2GHFA

Solution structure of the complete zinc-finger region of human zinc-fingers and homeoboxes 1 (zhx1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
MAHHHHHHNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTINDLTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, metal binding protein
molecule keywords Zinc fingers and homeoboxes protein 1
publication title Solution structure of the zinc-finger region of human zinc-fingers and homeoboxes 1 (ZHX1)
rcsb
source organism Homo sapiens
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18387 zf_C2H2_ZHX Zinc-fingers and homeoboxes C2H2 finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ghfA01
4R2QA 2ENCA 2MKDA 2MKNA 1X5WA 2EMAA 2YTEA 2EP3A 1X6EA 2EM9A 1JK1A 2CTDA 4R2SA 1X6FA 2LV2A 4IJDA 2ADRA 4R2AA 2J7JA 4F6NA 1YSAC 2EN3A 2D9HA 1F2IG 1MEYC 2EMGA 2EMWA 2EL5A 5KL6A 2EN7A 2EM5A 2GLIA 2YTIA 2I13A 4F2JC 2YSOA 2YU8A 2PRTA 1X3CA 2EN2A 1Z1BA 1WJPA 2EMYA 2WBUA 2YTNA 1DGCA 2EMIA 2YU5A 2ELYA 2EORA 2EOYA 2EM2A 1AAYA 1P47A 2LCEA 4M9VC 2EE8A 2NABA 2EN6A 1BBOA 1ZAAC 1UN6B 2YRKA 2EOEA 4FK5C 1A1KA 1A1HA 4GZNC 1LLMC 1B69A 2HGHA 2MDGA 2RPCA 2YTOA 2EMXA 2YRMA 1A1LA 2EL6A 3VHTB 2EMLA 5KL7A 4WSGA 2DLKA 1A1GA 5KL5A 2EM8A 2RSIA 1G2FC 1A1JA 2WBSA 1BB8A 3UK3C 2EQ1A 3EPJA 1X6HA 2EM7A 2ENAA 2ENHA 2LT7A 3EPHA 2YTJA 2EM3A 5KL2A 1RMDA 2CT1A 2EPXA 1KJKA 5KL4A 1A1FA 1NCSA 2WBTA 2EOSA 2EN1A 2EN4A 4F6MA 1G2DC 2DGCA 2EOMA 2EL4A 2EPPA 2EOXA 2EMHA 2EOJA 2WCC3 2EM6A 2EOIA 4IS1C 4R2RA 2LO3A 2YRHA 2A25A 2DRPA 1TF6A 2EMFA 2E72A 2YTPA 3EPKA 1JK2A 2JP9A 4R2PA 2YSPA 2EQ3A 2CSHA 4X9JA 2EQ0A 3MHHC 2EOZA 2YTFA 2YTQA 1UBDC 2DLQA 2EN8A 2M9AA 4R2DA 4R2CA 2EMZA 2LVHA 3M99B 2EMBA 2EOQA 2EPZA 1ZU1A 4R2EA 2EOHA 1YUIA 2EOFA 2BB8A 1ZR9A 1TN9A 2ELZA 2EPUA 2EJ4A 2GHFA 2R1FA 2EPAA 2VRDA 5KL3A 1A1IA 3EPLA 2EM4A 2EPRA 2EOOA 2YTDA 2YTGA 2JPAA 1TF3A 1YUJA 3MHSC 2EPCA 2EM0A 2EMKA 2DMIA 2EMCA
chains in the Genus database with same CATH superfamily
4DV5E 4X64E 1X49A 4R2QA 4HTGA 1X5WA 1SFEA 2LJHA 3C6MA 2EMAA 2N3GA 2DIXA 2EP3A 4YHHE 3OMLA 4BHBA 1JK1A 2CTDA 2KONA 1X6FA 1YYWA 2DMYA 2I9IA 4IJDA 2ADRA 4B3ME 1X48A 2EMGA 2EL5A 4BC9A 1WHQA 1HNZE 2GLIA 3BGHA 5BR8E 2LTSA 1XNQE 3DJWA 1N33E 2KOUA 3IWBA 1ZBTA 4O5GA 1WHNA 4TUGA 2EPNA 2EMYA 4WFTA 2FGGA 4L5NC 5AC4A 4M9VC 1ZAAC 2EZ6A 1UN6B 4WPYA 2V83A 1WRJA 1B69A 2Q8UA 2HGHA 4MLVA 1T4NA 2RPCA 2YRMA 1A1LA 5A69A 3EQ1A 1O0WA 5KL5A 2LRSA 1A1JA 1UILA 2E5LE 2VF1A 4DV2E 1YZ9A 5IXMB 3EPJA 2EM7A 2ENHA 2LT7A 2YTJA 3HPZA 4JV5E 4DUZE 4ZYEA 4TUIA 3VYYA 5KL4A 2N8XA 3HXLA 1A1FA 4JI6E 4WYQB 1NCSA 2WBTA 4I8OA 2EOSA 2RQLA 2EN1A 4F6MA 2L2KB 2B3TB 1N36E 2FV4B 2EM6A 1PDAA 2HC5A 1QU6A 4IS1C 4JI4E 2ZM6E 2MC5A 2LO3A 2YRHA 1PJTA 3J7AG 4MLQA 2EMFA 2E72A 1STUA 4X9JA 2EQ0A 1UBDC 3TQMA 2YTFA 2YTQA 2DLQA 4LF8E 3KZYA 4F9BB 4GKKE 2EOQA 1YPNA 1XNRE 4LF9E 2EPOA 2JWOA 2N3HA 1ZU1A 4ZYDA 2RS7A 3THOB 1ZR9A 4ZYHA 2GHFA 2R1FA 1J5EE 2LMZA 5AC5A 1WXRA 2EPRA 4JI1E 3VK6A 2JPAA 2V88A 4LFBE 1N34E 1TF3A 3MHSC 1LLMC 4DMIA 4F54A 2ENCA 2MKNA 3KWRA 1T39A 1X47A 1HNXE 5IV8B 2EM9A 2J7JA 2V87A 4F6NA 1YSAC 2G7HA 5ADZA 1MEYC 2H36X 4X8WA 1XMOE 4GEQB 1SR9A 2EM5A 2I13A 2YTIA 2UUAE 2YSOA 2YU8A 5AE2A 1IQSA 2L8TA 4O43A 2EN2A 4Q28A 2EMIA 1RQ0A 3T1YE 5LL6R 2VQEE 4NXME 1DI2A 2EM2A 2LE2A 1P47A 1BBOA 2EE8A 3J7Yp 1PJQA 2EOEA 4FK5C 1A1KA 4BC7A 1A1HA 5AE1A 1IMUA 2ODRC 4DUYE 2EMLA 5KL7A 2WZOA 1MGTA 2RSIA 2V85A 4JI5E 4DR5E 2EQ1A 3JTZA 2MDRA 2NUGA 1X6HA 2ENAA 5F3WA 4JI2E 2YPNA 2VE7C 3BF2A 3EPHA 2E1MA 4P7DA 5KL2A 2EPMX 2CT1A 3FIGA 4M2ZA 1IBME 2L2NA 2YWQA 2EOMA 2EPPA 2EOXA 2L33A 1RC7A 4ZYGA 1ZBQA 1J26A 2DRPA 1TF6A 1XMQE 2YTPA 5LMNE 3EPKA 2EWLA 4DR3E 1EH6A 2YSPA 2V86A 4X66E 2LJUA 1QNTA 1GQEA 1DQ3A 2M9AA 3BIDA 2EMZA 3M99B 2EMBA 3VYXA 1FKAE 2JVAA 2JYAA 2JXPA 2EOHA 1EH7A 1YUIA 2EOFA 3H09A 5TSEA 4O4KA 2ELZA 2EPUA 2EJ4A 4JI3E 2ODRD 1N32E 4HEIA 5A6AA 3HQ1A 3MSWA 2DSYA 4Q35B 3L00A 2RTXA 2JR1A 2VRDA 3ADJA 2EMKA 5T6JA 4X65E 2YTEA 3K6QA 5A6BA 4RHBB 4R2SA 2LV2A 4DR4E 4KZSA 4DV4E 2EN3A 2D9HA 1F2IG 2DB2A 2M7QA 4F2JC 1X3CA 2UU9E 4DR1E 1Z1BA 3T1HE 4WXDA 2YTNA 2YU5A 1BBGA 2ELYA 2EOYA 4LU9A 2LCEA 2NABA 2EN6A 4LFCE 4DV6E 4GZNC 2K4VA 2MDGA 2EPKX 4OX9E 2YTOA 2EMXA 1FJGE 2EL6A 3P1XA 4DKKA 5CFFE 4NXNE 4K0KE 3ZOQB 1A1GA 4NHRA 2UUBE 2EM8A 1G2FC 2JY9A 2NA2A 3IWCA 4BCAA 1BB8A 2JOBA 4JI0E 4WSPA 4P78A 1RMDA 4DV3E 2LUPB 2EPLX 4J8ZA 2LBSB 2L2MA 2JOXA 1G2DC 2EN4A 1L4SA 2F8BA 3QG5C 2DGCA 2EL4A 2EMHA 2EOJA 2WCC3 2EOIA 2HJJA 1GZ6A 5AASA 2GPIA 2A25A 4KHPE 4JI7E 4NZVA 4DV1E 1JK2A 3LLHA 2IHR1 1NEIA 3J81C 2EQ3A 2KHXA 1KYQA 2CSHA 4R2PA 3MHHC 2RSMA 2L3CA 1T4OA 2LVHA 2M4IA 2HHHE 2BBGA 3HPSA 4L8NA 4LF7E 3J80C 2BB8A 4LTYA 1TN9A 2YT4A 4RH8A 2UXBE 4M0VA 5A2QC 3THNA 1A1IA 3EPLA 2EM4A 4LF4E 2EOOA 2YTGA 3JAMC 1YYOA 2V89A 4LF5E 1YYKA 1YUJA 1UHZA 2EM3A 2EM0A 1X6EA 2DMIA 2EMCA 4JI8E 2MKDA 2M1SA 4B3SE 1IQOA 5LMUE 2B9DA 2MC6A 3RMPA 4WXCA 1AH5A 4BMJA 4R2AA 2UUCE 4BBYA 2NUEA 4AQYE 2NUFA 2EMWA 5KL6A 2EN7A 2LUQA 3IWDA 1I94E 4LFAE 2PRTA 3ADLA 4OOGC 2R76A 2UXDE 3C4BA 2F4VE 5FLXC 5A6JA 3LMLA 1WJPA 2WBUA 5AE3A 1DGCA 2EORA 4DV0E 1AAYA 1HR0E 1EH8A 2L92A 3HTXA 3KZZA 2YRKA 4DR6E 3ECRA 1YFHA 4N4RB 3C6KA 3F6HA 3JU0A 4R03A 1T4LB 3BBGA 1IBLE 3VHTB 4WSGA 2L3JA 4B3TE 4F9AB 2DLKA 5IWAE 3OTOE 1N3GA 4KWYA 2WBSA 3UK3C 4DR7E 2K7IA 2YZTA 4X62E 4DV7E 4DR2E 4LF6E 4B3RE 1GTKA 3AV0A 3AUZA 4YY3E 2EPXA 5DNYA 1KJKA 1EKZA 4R8OA 2V8QB 3DF6A 1T38A 3ADGA 2VQFE 4BS9A 2RS6A 4R2RA 5IT9C 1PKPA 4BHCA 4WX9A 3ADIA 2LTRA 5A6BD 2JP9A 4JYAE 4F9CB 2EOZA 3F6GA 2UXCE 2EN8A 4R2DA 4R2CA 3C4TA 2CPNA 2FTXB 4M30A 1HNWE 2L6MA 1PJSA 2EPZA 4R2EA 1IBKE 2B7VA 5KL3A 2EPAA 2B7TA 5LLQA 2YTDA 4GKJE 2EPCA 4O24A 5A6KA
chains in the Genus database with same CATH topology
4R2QA 2ENCA 2MKDA 2MKNA 1X5WA 2EMAA 2YTEA 2EP3A 1X6EA 2EM9A 1JK1A 2CTDA 4R2SA 1X6FA 2LV2A 4IJDA 2ADRA 4R2AA 2J7JA 4F6NA 1YSAC 2EN3A 2D9HA 1F2IG 1MEYC 2EMGA 2EMWA 2EL5A 5KL6A 2EN7A 2EM5A 2GLIA 2YTIA 2I13A 4F2JC 2YSOA 2YU8A 2PRTA 1X3CA 2EN2A 1Z1BA 1WJPA 2EMYA 2WBUA 2YTNA 1DGCA 2EMIA 2YU5A 2ELYA 2EORA 2EOYA 2EM2A 1AAYA 1P47A 2LCEA 4M9VC 2EE8A 2NABA 2EN6A 1BBOA 1ZAAC 1UN6B 2YRKA 2EOEA 4FK5C 1A1KA 1A1HA 4GZNC 1LLMC 1B69A 2HGHA 2MDGA 2RPCA 2YTOA 2EMXA 2YRMA 1A1LA 2EL6A 3VHTB 2EMLA 5KL7A 4WSGA 2DLKA 1A1GA 5KL5A 2EM8A 2RSIA 1G2FC 1A1JA 2WBSA 1BB8A 3UK3C 2EQ1A 3EPJA 1X6HA 2EM7A 2ENAA 2ENHA 2LT7A 3EPHA 2YTJA 2EM3A 5KL2A 1RMDA 2CT1A 2EPXA 1KJKA 5KL4A 1A1FA 1NCSA 2WBTA 2EOSA 2EN1A 2EN4A 4F6MA 1G2DC 2DGCA 2EOMA 2EL4A 2EPPA 2EOXA 2EMHA 2EOJA 2WCC3 2EM6A 2EOIA 4IS1C 4R2RA 2LO3A 2YRHA 2A25A 2DRPA 1TF6A 2EMFA 2E72A 2YTPA 3EPKA 1JK2A 2JP9A 4R2PA 2YSPA 2EQ3A 2CSHA 4X9JA 2EQ0A 3MHHC 2EOZA 2YTFA 2YTQA 1UBDC 2DLQA 2EN8A 2M9AA 4R2DA 4R2CA 2EMZA 2LVHA 3M99B 2EMBA 2EOQA 2EPZA 1ZU1A 4R2EA 2EOHA 1YUIA 2EOFA 2BB8A 1ZR9A 1TN9A 2ELZA 2EPUA 2EJ4A 2GHFA 2R1FA 2EPAA 2VRDA 5KL3A 1A1IA 3EPLA 2EM4A 2EPRA 2EOOA 2YTDA 2YTGA 2JPAA 1TF3A 1YUJA 3MHSC 2EPCA 2EM0A 2EMKA 2DMIA 2EMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2Q A;  2ENC A;  2MKD A;  2MKN A;  1X5W A;  2EMA A;  2YTE A;  2EP3 A;  1X6E A;  2EM9 A;  1JK1 A;  2CTD A;  4R2S A;  1X6F A;  2LV2 A;  4IJD A;  2ADR A;  4R2A A;  2J7J A;  4F6N A;  1YSA C;  2EN3 A;  2D9H A;  1F2I G;  1MEY C;  2EMG A;  2EMW A;  2EL5 A;  5KL6 A;  2EN7 A;  2EM5 A;  2GLI A;  2YTI A;  2I13 A;  4F2J C;  2YSO A;  2YU8 A;  2PRT A;  1X3C A;  2EN2 A;  1Z1B A;  1WJP A;  2EMY A;  2WBU A;  2YTN A;  1DGC A;  2EMI A;  2YU5 A;  2ELY A;  2EOR A;  2EOY A;  2EM2 A;  1AAY A;  1P47 A;  2LCE A;  4M9V C;  2EE8 A;  2NAB A;  2EN6 A;  1BBO A;  1ZAA C;  1UN6 B;  2YRK A;  2EOE A;  4FK5 C;  1A1K A;  1A1H A;  4GZN C;  1LLM C;  1B69 A;  2HGH A;  2MDG A;  2RPC A;  2YTO A;  2EMX A;  2YRM A;  1A1L A;  2EL6 A;  3VHT B;  2EML A;  5KL7 A;  4WSG A;  2DLK A;  1A1G A;  5KL5 A;  2EM8 A;  2RSI A;  1G2F C;  1A1J A;  2WBS A;  1BB8 A;  3UK3 C;  2EQ1 A;  3EPJ A;  1X6H A;  2EM7 A;  2ENA A;  2ENH A;  2LT7 A;  3EPH A;  2YTJ A;  2EM3 A;  5KL2 A;  1RMD A;  2CT1 A;  2EPX A;  1KJK A;  5KL4 A;  1A1F A;  1NCS A;  2WBT A;  2EOS A;  2EN1 A;  2EN4 A;  4F6M A;  1G2D C;  2DGC A;  2EOM A;  2EL4 A;  2EPP A;  2EOX A;  2EMH A;  2EOJ A;  2WCC 3;  2EM6 A;  2EOI A;  4IS1 C;  4R2R A;  2LO3 A;  2YRH A;  2A25 A;  2DRP A;  1TF6 A;  2EMF A;  2E72 A;  2YTP A;  3EPK A;  1JK2 A;  2JP9 A;  4R2P A;  2YSP A;  2EQ3 A;  2CSH A;  4X9J A;  2EQ0 A;  3MHH C;  2EOZ A;  2YTF A;  2YTQ A;  1UBD C;  2DLQ A;  2EN8 A;  2M9A A;  4R2D A;  4R2C A;  2EMZ A;  2LVH A;  3M99 B;  2EMB A;  2EOQ A;  2EPZ A;  1ZU1 A;  4R2E A;  2EOH A;  1YUI A;  2EOF A;  2BB8 A;  1ZR9 A;  1TN9 A;  2ELZ A;  2EPU A;  2EJ4 A;  2GHF A;  2R1F A;  2EPA A;  2VRD A;  5KL3 A;  1A1I A;  3EPL A;  2EM4 A;  2EPR A;  2EOO A;  2YTD A;  2YTG A;  2JPA A;  1TF3 A;  1YUJ A;  3MHS C;  2EPC A;  2EM0 A;  2EMK A;  2DMI A;  2EMC A; 
#chains in the Genus database with same CATH topology
 4DV5 E;  4X64 E;  1X49 A;  4R2Q A;  4HTG A;  1X5W A;  1SFE A;  2LJH A;  3C6M A;  2EMA A;  2N3G A;  2DIX A;  2EP3 A;  4YHH E;  3OML A;  4BHB A;  1JK1 A;  2CTD A;  2KON A;  1X6F A;  1YYW A;  2DMY A;  2I9I A;  4IJD A;  2ADR A;  4B3M E;  1X48 A;  2EMG A;  2EL5 A;  4BC9 A;  1WHQ A;  1HNZ E;  2GLI A;  3BGH A;  5BR8 E;  2LTS A;  1XNQ E;  3DJW A;  1N33 E;  2KOU A;  3IWB A;  1ZBT A;  4O5G A;  1WHN A;  4TUG A;  2EPN A;  2EMY A;  4WFT A;  2FGG A;  4L5N C;  5AC4 A;  4M9V C;  1ZAA C;  2EZ6 A;  1UN6 B;  4WPY A;  2V83 A;  1WRJ A;  1B69 A;  2Q8U A;  2HGH A;  4MLV A;  1T4N A;  2RPC A;  2YRM A;  1A1L A;  5A69 A;  3EQ1 A;  1O0W A;  5KL5 A;  2LRS A;  1A1J A;  1UIL A;  2E5L E;  2VF1 A;  4DV2 E;  1YZ9 A;  5IXM B;  3EPJ A;  2EM7 A;  2ENH A;  2LT7 A;  2YTJ A;  3HPZ A;  4JV5 E;  4DUZ E;  4ZYE A;  4TUI A;  3VYY A;  5KL4 A;  2N8X A;  3HXL A;  1A1F A;  4JI6 E;  4WYQ B;  1NCS A;  2WBT A;  4I8O A;  2EOS A;  2RQL A;  2EN1 A;  4F6M A;  2L2K B;  2B3T B;  1N36 E;  2FV4 B;  2EM6 A;  1PDA A;  2HC5 A;  1QU6 A;  4IS1 C;  4JI4 E;  2ZM6 E;  2MC5 A;  2LO3 A;  2YRH A;  1PJT A;  3J7A G;  4MLQ A;  2EMF A;  2E72 A;  1STU A;  4X9J A;  2EQ0 A;  1UBD C;  3TQM A;  2YTF A;  2YTQ A;  2DLQ A;  4LF8 E;  3KZY A;  4F9B B;  4GKK E;  2EOQ A;  1YPN A;  1XNR E;  4LF9 E;  2EPO A;  2JWO A;  2N3H A;  1ZU1 A;  4ZYD A;  2RS7 A;  3THO B;  1ZR9 A;  4ZYH A;  2GHF A;  2R1F A;  1J5E E;  2LMZ A;  5AC5 A;  1WXR A;  2EPR A;  4JI1 E;  3VK6 A;  2JPA A;  2V88 A;  4LFB E;  1N34 E;  1TF3 A;  3MHS C;  1LLM C;  4DMI A;  4F54 A;  2ENC A;  2MKN A;  3KWR A;  1T39 A;  1X47 A;  1HNX E;  5IV8 B;  2EM9 A;  2J7J A;  2V87 A;  4F6N A;  1YSA C;  2G7H A;  5ADZ A;  1MEY C;  2H36 X;  4X8W A;  1XMO E;  4GEQ B;  1SR9 A;  2EM5 A;  2I13 A;  2YTI A;  2UUA E;  2YSO A;  2YU8 A;  5AE2 A;  1IQS A;  2L8T A;  4O43 A;  2EN2 A;  4Q28 A;  2EMI A;  1RQ0 A;  3T1Y E;  5LL6 R;  2VQE E;  4NXM E;  1DI2 A;  2EM2 A;  2LE2 A;  1P47 A;  1BBO A;  2EE8 A;  3J7Y p;  1PJQ A;  2EOE A;  4FK5 C;  1A1K A;  4BC7 A;  1A1H A;  5AE1 A;  1IMU A;  2ODR C;  4DUY E;  2EML A;  5KL7 A;  2WZO A;  1MGT A;  2RSI A;  2V85 A;  4JI5 E;  4DR5 E;  2EQ1 A;  3JTZ A;  2MDR A;  2NUG A;  1X6H A;  2ENA A;  5F3W A;  4JI2 E;  2YPN A;  2VE7 C;  3BF2 A;  3EPH A;  2E1M A;  4P7D A;  5KL2 A;  2EPM X;  2CT1 A;  3FIG A;  4M2Z A;  1IBM E;  2L2N A;  2YWQ A;  2EOM A;  2EPP A;  2EOX A;  2L33 A;  1RC7 A;  4ZYG A;  1ZBQ A;  1J26 A;  2DRP A;  1TF6 A;  1XMQ E;  2YTP A;  5LMN E;  3EPK A;  2EWL A;  4DR3 E;  1EH6 A;  2YSP A;  2V86 A;  4X66 E;  2LJU A;  1QNT A;  1GQE A;  1DQ3 A;  2M9A A;  3BID A;  2EMZ A;  3M99 B;  2EMB A;  3VYX A;  1FKA E;  2JVA A;  2JYA A;  2JXP A;  2EOH A;  1EH7 A;  1YUI A;  2EOF A;  3H09 A;  5TSE A;  4O4K A;  2ELZ A;  2EPU A;  2EJ4 A;  4JI3 E;  2ODR D;  1N32 E;  4HEI A;  5A6A A;  3HQ1 A;  3MSW A;  2DSY A;  4Q35 B;  3L00 A;  2RTX A;  2JR1 A;  2VRD A;  3ADJ A;  2EMK A;  5T6J A;  4X65 E;  2YTE A;  3K6Q A;  5A6B A;  4RHB B;  4R2S A;  2LV2 A;  4DR4 E;  4KZS A;  4DV4 E;  2EN3 A;  2D9H A;  1F2I G;  2DB2 A;  2M7Q A;  4F2J C;  1X3C A;  2UU9 E;  4DR1 E;  1Z1B A;  3T1H E;  4WXD A;  2YTN A;  2YU5 A;  1BBG A;  2ELY A;  2EOY A;  4LU9 A;  2LCE A;  2NAB A;  2EN6 A;  4LFC E;  4DV6 E;  4GZN C;  2K4V A;  2MDG A;  2EPK X;  4OX9 E;  2YTO A;  2EMX A;  1FJG E;  2EL6 A;  3P1X A;  4DKK A;  5CFF E;  4NXN E;  4K0K E;  3ZOQ B;  1A1G A;  4NHR A;  2UUB E;  2EM8 A;  1G2F C;  2JY9 A;  2NA2 A;  3IWC A;  4BCA A;  1BB8 A;  2JOB A;  4JI0 E;  4WSP A;  4P78 A;  1RMD A;  4DV3 E;  2LUP B;  2EPL X;  4J8Z A;  2LBS B;  2L2M A;  2JOX A;  1G2D C;  2EN4 A;  1L4S A;  2F8B A;  3QG5 C;  2DGC A;  2EL4 A;  2EMH A;  2EOJ A;  2WCC 3;  2EOI A;  2HJJ A;  1GZ6 A;  5AAS A;  2GPI A;  2A25 A;  4KHP E;  4JI7 E;  4NZV A;  4DV1 E;  1JK2 A;  3LLH A;  2IHR 1;  1NEI A;  3J81 C;  2EQ3 A;  2KHX A;  1KYQ A;  2CSH A;  4R2P A;  3MHH C;  2RSM A;  2L3C A;  1T4O A;  2LVH A;  2M4I A;  2HHH E;  2BBG A;  3HPS A;  4L8N A;  4LF7 E;  3J80 C;  2BB8 A;  4LTY A;  1TN9 A;  2YT4 A;  4RH8 A;  2UXB E;  4M0V A;  5A2Q C;  3THN A;  1A1I A;  3EPL A;  2EM4 A;  4LF4 E;  2EOO A;  2YTG A;  3JAM C;  1YYO A;  2V89 A;  4LF5 E;  1YYK A;  1YUJ A;  1UHZ A;  2EM3 A;  2EM0 A;  1X6E A;  2DMI A;  2EMC A;  4JI8 E;  2MKD A;  2M1S A;  4B3S E;  1IQO A;  5LMU E;  2B9D A;  2MC6 A;  3RMP A;  4WXC A;  1AH5 A;  4BMJ A;  4R2A A;  2UUC E;  4BBY A;  2NUE A;  4AQY E;  2NUF A;  2EMW A;  5KL6 A;  2EN7 A;  2LUQ A;  3IWD A;  1I94 E;  4LFA E;  2PRT A;  3ADL A;  4OOG C;  2R76 A;  2UXD E;  3C4B A;  2F4V E;  5FLX C;  5A6J A;  3LML A;  1WJP A;  2WBU A;  5AE3 A;  1DGC A;  2EOR A;  4DV0 E;  1AAY A;  1HR0 E;  1EH8 A;  2L92 A;  3HTX A;  3KZZ A;  2YRK A;  4DR6 E;  3ECR A;  1YFH A;  4N4R B;  3C6K A;  3F6H A;  3JU0 A;  4R03 A;  1T4L B;  3BBG A;  1IBL E;  3VHT B;  4WSG A;  2L3J A;  4B3T E;  4F9A B;  2DLK A;  5IWA E;  3OTO E;  1N3G A;  4KWY A;  2WBS A;  3UK3 C;  4DR7 E;  2K7I A;  2YZT A;  4X62 E;  4DV7 E;  4DR2 E;  4LF6 E;  4B3R E;  1GTK A;  3AV0 A;  3AUZ A;  4YY3 E;  2EPX A;  5DNY A;  1KJK A;  1EKZ A;  4R8O A;  2V8Q B;  3DF6 A;  1T38 A;  3ADG A;  2VQF E;  4BS9 A;  2RS6 A;  4R2R A;  5IT9 C;  1PKP A;  4BHC A;  4WX9 A;  3ADI A;  2LTR A;  5A6B D;  2JP9 A;  4JYA E;  4F9C B;  2EOZ A;  3F6G A;  2UXC E;  2EN8 A;  4R2D A;  4R2C A;  3C4T A;  2CPN A;  2FTX B;  4M30 A;  1HNW E;  2L6M A;  1PJS A;  2EPZ A;  4R2E A;  1IBK E;  2B7V A;  5KL3 A;  2EPA A;  2B7T A;  5LLQ A;  2YTD A;  4GKJ E;  2EPC A;  4O24 A;  5A6K A; 
#chains in the Genus database with same CATH homology
 4R2Q A;  2ENC A;  2MKD A;  2MKN A;  1X5W A;  2EMA A;  2YTE A;  2EP3 A;  1X6E A;  2EM9 A;  1JK1 A;  2CTD A;  4R2S A;  1X6F A;  2LV2 A;  4IJD A;  2ADR A;  4R2A A;  2J7J A;  4F6N A;  1YSA C;  2EN3 A;  2D9H A;  1F2I G;  1MEY C;  2EMG A;  2EMW A;  2EL5 A;  5KL6 A;  2EN7 A;  2EM5 A;  2GLI A;  2YTI A;  2I13 A;  4F2J C;  2YSO A;  2YU8 A;  2PRT A;  1X3C A;  2EN2 A;  1Z1B A;  1WJP A;  2EMY A;  2WBU A;  2YTN A;  1DGC A;  2EMI A;  2YU5 A;  2ELY A;  2EOR A;  2EOY A;  2EM2 A;  1AAY A;  1P47 A;  2LCE A;  4M9V C;  2EE8 A;  2NAB A;  2EN6 A;  1BBO A;  1ZAA C;  1UN6 B;  2YRK A;  2EOE A;  4FK5 C;  1A1K A;  1A1H A;  4GZN C;  1LLM C;  1B69 A;  2HGH A;  2MDG A;  2RPC A;  2YTO A;  2EMX A;  2YRM A;  1A1L A;  2EL6 A;  3VHT B;  2EML A;  5KL7 A;  4WSG A;  2DLK A;  1A1G A;  5KL5 A;  2EM8 A;  2RSI A;  1G2F C;  1A1J A;  2WBS A;  1BB8 A;  3UK3 C;  2EQ1 A;  3EPJ A;  1X6H A;  2EM7 A;  2ENA A;  2ENH A;  2LT7 A;  3EPH A;  2YTJ A;  2EM3 A;  5KL2 A;  1RMD A;  2CT1 A;  2EPX A;  1KJK A;  5KL4 A;  1A1F A;  1NCS A;  2WBT A;  2EOS A;  2EN1 A;  2EN4 A;  4F6M A;  1G2D C;  2DGC A;  2EOM A;  2EL4 A;  2EPP A;  2EOX A;  2EMH A;  2EOJ A;  2WCC 3;  2EM6 A;  2EOI A;  4IS1 C;  4R2R A;  2LO3 A;  2YRH A;  2A25 A;  2DRP A;  1TF6 A;  2EMF A;  2E72 A;  2YTP A;  3EPK A;  1JK2 A;  2JP9 A;  4R2P A;  2YSP A;  2EQ3 A;  2CSH A;  4X9J A;  2EQ0 A;  3MHH C;  2EOZ A;  2YTF A;  2YTQ A;  1UBD C;  2DLQ A;  2EN8 A;  2M9A A;  4R2D A;  4R2C A;  2EMZ A;  2LVH A;  3M99 B;  2EMB A;  2EOQ A;  2EPZ A;  1ZU1 A;  4R2E A;  2EOH A;  1YUI A;  2EOF A;  2BB8 A;  1ZR9 A;  1TN9 A;  2ELZ A;  2EPU A;  2EJ4 A;  2GHF A;  2R1F A;  2EPA A;  2VRD A;  5KL3 A;  1A1I A;  3EPL A;  2EM4 A;  2EPR A;  2EOO A;  2YTD A;  2YTG A;  2JPA A;  1TF3 A;  1YUJ A;  3MHS C;  2EPC A;  2EM0 A;  2EMK A;  2DMI A;  2EMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...