 4LF9E 2R1FA 2BB8A 4Q28A 2EWLA 3BBGA 4WXCA 1O0WA 4RH8A 2MKNA 2L6MA 1I94E 2EM8A 5KL7A 4LTYA 1TF3A 1IBKE 2JY9A 3ADIA 1NCSA 2L2NA 3VYXA 4GKKE 2DSYA 1EH7A 3J7Yp 5AE1A 2EPAA 3T1YE 2UUAE 4WSGA 4WX9A 2EL6A 4ZYHA 2EPKX 1A1FA 2EE8A 5A6BD 3RMPA 4LF4E 2YTJA 1AH5A 4YY3E 4F9AB 4GEQB 4X62E 2EN7A 4DV7E 2K7IA 4O5GA 3OMLA 4R2AA 2EM7A 2YRHA 3AV0A 3J81C 3F6GA 4IJDA 3F6HA 1MGTA 1PKPA 2MDRA 1N33E 3HXLA 2EMFA 2L3CA 2N8XA 3ZOQB 1FKAE 4O43A 4X65E 1DQ3A 2F8BA 1T4OA 5FLXC 4HTGA 4JI1E 2ELZA 4IS1C 4R2QA 2CT1A 2EPNA 2YRMA 4R2SA 2LMZA 1PJTA 1T4LB 1JK2A 2E5LE 5KL3A 2ZM6E 4HEIA 2IHR1 4L5NC 2ENCA 1RQ0A 1WHQA 2YTPA 4WXDA 2EN3A 2A25A 2EM9A 1XNRE 4NHRA 2DLKA 4F54A 2UXBE 4R2EA 4WYQB 3BGHA 2B7VA 1EKZA 4DR7E 1J5EE 4DV0E 2DMYA 4DV4E 1ZBQA 1AAYA 2YZTA 3H09A 2PRTA 2B7TA 4JI0E 4F6NA 1N36E 1B69A 2FV4B 2EZ6A 5LL6R 1UN6B 2EOOA 2LVHA 2EP3A 2YTIA 5LMUE 5AC4A 2VE7C 2JOXA 4J8ZA 1BB8A 1ZR9A 2YTFA 3P1XA 2VQFE 2EPZA 2YRKA 5IXMB 4FK5C 2YU5A 3EQ1A 2CTDA 2VF1A 2L2KB 4OOGC 1PJQA 4BC9A 2WBTA 2Q8UA 2LJHA 5A6AA 3ADGA 5TSEA 2NABA 2EM5A 4P7DA 2EM4A 4R2DA 5AE3A 4B3ME 1WRJA 1SFEA 1YZ9A 3BIDA 4L8NA 3C6MA 4JI8E 2JR1A 2B9DA 4M0VA 2V86A 1HNWE 2DLQA 2EMHA 2F4VE 4ZYGA 1KYQA 2EM0A 2EOIA 2E1MA 3THNA 1EH8A 1YYOA 4BHCA 1PDAA 2JXPA 2LBSB 1RMDA 2BBGA 2EPRA 4LF7E 2MC6A 2YT4A 1PJSA 2EOJA 4DV6E 2YU8A 2EMZA 4Q35B 2EMCA 1EH6A 2EN6A 1WJPA 1X6EA 2LRSA 1IBLE 2JOBA 5ADZA 2EMWA 2LJUA 2V88A 4DV2E 2NA2A 2EM2A 5DNYA 1XMOE 3IWBA 5A69A 1XMQE 3ADLA 3DJWA 1IBME 2EPLX 5KL5A 1ZU1A 3JTZA 1YSAC 2MKDA 2FGGA 2M7QA 5A6JA 2B3TB 2EOSA 4LFCE 1QNTA 2HJJA 4DUZE 2M4IA 3LLHA 3T1HE 2ADRA 2UUCE 4X9JA 2NUFA 3L00A 1WXRA 1MEYC 2EPMX 1FJGE 1XNQE 2JVAA 4KZSA 2RPCA 3JAMC 3VHTB 4DV1E 3TQMA 4M9VC 1UILA 4BBYA 2EPXA 2YSOA 2EMLA 4BS9A 1N3GA 2H36X 5CFFE 2JP9A 3EPHA 3ADJA 4RHBB 2V85A 2EN2A 4N4RB 4O4KA 4LU9A 4B3SE 4F9BB 3VYYA 1UHZA 1SR9A 4GZNC 2EL5A 1HNZE 4P78A 5AE2A 4R8OA 2EJ4A 4NXME 2GLIA 5AASA 2YTNA 1X3CA 2EMXA 5KL2A 2RTXA 2EORA 1YPNA 2HC5A 4DR4E 5A6KA 2DMIA 2EPPA 4DR3E 2N3HA 2MC5A 2GPIA 1X49A 2N3GA 3JU0A 4BHBA 5KL4A 5IWAE 3UK3C 3HTXA 2EPUA 4JI4E 2EMYA 3KZZA 4DUYE 4LF6E 1HR0E 2FTXB 2EL4A 2JYAA 4M2ZA 2WZOA 5IT9C 4KWYA 2EOEA 4NZVA 2DIXA 1YYWA 2DRPA 4M30A
chains in the Genus database with same CATH topology
3AV0A 2L33A 3IWDA 2LRSA 1HNXE 2L2MA 4DR6E 3J81C 3F6GA 1IBLE 2JOBA 3F6HA 2RS7A 1PKPA 5ADZA 2MDRA 2V88A 2NA2A 3HXLA 5LMNE 2L3CA 4DV2E 1N33E 5DNYA 2HHHE 3ZOQB 1XMOE 2V8QB 3K6QA 3IWBA 4B3RE 4K0KE 3FIGA 4JYAE 1GZ6A 2ODRD 2RSMA 1FKAE 1XMQE 3ADLA 4X65E 1DQ3A 3DJWA 2F8BA 3HPSA 4OX9E 1T4OA 5FLXC 4X64E 3DF6A 1IBME 5F3WA 2KONA 3JTZA 2LUQA 4JI1E 3J80C 2UUBE 4GKJE 2UXDE 2FGGA 3MSWA 2M7QA 2NUGA 2ODRC 2B3TB 2LMZA 4R03A 1T4LB 2G7HA 4LFCE 2V87A 2E5LE 2ZM6E 2LE2A 2M4IA 3LLHA 2IHR1 5T6JA 4L5NC 4DUZE 3T1HE 4X8WA 2NUEA 1T4NA 1RQ0A 1WHQA 4WFTA 3KWRA 2UUCE 2NUFA 1RC7A 2CPNA 2UU9E 1XNRE 1QU6A 1WXRA 4F54A 2UXBE 1FJGE 4WYQB 1XNQE 2B7VA 2JVAA 2RS6A 4KZSA 1EKZA 4JI2E 3JAMC 4TUIA 2V89A 3C4BA 4DR7E 1J5EE 4DV1E 5A2QC 2L3JA 4DV0E 1UILA 2L92A 4I8OA 4BBYA 2VQEE 2LUPB 4LF5E 2JWOA 2DMYA 2LTSA 3C4TA 1ZBQA 1X48A 2YZTA 4BS9A 3H09A 4DV4E 1DI2A 2H36X 5CFFE 2M1SA 2UXCE 2B7TA 2V83A 4JI0E 2LTRA 3ADJA 4DR2E 2V85A 1N36E 4BMJA 1J26A 2FV4B 4LU9A 4B3SE 5LL6R 2EZ6A 1N34E 4F9BB 3VYYA 3AUZA 4BCAA 4JI7E 4WPYA 5LMUE 1UHZA 2VE7C 2JOXA 4J8ZA 1SR9A 4AQYE 1WHNA 3P1XA 2VQFE 1HNZE 4P78A 5AE2A 1YYKA 4LF8E 3OTOE 4BC7A 2VF1A 2L2KB 4OOGC 4R8OA 4BC9A 4DV5E 4LF9E 2KOUA 4JV5E 4Q28A 4NXME 2EWLA 4DKKA 4JI5E 1O0WA 4B3TE 4LFBE 5AASA 2LJHA 1GQEA 2L6MA 3IWCA 4WSPA 4YHHE 1I94E 3ADGA 2RTXA 4LTYA 1IBKE 2L8TA 4P7DA 4NXNE 2JY9A 3HPZA 1STUA 5AE3A 4B3ME 1N32E 3ADIA 4DR4E 2L2NA 3VYXA 4DR3E 2N3HA 1YZ9A 2DSYA 4GKKE 2MC5A 3J7Yp 1X49A 5AE1A 2N3GA 4L8NA 5BR8E 3T1YE 2UUAE 3JU0A 4LFAE 5IWAE 4JI8E 4DR5E 2DB2A 4JI3E 2JR1A 3HTXA 2B9DA 4M0VA 2V86A 1HNWE 4JI4E 4DMIA 2F4VE 2KHXA 4F9CB 4DR1E 2K4VA 3RMPA 4LF4E 4DUYE 2E1MA 1ZBTA 4LF6E 1HR0E 3J7AG 4DV3E 2FTXB 1YYOA 4YY3E 4F9AB 4M2ZA 2WZOA 4GEQB 3VK6A 4X62E 5IT9C 4JI6E 4DV7E 2LBSB 3HQ1A 4X66E 3LMLA 4TUGA 4LF7E 2MC6A 2DIXA 2YT4A 1YYWA 3OMLA 4DV6E 1X47A 4KHPE 4M30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L33 A;  2LRS A;  1HNX E;  2L2M A;  4DR6 E;  1IBL E;  2RS7 A;  1PKP A;  2MDR A;  5LMN E;  2NA2 A;  4DV2 E;  1N33 E;  2L3C A;  2HHH E;  1XMO E;  4K0K E;  4B3R E;  4JYA E;  1FKA E;  2RSM A;  1XMQ E;  3ADL A;  4X65 E;  4OX9 E;  1T4O A;  4X64 E;  1IBM E;  4JI1 E;  2LUQ A;  2UUB E;  4GKJ E;  2UXD E;  2NUG A;  2B3T B;  1T4L B;  4LFC E;  2E5L E;  2ZM6 E;  4DUZ E;  3LLH A;  3T1H E;  2IHR 1;  4X8W A;  2NUE A;  1T4N A;  1RQ0 A;  1WHQ A;  4WFT A;  2UUC E;  2NUF A;  1RC7 A;  2CPN A;  2UU9 E;  1XNR E;  1QU6 A;  2UXB E;  1FJG E;  4WYQ B;  1XNQ E;  2B7V A;  2JVA A;  2RS6 A;  4JI2 E;  1EKZ A;  3C4B A;  4DR7 E;  1J5E E;  4DV1 E;  2L3J A;  4DV0 E;  1UIL A;  2VQE E;  2LUP B;  4LF5 E;  2DMY A;  2LTS A;  3C4T A;  4DV4 E;  1X48 A;  1DI2 A;  5CFF E;  2UXC E;  2B7T A;  4JI0 E;  2LTR A;  3ADJ A;  4DR2 E;  1N36 E;  1J26 A;  4B3S E;  2EZ6 A;  1N34 E;  3VYY A;  4JI7 E;  5LMU E;  1UHZ A;  4AQY E;  1WHN A;  3P1X A;  2VQF E;  1HNZ E;  1YYK A;  4LF8 E;  3OTO E;  2L2K B;  4OOG C;  4LF9 E;  4DV5 E;  4JV5 E;  4NXM E;  4DKK A;  4JI5 E;  1O0W A;  4B3T E;  4LFB E;  2LJH A;  1GQE A;  4YHH E;  1I94 E;  3ADG A;  2RTX A;  1IBK E;  4DR4 E;  4NXN E;  2JY9 A;  1N32 E;  1STU A;  4B3M E;  3ADI A;  2L2N A;  3VYX A;  4DR3 E;  2N3H A;  1YZ9 A;  4GKK E;  3J7Y p;  1X49 A;  2N3G A;  5BR8 E;  3T1Y E;  2UUA E;  4LFA E;  5IWA E;  4JI8 E;  4DR5 E;  2DB2 A;  4JI3 E;  3HTX A;  1HNW E;  4JI4 E;  2F4V E;  2KHX A;  4DR1 E;  4LF4 E;  4DUY E;  1ZBT A;  4LF6 E;  1HR0 E;  4DV3 E;  1YYO A;  4YY3 E;  4M2Z A;  4X62 E;  4JI6 E;  4DV7 E;  2LBS B;  4X66 E;  4LF7 E;  2YT4 A;  2DIX A;  1YYW A;  4DV6 E;  1X47 A;  4KHP E;  4M30 A; 
#chains in the Genus database with same CATH topology
 2L33 A;  3IWD A;  5AC5 A;  4DR6 E;  2L2M A;  5LLQ A;  5LMN E;  2EOF A;  2YSP A;  2V8Q B;  3K6Q A;  4B3R E;  3FIG A;  4JYA E;  4F6M A;  1GZ6 A;  4MLQ A;  3HPS A;  4OX9 E;  2EMA A;  4X64 E;  3EPK A;  2I13 A;  3DF6 A;  3J80 C;  2UUB E;  2UXD E;  3MSW A;  2NUG A;  2EPO A;  4R03 A;  2G7H A;  2V87 A;  2GHF A;  2LE2 A;  4R2P A;  4X8W A;  3MHH C;  1T4N A;  2EPC A;  3KWR A;  3EPJ A;  2EOX A;  2EQ0 A;  1ZAA C;  2CPN A;  2D9H A;  2UU9 E;  1A1L A;  1QU6 A;  1YFH A;  4TUI A;  2V89 A;  3C4B A;  2EOZ A;  5A2Q C;  2E72 A;  2L3J A;  1P47 A;  2EN8 A;  2L92 A;  2WBU A;  4LF5 E;  1LLM C;  2JWO A;  2EMK A;  1X48 A;  2YTE A;  2YPN A;  2M1S A;  2CSH A;  3M99 B;  1J26 A;  1X5W A;  4BMJ A;  1N34 E;  2YTQ A;  3AUZ A;  4JI7 E;  3C6K A;  4WPY A;  1BBG A;  1Z1B A;  4AQY E;  1DGC A;  2EN4 A;  2YTO A;  4ZYD A;  3OTO E;  4R2C A;  1A1H A;  4DV5 E;  1YUI A;  2EOQ A;  2KOU A;  4JV5 E;  4DKK A;  4JI5 E;  4B3T E;  4LFB E;  2EQ1 A;  1GQE A;  3IWC A;  4WSP A;  1IMU A;  4YHH E;  2LO3 A;  1X6H A;  2L8T A;  4NXN E;  1N32 E;  3HPZ A;  1STU A;  2EOM A;  4ZYE A;  3QG5 C;  1L4S A;  5BR8 E;  2R76 A;  4LFA E;  4DR5 E;  2DB2 A;  4JI3 E;  4DMI A;  2WBS A;  3KZY A;  2KHX A;  4F9C B;  4DR1 E;  2RQL A;  2K4V A;  2DGC A;  1ZBT A;  1A1G A;  2EM3 A;  4DV3 E;  3J7A G;  1F2I G;  3VK6 A;  1T39 A;  4JI6 E;  2YWQ A;  3HQ1 A;  4X66 E;  3LML A;  4TUG A;  2EN1 A;  4MLV A;  1X47 A;  1A1I A;  4KHP E;  4R2R A;  3BF2 A;  2LCE A;  5IV8 B;  1HNX E;  3EPL A;  2I9I A;  2RS7 A;  1NEI A;  4F2J C;  2HHH E;  1X6F A;  4K0K E;  1GTK A;  2YTD A;  1A1J A;  2ODR D;  2RSM A;  5KL6 A;  1UBD C;  5F3W A;  2KON A;  2LUQ A;  2MDG A;  2ENH A;  1T38 A;  1YUJ A;  4GKJ E;  2ODR C;  2ELY A;  5T6J A;  1G2F C;  1TF6 A;  2NUE A;  4WFT A;  1RC7 A;  2YTG A;  2EOY A;  5A6B A;  1KJK A;  2RS6 A;  4JI2 E;  4O24 A;  2LV2 A;  1JK1 A;  3ECR A;  4I8O A;  2VQE E;  2LUP B;  2WCC 3;  1G2D C;  1IQO A;  2LTS A;  3C4T A;  1DI2 A;  1A1K A;  2UXC E;  1IQS A;  2EOH A;  2LT7 A;  2ENA A;  2V83 A;  2VRD A;  1BBO A;  2LTR A;  4DR2 E;  2J7J A;  2EMI A;  2EM6 A;  2HGH A;  3MHS C;  4BCA A;  2RSI A;  2EQ3 A;  2EMB A;  1WHN A;  2EMG A;  2JPA A;  2M9A A;  1TN9 A;  4LF8 E;  1YYK A;  4BC7 A;  3THO B;  4LF9 E;  2R1F A;  2BB8 A;  4Q28 A;  2EWL A;  3BBG A;  4WXC A;  1O0W A;  4RH8 A;  2MKN A;  2L6M A;  1I94 E;  2EM8 A;  5KL7 A;  4LTY A;  1TF3 A;  1IBK E;  2JY9 A;  3ADI A;  1NCS A;  2L2N A;  3VYX A;  4GKK E;  2DSY A;  1EH7 A;  3J7Y p;  5AE1 A;  2EPA A;  3T1Y E;  2UUA E;  4WSG A;  4WX9 A;  2EL6 A;  4ZYH A;  2EPK X;  1A1F A;  2EE8 A;  5A6B D;  3RMP A;  4LF4 E;  2YTJ A;  1AH5 A;  4YY3 E;  4F9A B;  4GEQ B;  4X62 E;  2EN7 A;  4DV7 E;  2K7I A;  4O5G A;  3OML A;  4R2A A;  2EM7 A;  2YRH A;  3AV0 A;  3J81 C;  3F6G A;  4IJD A;  3F6H A;  1MGT A;  1PKP A;  2MDR A;  1N33 E;  3HXL A;  2EMF A;  2L3C A;  2N8X A;  3ZOQ B;  1FKA E;  4O43 A;  4X65 E;  1DQ3 A;  2F8B A;  1T4O A;  5FLX C;  4HTG A;  4JI1 E;  2ELZ A;  4IS1 C;  4R2Q A;  2CT1 A;  2EPN A;  2YRM A;  4R2S A;  2LMZ A;  1PJT A;  1T4L B;  1JK2 A;  2E5L E;  5KL3 A;  2ZM6 E;  4HEI A;  2IHR 1;  4L5N C;  2ENC A;  1RQ0 A;  1WHQ A;  2YTP A;  4WXD A;  2EN3 A;  2A25 A;  2EM9 A;  1XNR E;  4NHR A;  2DLK A;  4F54 A;  2UXB E;  4R2E A;  4WYQ B;  3BGH A;  2B7V A;  1EKZ A;  4DR7 E;  1J5E E;  4DV0 E;  2DMY A;  4DV4 E;  1ZBQ A;  1AAY A;  2YZT A;  3H09 A;  2PRT A;  2B7T A;  4JI0 E;  4F6N A;  1N36 E;  1B69 A;  2FV4 B;  2EZ6 A;  5LL6 R;  1UN6 B;  2EOO A;  2LVH A;  2EP3 A;  2YTI A;  5LMU E;  5AC4 A;  2VE7 C;  2JOX A;  4J8Z A;  1BB8 A;  1ZR9 A;  2YTF A;  3P1X A;  2VQF E;  2EPZ A;  2YRK A;  5IXM B;  4FK5 C;  2YU5 A;  3EQ1 A;  2CTD A;  2VF1 A;  2L2K B;  4OOG C;  1PJQ A;  4BC9 A;  2WBT A;  2Q8U A;  2LJH A;  5A6A A;  3ADG A;  5TSE A;  2NAB A;  2EM5 A;  4P7D A;  2EM4 A;  4R2D A;  5AE3 A;  4B3M E;  1WRJ A;  1SFE A;  1YZ9 A;  3BID A;  4L8N A;  3C6M A;  4JI8 E;  2JR1 A;  2B9D A;  4M0V A;  2V86 A;  1HNW E;  2DLQ A;  2EMH A;  2F4V E;  4ZYG A;  1KYQ A;  2EM0 A;  2EOI A;  2E1M A;  3THN A;  1EH8 A;  1YYO A;  4BHC A;  1PDA A;  2JXP A;  2LBS B;  1RMD A;  2BBG A;  2EPR A;  4LF7 E;  2MC6 A;  2YT4 A;  1PJS A;  2EOJ A;  4DV6 E;  2YU8 A;  2EMZ A;  4Q35 B;  2EMC A;  1EH6 A;  2EN6 A;  1WJP A;  1X6E A;  2LRS A;  1IBL E;  2JOB A;  5ADZ A;  2EMW A;  2LJU A;  2V88 A;  4DV2 E;  2NA2 A;  2EM2 A;  5DNY A;  1XMO E;  3IWB A;  5A69 A;  1XMQ E;  3ADL A;  3DJW A;  1IBM E;  2EPL X;  5KL5 A;  1ZU1 A;  3JTZ A;  1YSA C;  2MKD A;  2FGG A;  2M7Q A;  5A6J A;  2B3T B;  2EOS A;  4LFC E;  1QNT A;  2HJJ A;  4DUZ E;  2M4I A;  3LLH A;  3T1H E;  2ADR A;  2UUC E;  4X9J A;  2NUF A;  3L00 A;  1WXR A;  1MEY C;  2EPM X;  1FJG E;  1XNQ E;  2JVA A;  4KZS A;  2RPC A;  3JAM C;  3VHT B;  4DV1 E;  3TQM A;  4M9V C;  1UIL A;  4BBY A;  2EPX A;  2YSO A;  2EML A;  4BS9 A;  1N3G A;  2H36 X;  5CFF E;  2JP9 A;  3EPH A;  3ADJ A;  4RHB B;  2V85 A;  2EN2 A;  4N4R B;  4O4K A;  4LU9 A;  4B3S E;  4F9B B;  3VYY A;  1UHZ A;  1SR9 A;  4GZN C;  2EL5 A;  1HNZ E;  4P78 A;  5AE2 A;  4R8O A;  2EJ4 A;  4NXM E;  2GLI A;  5AAS A;  2YTN A;  1X3C A;  2EMX A;  5KL2 A;  2RTX A;  2EOR A;  1YPN A;  2HC5 A;  4DR4 E;  5A6K A;  2DMI A;  2EPP A;  4DR3 E;  2N3H A;  2MC5 A;  2GPI A;  1X49 A;  2N3G A;  3JU0 A;  4BHB A;  5KL4 A;  5IWA E;  3UK3 C;  3HTX A;  2EPU A;  4JI4 E;  2EMY A;  3KZZ A;  4DUY E;  4LF6 E;  1HR0 E;  2FTX B;  2EL4 A;  2JYA A;  4M2Z A;  2WZO A;  5IT9 C;  4KWY A;  2EOE A;  4NZV A;  2DIX A;  1YYW A;  2DRP A;  4M30 A; 
#chains in the Genus database with same CATH homology
 3AV0 A;  2L33 A;  3IWD A;  2LRS A;  1HNX E;  2L2M A;  4DR6 E;  3J81 C;  3F6G A;  1IBL E;  2JOB A;  3F6H A;  2RS7 A;  1PKP A;  5ADZ A;  2MDR A;  2V88 A;  2NA2 A;  3HXL A;  5LMN E;  2L3C A;  4DV2 E;  1N33 E;  5DNY A;  2HHH E;  3ZOQ B;  1XMO E;  2V8Q B;  3K6Q A;  3IWB A;  4B3R E;  4K0K E;  3FIG A;  4JYA E;  1GZ6 A;  2ODR D;  2RSM A;  1FKA E;  1XMQ E;  3ADL A;  4X65 E;  1DQ3 A;  3DJW A;  2F8B A;  3HPS A;  4OX9 E;  1T4O A;  5FLX C;  4X64 E;  3DF6 A;  1IBM E;  5F3W A;  2KON A;  3JTZ A;  2LUQ A;  4JI1 E;  3J80 C;  2UUB E;  4GKJ E;  2UXD E;  2FGG A;  3MSW A;  2M7Q A;  2NUG A;  2ODR C;  2B3T B;  2LMZ A;  4R03 A;  1T4L B;  2G7H A;  4LFC E;  2V87 A;  2E5L E;  2ZM6 E;  2LE2 A;  2M4I A;  3LLH A;  2IHR 1;  5T6J A;  4L5N C;  4DUZ E;  3T1H E;  4X8W A;  2NUE A;  1T4N A;  1RQ0 A;  1WHQ A;  4WFT A;  3KWR A;  2UUC E;  2NUF A;  1RC7 A;  2CPN A;  2UU9 E;  1XNR E;  1QU6 A;  1WXR A;  4F54 A;  2UXB E;  1FJG E;  4WYQ B;  1XNQ E;  2B7V A;  2JVA A;  2RS6 A;  4KZS A;  1EKZ A;  4JI2 E;  3JAM C;  4TUI A;  2V89 A;  3C4B A;  4DR7 E;  1J5E E;  4DV1 E;  5A2Q C;  2L3J A;  4DV0 E;  1UIL A;  2L92 A;  4I8O A;  4BBY A;  2VQE E;  2LUP B;  4LF5 E;  2JWO A;  2DMY A;  2LTS A;  3C4T A;  1ZBQ A;  1X48 A;  2YZT A;  4BS9 A;  3H09 A;  4DV4 E;  1DI2 A;  2H36 X;  5CFF E;  2M1S A;  2UXC E;  2B7T A;  2V83 A;  4JI0 E;  2LTR A;  3ADJ A;  4DR2 E;  2V85 A;  1N36 E;  4BMJ A;  1J26 A;  2FV4 B;  4LU9 A;  4B3S E;  5LL6 R;  2EZ6 A;  1N34 E;  4F9B B;  3VYY A;  3AUZ A;  4BCA A;  4JI7 E;  4WPY A;  5LMU E;  1UHZ A;  2VE7 C;  2JOX A;  4J8Z A;  1SR9 A;  4AQY E;  1WHN A;  3P1X A;  2VQF E;  1HNZ E;  4P78 A;  5AE2 A;  1YYK A;  4LF8 E;  3OTO E;  4BC7 A;  2VF1 A;  2L2K B;  4OOG C;  4R8O A;  4BC9 A;  4DV5 E;  4LF9 E;  2KOU A;  4JV5 E;  4Q28 A;  4NXM E;  2EWL A;  4DKK A;  4JI5 E;  1O0W A;  4B3T E;  4LFB E;  5AAS A;  2LJH A;  1GQE A;  2L6M A;  3IWC A;  4WSP A;  4YHH E;  1I94 E;  3ADG A;  2RTX A;  4LTY A;  1IBK E;  2L8T A;  4P7D A;  4NXN E;  2JY9 A;  3HPZ A;  1STU A;  5AE3 A;  4B3M E;  1N32 E;  3ADI A;  4DR4 E;  2L2N A;  3VYX A;  4DR3 E;  2N3H A;  1YZ9 A;  2DSY A;  4GKK E;  2MC5 A;  3J7Y p;  1X49 A;  5AE1 A;  2N3G A;  4L8N A;  5BR8 E;  3T1Y E;  2UUA E;  3JU0 A;  4LFA E;  5IWA E;  4JI8 E;  4DR5 E;  2DB2 A;  4JI3 E;  2JR1 A;  3HTX A;  2B9D A;  4M0V A;  2V86 A;  1HNW E;  4JI4 E;  4DMI A;  2F4V E;  2KHX A;  4F9C B;  4DR1 E;  2K4V A;  3RMP A;  4LF4 E;  4DUY E;  2E1M A;  1ZBT A;  4LF6 E;  1HR0 E;  3J7A G;  4DV3 E;  2FTX B;  1YYO A;  4YY3 E;  4F9A B;  4M2Z A;  2WZO A;  4GEQ B;  3VK6 A;  4X62 E;  5IT9 C;  4JI6 E;  4DV7 E;  2LBS B;  3HQ1 A;  4X66 E;  3LML A;  4TUG A;  4LF7 E;  2MC6 A;  2DIX A;  2YT4 A;  1YYW A;  3OML A;  4DV6 E;  1X47 A;  4KHP E;  4M30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...