1UHZA

Solution structure of dsrna binding domain in staufen homolog 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
GSSGSSGPISRLAQIQQARKEKEPDYILLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTSLQDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords staufen (RNA binding protein) homolog 2
publication title Solution structure of dsRNA binding domain in Staufen homolog 2
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1uhzA00
4JI2E 2RSMA 2F4VE 2LRSA 2EZ6A 4M2ZA 4LFBE 4DV3E 4LF9E 2UXBE 1XMQE 1T4NA 4YHHE 4B3SE 1YYKA 1N32E 1IBME 1WHNA 1RQ0A 4DV6E 4DUYE 1DI2A 4X66E 4DR4E 4X8WA 4DR5E 1YYWA 4WYQB 4DUZE 4AQYE 1X48A 4X64E 2VQFE 2UUCE 2LTRA 2L2KB 1XNRE 2NUGA 1XMOE 4NXNE 4GKKE 1J26A 4X65E 2DMYA 4K0KE 1UILA 4JI1E 4LF4E 1UHZA 4DR6E 4LF8E 2L2NA 2E5LE 2L3CA 2L2MA 2L33A 4DR2E 2LBSB 2IHR1 1RC7A 4LF5E 2MDRA 5CFFE 2UUAE 2NUEA 2UXCE 5LMUE 1IBLE 4NXME 3VYYA 2NUFA 2CPNA 4DV1E 4DV0E 5LMNE 1EKZA 2LUPB 2RTXA 1N36E 1HNXE 4JYAE 5BR8E 3T1YE 2RS6A 3T1HE 3OTOE 3ADGA 2B7VA 3C4BA 4LFAE 1X49A 2YT4A 1GQEA 4DV7E 4DR1E 1HNWE 1T4OA 4GKJE 1PKPA 2L3JA 1HNZE 3HTXA 3LLHA 3ADLA 4JI5E 4B3ME 1I94E 2HHHE 3J7Yp 2N3GA 4B3TE 3VYXA 3ADIA 3P1XA 1O0WA 4LF6E 1QU6A 1ZBTA 4X62E 1YZ9A 2B3TB 4LF7E 5IWAE 2UUBE 4LFCE 1STUA 4JI8E 1FKAE 1FJGE 4JI0E 1J5EE 4M30A 2VQEE 4DV5E 4DKKA 2N3HA 2B7TA 4DV4E 1IBKE 3C4TA 1T4LB 1HR0E 2KHXA 4DR7E 1YYOA 4JI4E 2NA2A 4OX9E 4JI6E 4DR3E 4YY3E 2DIXA 2JY9A 3ADJA 4KHPE 1N33E 2LUQA 4DV2E 2UU9E 4OOGC 2ZM6E 2LJHA 1XNQE 2UXDE 2LTSA 1X47A 2JVAA 4B3RE 4JI3E 1N34E 4WFTA 4JV5E 1WHQA 2RS7A 2DB2A 4JI7E
chains in the Genus database with same CATH superfamily
1X3CA 2EN3A 4JI2E 2RSMA 4M2ZA 4M0VA 1T4NA 4B3SE 1YYKA 2JXPA 1YPNA 4R2DA 1KJKA 2RSIA 2G7HA 3DF6A 2J7JA 2MKDA 1X48A 1YUJA 1NEIA 2NABA 2EPLX 2JYAA 2K4VA 2DRPA 1TN9A 1QNTA 1YFHA 1A1HA 5KL4A 2L8TA 2YRKA 2EQ1A 1UILA 4JI1E 4LF4E 4LF8E 2L2NA 3J7AG 3KWRA 2VRDA 2EN6A 2LBSB 5T6JA 3BF2A 2UXCE 2NUEA 1L4SA 2FTXB 1IBLE 3MHSC 3VYYA 4P7DA 2V86A 1A1IA 1EKZA 5A6BD 2LUPB 2RTXA 3AV0A 2KONA 4IS1C 2LCEA 2LMZA 4R2CA 3OTOE 2DLKA 1P47A 1X49A 2YT4A 4BMJA 3ECRA 1T4OA 2EPNA 3IWCA 2EOEA 4F9AB 2EMZA 3ZOQB 3KZZA 4B3ME 4LU9A 2EJ4A 2N3GA 4B3TE 5LL6R 2RQLA 1X6FA 2EPMX 3MHHC 5KL2A 4BCAA 4LF6E 1QU6A 2EM2A 2WCC3 1B69A 2MC5A 4WXDA 2WBUA 4RHBB 2EOYA 3J80C 1YZ9A 2B3TB 4ZYDA 3BGHA 4BS9A 2JR1A 1T38A 2EOFA 1BBOA 2N8XA 4DKKA 4R2PA 2LT7A 2YTFA 2EOMA 1GZ6A 2NA2A 2GPIA 2EL6A 4DR3E 2I13A 2YTGA 1X6EA 3EPHA 1MEYC 1TF6A 1IQOA 2ADRA 1YSAC 2EMYA 2EM7A 2EN2A 2EMLA 4WFTA 2YU5A 2DB2A 1IMUA 4LFBE 4MLVA 1XMQE 4YHHE 4I8OA 1WHNA 1RQ0A 2YZTA 5A6KA 5AE2A 5AE1A 2EMBA 1KYQA 2EN7A 1GTKA 4X64E 2VQFE 3EPKA 2LTRA 2L2KB 1WRJA 2EPKX 2V83A 4NXNE 1A1KA 1A1LA 2EM8A 1A1GA 5KL5A 2EN8A 1UHZA 1JK1A 2L3CA 2L33A 4LF5E 1AH5A 5CFFE 2YSPA 4M9VC 4F9CB 4DV1E 2V88A 4DV0E 2FV4B 4R03A 1N36E 1HNXE 2M9AA 2EOJA 4BHBA 2RS6A 3T1HE 2V87A 3C4BA 2EOXA 3BIDA 1PKPA 5AC4A 2E72A 4BBYA 3ADLA 4JI5E 3OMLA 2YRHA 2EOSA 2D9HA 2EM4A 2EN1A 1AAYA 3ADIA 1G2FC 2EL5A 3AUZA 3EPLA 2ELZA 2EQ3A 5A6JA 2HJJA 3KZYA 5IWAE 2BB8A 4F6NA 4JI8E 1FJGE 2JWOA 4JI0E 1ZAAC 2YTNA 5KL3A 4O43A 4DV4E 2EMCA 2Q8UA 1EH6A 1T4LB 1TF3A 1YYOA 1G2DC 4JI4E 4OX9E 2KOUA 2WBSA 4JI6E 2YTQA 2EM9A 2EPZA 2HC5A 2K7IA 2YSOA 3VK6A 4KHPE 1N33E 2YTIA 2V8QB 2ODRD 4NHRA 2DMIA 4GEQB 2EMXA 2LTSA 5IXMB 3M99B 2E1MA 2EMFA 2ENCA 2R1FA 2EQ0A 2RS7A 4JI7E 2BBGA 2FGGA 4NZVA 2EM5A 2EOZA 2I9IA 2YWQA 2EZ6A 2EMHA 3EQ1A 4DV3E 4F54A 4LF9E 1MGTA 2M4IA 4WSGA 2UXBE 4F9BB 1PDAA 2EPCA 1PJSA 4DUYE 4X66E 1YYWA 4DR5E 1EH8A 1N3GA 4WYQB 3H09A 4DUZE 4AQYE 2GLIA 2YPNA 4ZYGA 2UUCE 2EPRA 2DGCA 1XNRE 2NUGA 1XMOE 3RMPA 2LVHA 4GKKE 4WXCA 2H36X 1UBDC 4X65E 2JPAA 4X9JA 4BHCA 3C6KA 2E5LE 1JK2A 4N4RB 4F2JC 5IT9C 4DR2E 3QG5C 4MLQA 2IHR1 2MDRA 1PJTA 3DJWA 2UUAE 5A2QC 5LMUE 4NXME 2CTDA 1A1FA 2YRMA 3JTZA 4P78A 1LLMC 2JOXA 2ODRC 3J81C 2GHFA 2DLQA 4O24A 1DGCA 5A6AA 2LO3A 1HNWE 2YTDA 4DR1E 2EPXA 4GKJE 1WJPA 2L3JA 4IJDA 2A25A 1YUIA 3HTXA 2EE8A 3LLHA 1I94E 2HHHE 4L8NA 1BBGA 4WX9A 5DNYA 5AC5A 1ZBQA 3P1XA 1O0WA 2EPUA 2EORA 5A69A 5F3WA 1ZBTA 2EPOA 3F6GA 2YTEA 3FIGA 5AASA 2UUBE 3MSWA 1FKAE 1J5EE 2V85A 2YTJA 3HQ1A 4M30A 5IV8B 2N3HA 2B7TA 2DSYA 4DR7E 1HR0E 1ZR9A 3THNA 2EOHA 5KL7A 2WZOA 2ENHA 4FK5C 4YY3E 2DIXA 2JY9A 2LE2A 2WBTA 4Q28A 1IQSA 2LUQA 1EH7A 2CSHA 4DV2E 2UU9E 4OOGC 2ZM6E 4L5NC 1XNQE 2JVAA 4ZYEA 1N34E 3L00A 4JV5E 1WHQA 4LTYA 2F4VE 2L6MA 2LRSA 2M7QA 5TSEA 1WXRA 1X5WA 2YTPA 3EPJA 1ZU1A 1IBME 1N32E 4R2AA 3TQMA 3HPZA 4DV6E 4KZSA 1DI2A 4R8OA 4DR4E 4X8WA 1SR9A 3BBGA 2YTOA 4WPYA 4KWYA 2EM0A 2ELYA 3IWDA 4Q35B 3VHTB 2EWLA 1NCSA 2MKNA 2EOOA 1J26A 2DMYA 4K0KE 4DR6E 4R2SA 2EN4A 2EPAA 2L2MA 2EM3A 4HTGA 2B9DA 4BC7A 1RC7A 2L92A 2MC6A 2NUFA 2CPNA 2EOQA 4R2RA 1SFEA 2YU8A 5LMNE 3F6HA 2LV2A 4DMIA 2RPCA 2EM6A 1A1JA 3K6QA 4JYAE 2EPPA 2EMKA 5BR8E 4O5GA 2R76A 3IWBA 3T1YE 1F2IG 2EOIA 2B7VA 2EMGA 3ADGA 5A6BA 4DV7E 4LFAE 1GQEA 2M1SA 3HXLA 4TUIA 2ENAA 5KL6A 1HNZE 2EMAA 5ADZA 4J8ZA 2JP9A 4BC9A 4R2QA 3J7Yp 3VYXA 5AE3A 2F8BA 5FLXC 2EMIA 1X6HA 2VF1A 2EMWA 2MDGA 4GZNC 1T39A 5LLQA 4ZYHA 4X62E 2PRTA 1BB8A 3THOB 4R2EA 4LF7E 2LJUA 4LFCE 3UK3C 1STUA 4O4KA 3C6MA 4F6MA 2VQEE 4DV5E 1Z1BA 1IBKE 3C4TA 3JAMC 2EL4A 2KHXA 2HGHA 2EP3A 4RH8A 1DQ3A 1RMDA 2CT1A 3JU0A 3ADJA 4HEIA 4WSPA 1UN6B 2LJHA 4TUGA 2UXDE 1X47A 4B3RE 2V89A 3LMLA 2VE7C 2JOBA 3HPSA 4JI3E 1PJQA
chains in the Genus database with same CATH topology
2FGGA 4LTYA 4JI2E 2RSMA 2F4VE 2L6MA 2LRSA 2M7QA 2EZ6A 4M2ZA 4LFBE 4DV3E 4F54A 4M0VA 4LF9E 2M4IA 2UXBE 1XMQE 1T4NA 4YHHE 1WXRA 4I8OA 4F9BB 4B3SE 1YYKA 1N32E 1IBME 1WHNA 1RQ0A 2YZTA 3HPZA 4DV6E 4KZSA 2G7HA 4DUYE 1DI2A 4R8OA 5AE2A 5AE1A 4X8WA 4X66E 1SR9A 4DR5E 1YYWA 4DR4E 4WYQB 3DF6A 3H09A 4WPYA 4DUZE 4AQYE 1X48A 3IWDA 4X64E 2VQFE 2UUCE 2LTRA 2L2KB 1XNRE 2K4VA 2NUGA 2EWLA 2V83A 3RMPA 1XMOE 4NXNE 4GKKE 1J26A 2H36X 4X65E 2DMYA 2L8TA 4K0KE 1UILA 4JI1E 4LF4E 1UHZA 4DR6E 4LF8E 2L2NA 2E5LE 3J7AG 3KWRA 2L3CA 2L2MA 2L33A 2B9DA 4DR2E 5IT9C 4BC7A 2LBSB 2IHR1 1RC7A 4LF5E 5T6JA 2L92A 2MDRA 3DJWA 5CFFE 2UUAE 2NUEA 2UXCE 5A2QC 2MC6A 5LMUE 2FTXB 1IBLE 4NXME 3VYYA 4F9CB 3JTZA 4P78A 4P7DA 2NUFA 2CPNA 2V88A 4DV1E 2V86A 4DV0E 5LMNE 2FV4B 2JOXA 3F6HA 4DMIA 2ODRC 1EKZA 4R03A 2LUPB 3J81C 2RTXA 3AV0A 1N36E 1HNXE 3K6QA 4JYAE 2KONA 5BR8E 3T1YE 3IWBA 2RS6A 2LMZA 3T1HE 2V87A 2B7VA 3ADGA 3C4BA 3OTOE 1X49A 2YT4A 1GQEA 2M1SA 4BMJA 3HXLA 4DV7E 4DR1E 4LFAE 1HNWE 1T4OA 4TUIA 4GKJE 1PKPA 3IWCA 2L3JA 4BBYA 5ADZA 1HNZE 3HTXA 3LLHA 4J8ZA 4F9AB 3ZOQB 4JI5E 3ADLA 4B3ME 4BC9A 3OMLA 4LU9A 3J7Yp 2N3GA 4L8NA 1I94E 5LL6R 5AE3A 2HHHE 5DNYA 4B3TE 3VYXA 3ADIA 2F8BA 5FLXC 1ZBQA 3P1XA 2VF1A 1O0WA 3AUZA 4BCAA 4LF6E 1QU6A 5F3WA 2MC5A 1ZBTA 3F6GA 4X62E 3J80C 1YZ9A 2B3TB 4LF7E 3FIGA 5AASA 5IWAE 4BS9A 2UUBE 3MSWA 4LFCE 2JR1A 1STUA 4JI8E 1FKAE 1FJGE 2JWOA 4JI0E 1J5EE 2V85A 3HQ1A 4M30A 2VQEE 4DV5E 4DKKA 2N3HA 2B7TA 2DSYA 4DV4E 3C4TA 3JAMC 1T4LB 2KHXA 1IBKE 1HR0E 1YYOA 4DR7E 4JI4E 1GZ6A 2NA2A 2WZOA 1DQ3A 4OX9E 2KOUA 4JI6E 4DR3E 4YY3E 3JU0A 2DIXA 2JY9A 2LE2A 3ADJA 4KHPE 3VK6A 4Q28A 1N33E 2LUQA 4WSPA 4DV2E 2V8QB 2UU9E 2ODRD 4OOGC 2ZM6E 2LJHA 4L5NC 4TUGA 1XNQE 2UXDE 4GEQB 2LTSA 1X47A 2JVAA 2V89A 4B3RE 3LMLA 2E1MA 2VE7C 2JOBA 3HPSA 1N34E 4JI3E 4WFTA 4JV5E 1WHQA 2RS7A 2DB2A 4JI7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 E;  2RSM A;  2F4V E;  2LRS A;  2EZ6 A;  4M2Z A;  4LFB E;  4DV3 E;  4LF9 E;  2UXB E;  1XMQ E;  1T4N A;  4YHH E;  4B3S E;  1YYK A;  1N32 E;  1IBM E;  1WHN A;  1RQ0 A;  4DV6 E;  4DUY E;  1DI2 A;  4X66 E;  4DR4 E;  4X8W A;  4DR5 E;  1YYW A;  4WYQ B;  4DUZ E;  4AQY E;  1X48 A;  4X64 E;  2VQF E;  2UUC E;  2LTR A;  2L2K B;  1XNR E;  2NUG A;  1XMO E;  4NXN E;  4GKK E;  1J26 A;  4X65 E;  2DMY A;  4K0K E;  1UIL A;  4JI1 E;  4LF4 E;  1UHZ A;  4DR6 E;  4LF8 E;  2L2N A;  2E5L E;  2L3C A;  2L2M A;  2L33 A;  4DR2 E;  2LBS B;  2IHR 1;  1RC7 A;  4LF5 E;  2MDR A;  5CFF E;  2UUA E;  2NUE A;  2UXC E;  5LMU E;  1IBL E;  4NXM E;  3VYY A;  2NUF A;  2CPN A;  4DV1 E;  4DV0 E;  5LMN E;  1EKZ A;  2LUP B;  2RTX A;  1N36 E;  1HNX E;  4JYA E;  5BR8 E;  3T1Y E;  2RS6 A;  3T1H E;  3OTO E;  3ADG A;  2B7V A;  3C4B A;  4LFA E;  1X49 A;  2YT4 A;  1GQE A;  4DV7 E;  4DR1 E;  1HNW E;  1T4O A;  4GKJ E;  1PKP A;  2L3J A;  1HNZ E;  3HTX A;  3LLH A;  3ADL A;  4JI5 E;  4B3M E;  1I94 E;  2HHH E;  3J7Y p;  2N3G A;  4B3T E;  3VYX A;  3ADI A;  3P1X A;  1O0W A;  4LF6 E;  1QU6 A;  1ZBT A;  4X62 E;  1YZ9 A;  2B3T B;  4LF7 E;  5IWA E;  2UUB E;  4LFC E;  1STU A;  4JI8 E;  1FKA E;  1FJG E;  4JI0 E;  1J5E E;  4M30 A;  2VQE E;  4DV5 E;  4DKK A;  2N3H A;  2B7T A;  4DV4 E;  1IBK E;  3C4T A;  1T4L B;  1HR0 E;  2KHX A;  4DR7 E;  1YYO A;  4JI4 E;  2NA2 A;  4OX9 E;  4JI6 E;  4DR3 E;  4YY3 E;  2DIX A;  2JY9 A;  3ADJ A;  4KHP E;  1N33 E;  2LUQ A;  4DV2 E;  2UU9 E;  4OOG C;  2ZM6 E;  2LJH A;  1XNQ E;  2UXD E;  2LTS A;  1X47 A;  2JVA A;  4B3R E;  4JI3 E;  1N34 E;  4WFT A;  4JV5 E;  1WHQ A;  2RS7 A;  2DB2 A;  4JI7 E; 
#chains in the Genus database with same CATH topology
 1X3C A;  2EN3 A;  4JI2 E;  2RSM A;  4M2Z A;  4M0V A;  1T4N A;  4B3S E;  1YYK A;  2JXP A;  1YPN A;  4R2D A;  1KJK A;  2RSI A;  2G7H A;  3DF6 A;  2J7J A;  2MKD A;  1X48 A;  1YUJ A;  1NEI A;  2NAB A;  2EPL X;  2JYA A;  2K4V A;  2DRP A;  1TN9 A;  1QNT A;  1YFH A;  1A1H A;  5KL4 A;  2L8T A;  2YRK A;  2EQ1 A;  1UIL A;  4JI1 E;  4LF4 E;  4LF8 E;  2L2N A;  3J7A G;  3KWR A;  2VRD A;  2EN6 A;  2LBS B;  5T6J A;  3BF2 A;  2UXC E;  2NUE A;  1L4S A;  2FTX B;  1IBL E;  3MHS C;  3VYY A;  4P7D A;  2V86 A;  1A1I A;  1EKZ A;  5A6B D;  2LUP B;  2RTX A;  3AV0 A;  2KON A;  4IS1 C;  2LCE A;  2LMZ A;  4R2C A;  3OTO E;  2DLK A;  1P47 A;  1X49 A;  2YT4 A;  4BMJ A;  3ECR A;  1T4O A;  2EPN A;  3IWC A;  2EOE A;  4F9A B;  2EMZ A;  3ZOQ B;  3KZZ A;  4B3M E;  4LU9 A;  2EJ4 A;  2N3G A;  4B3T E;  5LL6 R;  2RQL A;  1X6F A;  2EPM X;  3MHH C;  5KL2 A;  4BCA A;  4LF6 E;  1QU6 A;  2EM2 A;  2WCC 3;  1B69 A;  2MC5 A;  4WXD A;  2WBU A;  4RHB B;  2EOY A;  3J80 C;  1YZ9 A;  2B3T B;  4ZYD A;  3BGH A;  4BS9 A;  2JR1 A;  1T38 A;  2EOF A;  1BBO A;  2N8X A;  4DKK A;  4R2P A;  2LT7 A;  2YTF A;  2EOM A;  1GZ6 A;  2NA2 A;  2GPI A;  2EL6 A;  4DR3 E;  2I13 A;  2YTG A;  1X6E A;  3EPH A;  1MEY C;  1TF6 A;  1IQO A;  2ADR A;  1YSA C;  2EMY A;  2EM7 A;  2EN2 A;  2EML A;  4WFT A;  2YU5 A;  2DB2 A;  1IMU A;  4LFB E;  4MLV A;  1XMQ E;  4YHH E;  4I8O A;  1WHN A;  1RQ0 A;  2YZT A;  5A6K A;  5AE2 A;  5AE1 A;  2EMB A;  1KYQ A;  2EN7 A;  1GTK A;  4X64 E;  2VQF E;  3EPK A;  2LTR A;  2L2K B;  1WRJ A;  2EPK X;  2V83 A;  4NXN E;  1A1K A;  1A1L A;  2EM8 A;  1A1G A;  5KL5 A;  2EN8 A;  1UHZ A;  1JK1 A;  2L3C A;  2L33 A;  4LF5 E;  1AH5 A;  5CFF E;  2YSP A;  4M9V C;  4F9C B;  4DV1 E;  2V88 A;  4DV0 E;  2FV4 B;  4R03 A;  1N36 E;  1HNX E;  2M9A A;  2EOJ A;  4BHB A;  2RS6 A;  3T1H E;  2V87 A;  3C4B A;  2EOX A;  3BID A;  1PKP A;  5AC4 A;  2E72 A;  4BBY A;  3ADL A;  4JI5 E;  3OML A;  2YRH A;  2EOS A;  2D9H A;  2EM4 A;  2EN1 A;  1AAY A;  3ADI A;  1G2F C;  2EL5 A;  3AUZ A;  3EPL A;  2ELZ A;  2EQ3 A;  5A6J A;  2HJJ A;  3KZY A;  5IWA E;  2BB8 A;  4F6N A;  4JI8 E;  1FJG E;  2JWO A;  4JI0 E;  1ZAA C;  2YTN A;  5KL3 A;  4O43 A;  4DV4 E;  2EMC A;  2Q8U A;  1EH6 A;  1T4L B;  1TF3 A;  1YYO A;  1G2D C;  4JI4 E;  4OX9 E;  2KOU A;  2WBS A;  4JI6 E;  2YTQ A;  2EM9 A;  2EPZ A;  2HC5 A;  2K7I A;  2YSO A;  3VK6 A;  4KHP E;  1N33 E;  2YTI A;  2V8Q B;  2ODR D;  4NHR A;  2DMI A;  4GEQ B;  2EMX A;  2LTS A;  5IXM B;  3M99 B;  2E1M A;  2EMF A;  2ENC A;  2R1F A;  2EQ0 A;  2RS7 A;  4JI7 E;  2BBG A;  2FGG A;  4NZV A;  2EM5 A;  2EOZ A;  2I9I A;  2YWQ A;  2EZ6 A;  2EMH A;  3EQ1 A;  4DV3 E;  4F54 A;  4LF9 E;  1MGT A;  2M4I A;  4WSG A;  2UXB E;  4F9B B;  1PDA A;  2EPC A;  1PJS A;  4DUY E;  4X66 E;  1YYW A;  4DR5 E;  1EH8 A;  1N3G A;  4WYQ B;  3H09 A;  4DUZ E;  4AQY E;  2GLI A;  2YPN A;  4ZYG A;  2UUC E;  2EPR A;  2DGC A;  1XNR E;  2NUG A;  1XMO E;  3RMP A;  2LVH A;  4GKK E;  4WXC A;  2H36 X;  1UBD C;  4X65 E;  2JPA A;  4X9J A;  4BHC A;  3C6K A;  2E5L E;  1JK2 A;  4N4R B;  4F2J C;  5IT9 C;  4DR2 E;  3QG5 C;  4MLQ A;  2IHR 1;  2MDR A;  1PJT A;  3DJW A;  2UUA E;  5A2Q C;  5LMU E;  4NXM E;  2CTD A;  1A1F A;  2YRM A;  3JTZ A;  4P78 A;  1LLM C;  2JOX A;  2ODR C;  3J81 C;  2GHF A;  2DLQ A;  4O24 A;  1DGC A;  5A6A A;  2LO3 A;  1HNW E;  2YTD A;  4DR1 E;  2EPX A;  4GKJ E;  1WJP A;  2L3J A;  4IJD A;  2A25 A;  1YUI A;  3HTX A;  2EE8 A;  3LLH A;  1I94 E;  2HHH E;  4L8N A;  1BBG A;  4WX9 A;  5DNY A;  5AC5 A;  1ZBQ A;  3P1X A;  1O0W A;  2EPU A;  2EOR A;  5A69 A;  5F3W A;  1ZBT A;  2EPO A;  3F6G A;  2YTE A;  3FIG A;  5AAS A;  2UUB E;  3MSW A;  1FKA E;  1J5E E;  2V85 A;  2YTJ A;  3HQ1 A;  4M30 A;  5IV8 B;  2N3H A;  2B7T A;  2DSY A;  4DR7 E;  1HR0 E;  1ZR9 A;  3THN A;  2EOH A;  5KL7 A;  2WZO A;  2ENH A;  4FK5 C;  4YY3 E;  2DIX A;  2JY9 A;  2LE2 A;  2WBT A;  4Q28 A;  1IQS A;  2LUQ A;  1EH7 A;  2CSH A;  4DV2 E;  2UU9 E;  4OOG C;  2ZM6 E;  4L5N C;  1XNQ E;  2JVA A;  4ZYE A;  1N34 E;  3L00 A;  4JV5 E;  1WHQ A;  4LTY A;  2F4V E;  2L6M A;  2LRS A;  2M7Q A;  5TSE A;  1WXR A;  1X5W A;  2YTP A;  3EPJ A;  1ZU1 A;  1IBM E;  1N32 E;  4R2A A;  3TQM A;  3HPZ A;  4DV6 E;  4KZS A;  1DI2 A;  4R8O A;  4DR4 E;  4X8W A;  1SR9 A;  3BBG A;  2YTO A;  4WPY A;  4KWY A;  2EM0 A;  2ELY A;  3IWD A;  4Q35 B;  3VHT B;  2EWL A;  1NCS A;  2MKN A;  2EOO A;  1J26 A;  2DMY A;  4K0K E;  4DR6 E;  4R2S A;  2EN4 A;  2EPA A;  2L2M A;  2EM3 A;  4HTG A;  2B9D A;  4BC7 A;  1RC7 A;  2L92 A;  2MC6 A;  2NUF A;  2CPN A;  2EOQ A;  4R2R A;  1SFE A;  2YU8 A;  5LMN E;  3F6H A;  2LV2 A;  4DMI A;  2RPC A;  2EM6 A;  1A1J A;  3K6Q A;  4JYA E;  2EPP A;  2EMK A;  5BR8 E;  4O5G A;  2R76 A;  3IWB A;  3T1Y E;  1F2I G;  2EOI A;  2B7V A;  2EMG A;  3ADG A;  5A6B A;  4DV7 E;  4LFA E;  1GQE A;  2M1S A;  3HXL A;  4TUI A;  2ENA A;  5KL6 A;  1HNZ E;  2EMA A;  5ADZ A;  4J8Z A;  2JP9 A;  4BC9 A;  4R2Q A;  3J7Y p;  3VYX A;  5AE3 A;  2F8B A;  5FLX C;  2EMI A;  1X6H A;  2VF1 A;  2EMW A;  2MDG A;  4GZN C;  1T39 A;  5LLQ A;  4ZYH A;  4X62 E;  2PRT A;  1BB8 A;  3THO B;  4R2E A;  4LF7 E;  2LJU A;  4LFC E;  3UK3 C;  1STU A;  4O4K A;  3C6M A;  4F6M A;  2VQE E;  4DV5 E;  1Z1B A;  1IBK E;  3C4T A;  3JAM C;  2EL4 A;  2KHX A;  2HGH A;  2EP3 A;  4RH8 A;  1DQ3 A;  1RMD A;  2CT1 A;  3JU0 A;  3ADJ A;  4HEI A;  4WSP A;  1UN6 B;  2LJH A;  4TUG A;  2UXD E;  1X47 A;  4B3R E;  2V89 A;  3LML A;  2VE7 C;  2JOB A;  3HPS A;  4JI3 E;  1PJQ A; 
#chains in the Genus database with same CATH homology
 2FGG A;  4LTY A;  4JI2 E;  2RSM A;  2F4V E;  2L6M A;  2LRS A;  2M7Q A;  2EZ6 A;  4M2Z A;  4LFB E;  4DV3 E;  4F54 A;  4M0V A;  4LF9 E;  2M4I A;  2UXB E;  1XMQ E;  1T4N A;  4YHH E;  1WXR A;  4I8O A;  4F9B B;  4B3S E;  1YYK A;  1N32 E;  1IBM E;  1WHN A;  1RQ0 A;  2YZT A;  3HPZ A;  4DV6 E;  4KZS A;  2G7H A;  4DUY E;  1DI2 A;  4R8O A;  5AE2 A;  5AE1 A;  4X8W A;  4X66 E;  1SR9 A;  4DR5 E;  1YYW A;  4DR4 E;  4WYQ B;  3DF6 A;  3H09 A;  4WPY A;  4DUZ E;  4AQY E;  1X48 A;  3IWD A;  4X64 E;  2VQF E;  2UUC E;  2LTR A;  2L2K B;  1XNR E;  2K4V A;  2NUG A;  2EWL A;  2V83 A;  3RMP A;  1XMO E;  4NXN E;  4GKK E;  1J26 A;  2H36 X;  4X65 E;  2DMY A;  2L8T A;  4K0K E;  1UIL A;  4JI1 E;  4LF4 E;  1UHZ A;  4DR6 E;  4LF8 E;  2L2N A;  2E5L E;  3J7A G;  3KWR A;  2L3C A;  2L2M A;  2L33 A;  2B9D A;  4DR2 E;  5IT9 C;  4BC7 A;  2LBS B;  2IHR 1;  1RC7 A;  4LF5 E;  5T6J A;  2L92 A;  2MDR A;  3DJW A;  5CFF E;  2UUA E;  2NUE A;  2UXC E;  5A2Q C;  2MC6 A;  5LMU E;  2FTX B;  1IBL E;  4NXM E;  3VYY A;  4F9C B;  3JTZ A;  4P78 A;  4P7D A;  2NUF A;  2CPN A;  2V88 A;  4DV1 E;  2V86 A;  4DV0 E;  5LMN E;  2FV4 B;  2JOX A;  3F6H A;  4DMI A;  2ODR C;  1EKZ A;  4R03 A;  2LUP B;  3J81 C;  2RTX A;  3AV0 A;  1N36 E;  1HNX E;  3K6Q A;  4JYA E;  2KON A;  5BR8 E;  3T1Y E;  3IWB A;  2RS6 A;  2LMZ A;  3T1H E;  2V87 A;  2B7V A;  3ADG A;  3C4B A;  3OTO E;  1X49 A;  2YT4 A;  1GQE A;  2M1S A;  4BMJ A;  3HXL A;  4DV7 E;  4DR1 E;  4LFA E;  1HNW E;  1T4O A;  4TUI A;  4GKJ E;  1PKP A;  3IWC A;  2L3J A;  4BBY A;  5ADZ A;  1HNZ E;  3HTX A;  3LLH A;  4J8Z A;  4F9A B;  3ZOQ B;  4JI5 E;  3ADL A;  4B3M E;  4BC9 A;  3OML A;  4LU9 A;  3J7Y p;  2N3G A;  4L8N A;  1I94 E;  5LL6 R;  5AE3 A;  2HHH E;  5DNY A;  4B3T E;  3VYX A;  3ADI A;  2F8B A;  5FLX C;  1ZBQ A;  3P1X A;  2VF1 A;  1O0W A;  3AUZ A;  4BCA A;  4LF6 E;  1QU6 A;  5F3W A;  2MC5 A;  1ZBT A;  3F6G A;  4X62 E;  3J80 C;  1YZ9 A;  2B3T B;  4LF7 E;  3FIG A;  5AAS A;  5IWA E;  4BS9 A;  2UUB E;  3MSW A;  4LFC E;  2JR1 A;  1STU A;  4JI8 E;  1FKA E;  1FJG E;  2JWO A;  4JI0 E;  1J5E E;  2V85 A;  3HQ1 A;  4M30 A;  2VQE E;  4DV5 E;  4DKK A;  2N3H A;  2B7T A;  2DSY A;  4DV4 E;  3C4T A;  3JAM C;  1T4L B;  2KHX A;  1IBK E;  1HR0 E;  1YYO A;  4DR7 E;  4JI4 E;  1GZ6 A;  2NA2 A;  2WZO A;  1DQ3 A;  4OX9 E;  2KOU A;  4JI6 E;  4DR3 E;  4YY3 E;  3JU0 A;  2DIX A;  2JY9 A;  2LE2 A;  3ADJ A;  4KHP E;  3VK6 A;  4Q28 A;  1N33 E;  2LUQ A;  4WSP A;  4DV2 E;  2V8Q B;  2UU9 E;  2ODR D;  4OOG C;  2ZM6 E;  2LJH A;  4L5N C;  4TUG A;  1XNQ E;  2UXD E;  4GEQ B;  2LTS A;  1X47 A;  2JVA A;  2V89 A;  4B3R E;  3LML A;  2E1M A;  2VE7 C;  2JOB A;  3HPS A;  1N34 E;  4JI3 E;  4WFT A;  4JV5 E;  1WHQ A;  2RS7 A;  2DB2 A;  4JI7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...