2GHFA

Solution structure of the complete zinc-finger region of human zinc-fingers and homeoboxes 1 (zhx1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
MAHHHHHHNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTINDLTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc fingers and homeoboxes protein 1
publication title Solution structure of the zinc-finger region of human zinc-fingers and homeoboxes 1 (ZHX1)
rcsb
source organism Homo sapiens
molecule tags Transcription, metal binding protein
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18387 zf_C2H2_ZHX Zinc-fingers and homeoboxes C2H2 finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ghfA01
2WBTA 4FK5C 2D9HA 2WBUA 2EMCA 2R1FA 1A1HA 2YTFA 2EM4A 2WCC3 2ENAA 2YU5A 4WSGA 2YTEA 2EMHA 2EOEA 2ADRA 3UK3C 3MHHC 2ENHA 2EOMA 2ELYA 2DGCA 2EJ4A 2EMLA 2EMXA 2LV2A 2YTQA 2LVHA 2EN1A 5KL5A 1F2IG 2EPPA 1BBOA 1YUIA 4R2PA 2EL5A 2DMIA 2EM0A 2EMIA 2EN3A 1BB8A 1AAYA 2EQ3A 2EMKA 2YU8A 5KL3A 2ELZA 2EOSA 2EN2A 2EOXA 2EMWA 2YTNA 2J7JA 2EOZA 2EN7A 1X6EA 4F2JC 5KL6A 1P47A 2EOIA 2EQ1A 2WBSA 2YTGA 2EM9A 2LO3A 2E72A 3M99B 4R2QA 2EOHA 2EORA 2GLIA 2EQ0A 1B69A 2BB8A 2YTIA 1YSAC 2LCEA 2DLQA 2HGHA 4IJDA 2EPZA 2EMGA 1X3CA 2CT1A 2YTPA 2A25A 1Z1BA 2DLKA 4X9JA 2EOOA 4R2CA 2NABA 1A1LA 1A1GA 3MHSC 2I13A 1KJKA 3EPHA 2CTDA 3VHTB 2PRTA 2MDGA 1NCSA 2EN4A 1TF6A 2EL4A 2EOFA 2YSPA 5KL7A 1X5WA 2EL6A 2M9AA 1DGCA 2EPCA 1ZR9A 2EM3A 2YTJA 2YTDA 2EPXA 2RSIA 1YUJA 2EM7A 2YTOA 2EM6A 2EPAA 2EMZA 3EPJA 2EM8A 2EOQA 1WJPA 1X6HA 2YSOA 1A1FA 2EN6A 2EM2A 2GHFA 2MKNA 4IS1C 1A1IA 2MKDA 1UBDC 2JP9A 2EOJA 4R2AA 4R2RA 1A1JA 4M9VC 1LLMC 4R2DA 1JK1A 1RMDA 2ENCA 1JK2A 2RPCA 5KL2A 1G2FC 2LT7A 5KL4A 2DRPA 4F6MA 1X6FA 2YRHA 2EPUA 1G2DC 2JPAA 2EMBA 2EMAA 3EPLA 1UN6B 3EPKA 2YRKA 1TF3A 2EMFA 2EOYA 2EMYA 4R2EA 4GZNC 1TN9A 2EE8A 1A1KA 1MEYC 4F6NA 2EPRA 1ZAAC 2YRMA 2EM5A 2VRDA 4R2SA 2CSHA 2EP3A 2EN8A 1ZU1A
chains in the Genus database with same CATH superfamily
2WBTA 4K0KE 2WCC3 2EMHA 2EOEA 2ADRA 4JI4E 2JOXA 4JI5E 1I94E 4LFBE 4JI3E 2EMLA 2LV2A 1EKZA 4DV3E 4TUIA 1F2IG 2EPPA 2V87A 1STUA 4GKJE 2DMIA 2HC5A 2EMIA 1AAYA 1EH6A 2EQ3A 2ODRD 4HTGA 2LUQA 4JI6E 1RC7A 2EN2A 2JYAA 4BHBA 5AC5A 4F2JC 2EOIA 3ZOQB 3KWRA 2B7TA 2EM9A 2LO3A 4R2QA 1HR0E 5A6BD 2ZM6E 2E5LE 4JI1E 2LTRA 2BB8A 2YTIA 2LUPB 1YSAC 4BC9A 2JVAA 4JYAE 1IQOA 2L8TA 1T4OA 1X3CA 4BCAA 4DV2E 4X9JA 1HNZE 4B3TE 4O24A 2G7HA 2UUCE 3P1XA 2CTDA 3JU0A 2MDGA 1NCSA 4KWYA 1T4LB 3C6KA 2K4VA 2EM3A 2YTDA 1YPNA 2EM6A 1YYOA 2EMZA 3EPJA 1WJPA 2R76A 4BC7A 4DR1E 3HPZA 1EH7A 3BGHA 3VYYA 2MKNA 3BBGA 3RMPA 4B3SE 2FV4B 2IHR1 4WSPA 4GEQB 1A1JA 4JI2E 1GQEA 4LF9E 1LLMC 2GPIA 5A2QC 2WZOA 4JI0E 4OX9E 1JK2A 1XMOE 2RPCA 2RTXA 2CPNA 2EPOA 1NEIA 5DNYA 5IT9C 2DRPA 4F6MA 5TSEA 2EPUA 1PJTA 2KHXA 2L33A 3LLHA 2L3JA 1G2DC 1XNRE 2JPAA 1UN6B 1TF3A 4GZNC 1A1KA 4F6NA 1IBKE 3AV0A 5LMNE 4R2SA 2CSHA 3H09A 3AUZA 1ZU1A 4L5NC 4FK5C 2EMCA 2VF1A 3VK6A 4J8ZA 3FIGA 2V83A 3UK3C 4F9BB 3ADJA 4TUGA 2EMXA 2YWQA 1O0WA 2NA2A 2LVHA 4YY3E 2NUEA 1BB8A 1GZ6A 2RSMA 2YPNA 2EMKA 5KL3A 1HNWE 2DSYA 2YTNA 2EOZA 2EN7A 2LMZA 3JAMC 1P47A 1IBME 2E72A 1FKAE 4OOGC 3J7AG 2GLIA 1B69A 3C4TA 1UHZA 2MC5A 2YTPA 1IBLE 1RQ0A 2NABA 3BIDA 2UUAE 3MHSC 4DV4E 1N33E 2N3GA 3VHTB 2EN4A 3OTOE 5KL7A 2EOFA 1YYWA 1FJGE 2RS7A 4RH8A 1ZR9A 1BBGA 4LFCE 2RSIA 2LRSA 1YUJA 2EM7A 2L2NA 2UXDE 3DJWA 5AC4A 1AH5A 4ZYGA 2M7QA 3QG5C 2EOQA 4WX9A 5ADZA 1J5EE 1WRJA 2UXCE 2HHHE 2GHFA 4DR2E 4ZYDA 4LF6E 2MKDA 1UBDC 3HTXA 4F9CB 5IWAE 1QNTA 1JK1A 1T4NA 1RMDA 4LF7E 5A6AA 4YHHE 2UU9E 3ADGA 1X6FA 4X62E 4B3ME 4I8OA 3T1YE 4P7DA 3EPKA 4M0VA 2EMFA 4R2EA 2L3CA 2M1SA 4DV7E 2EPRA 4M2ZA 5FLXC 2MDRA 2EPMX 2LJUA 1J26A 2EP3A 2EPKX 2B9DA 4NHRA 1WHQA 2EPNA 2R1FA 5IXMB 1HNXE 2YTFA 2ENAA 4WSGA 2MC6A 3F6GA 5CFFE 3TQMA 2NUFA 2EWLA 4NXME 2ENHA 2EOMA 5T6JA 2DGCA 4DR4E 2EJ4A 2YTQA 3IWCA 2H36X 4NZVA 4X8WA 4LF5E 4ZYHA 4DR5E 1T39A 3L00A 4R2PA 2RS6A 2EL5A 2EM0A 4BBYA 3HPSA 2F4VE 4O5GA 2KOUA 3J7Yp 4DUZE 2EOSA 1YZ9A 2EMWA 1N3GA 4O43A 1UILA 4Q35B 2LTSA 5AE3A 2NUGA 3KZZA 4DV1E 5IV8B 4BS9A 4DR3E 3VYXA 5KL6A 2WBSA 4MLQA 1DQ3A 3HQ1A 4HEIA 1N32E 3THOB 2EORA 3EQ1A 3ADIA 2LCEA 4DKKA 2HGHA 1WXRA 2VQFE 4IJDA 2EMGA 4DUYE 4JV5E 2EPLX 3HXLA 1EH8A 2A25A 1KYQA 1IQSA 1QU6A 4DV5E 2DLKA 4DV6E 2EOOA 3BF2A 1SFEA 1A1GA 2I13A 2FTXB 3C4BA 2PRTA 2N3HA 4DV0E 2JR1A 1TF6A 4X64E 2YSPA 1X5WA 4L8NA 3JTZA 4B3RE 4BHCA 4KHPE 2V89A 2M9AA 2BBGA 1DGCA 2EPCA 2Q8UA 4ZYEA 1WHNA 1ZBTA 2DIXA 2UUBE 4DR7E 4LTYA 1YFHA 2EM8A 2E1MA 2V86A 1SR9A 4LF4E 1X6HA 2YSOA 3THNA 1PDAA 4GKKE 5LMUE 4R03A 2YT4A 1A1IA 4Q28A 4LFAE 1PJSA 2LE2A 2JP9A 2N8XA 4R2AA 4NXNE 3OMLA 3F6HA 4M9VC 3C6MA 4R2DA 5A6BA 5A6JA 2V88A 5A6KA 2L92A 3K6QA 5AASA 3J81C 1X49A 4MLVA 2LT7A 3KZYA 5KL4A 3T1HE 2YZTA 5AE2A 4F9AB 5LLQA 2L2MA 2HJJA 2EZ6A 4WXDA 2EMYA 1TN9A 2EE8A 1MEYC 2L2KB 2EM5A 2VRDA 4R8OA 5AE1A 2D9HA 2WBUA 2L6MA 1A1HA 4M30A 2EM4A 2YU5A 2RQLA 2YTEA 1N34E 3MHHC 2ELYA 2V85A 2JY9A 1YYKA 4X65E 2EN1A 4JI7E 5KL5A 1BBOA 4N4RB 1YUIA 2JWOA 2EN3A 1XNQE 2LJHA 5LL6R 2VQEE 3IWBA 2V8QB 3MSWA 2YU8A 4WXCA 1ZBQA 2ELZA 2EOXA 2J7JA 1DI2A 1X6EA 2I9IA 3LMLA 4X66E 2EQ1A 2YTGA 3M99B 2EOHA 4P78A 3J80C 1GTKA 2EQ0A 3DF6A 4LF8E 2B3TB 2DLQA 4LU9A 2EPZA 2UXBE 2CT1A 3ECRA 1Z1BA 4R2CA 1PKPA 1T38A 1A1LA 1KJKA 3EPHA 2B7VA 5A69A 1X48A 4BMJA 2LBSB 2F8BA 2KONA 2EL4A 2DB2A 2EL6A 1L4SA 2ODRC 1MGTA 4RHBB 2FGGA 2YTJA 2EPXA 2YTOA 2EPAA 5F3WA 1A1FA 4WYQB 2EN6A 4JI8E 2EM2A 4O4KA 3IWDA 2M4IA 4IS1C 2DMYA 4DMIA 1X47A 2EOJA 4R2RA 2JXPA 2ENCA 4WPYA 2K7IA 1N36E 3ADLA 4AQYE 4KZSA 2JOBA 5KL2A 1G2FC 4WFTA 2YRHA 4F54A 2EMBA 2EMAA 3EPLA 4DR6E 2YRKA 2EOYA 2VE7C 1XMQE 1ZAAC 2YRMA 1IMUA 5BR8E 1PJQA 2EN8A
chains in the Genus database with same CATH topology
2WBTA 4FK5C 2D9HA 2WBUA 2EMCA 2R1FA 1A1HA 2YTFA 2EM4A 2WCC3 2ENAA 2YU5A 4WSGA 2YTEA 2EMHA 2EOEA 2ADRA 3UK3C 3MHHC 2ENHA 2EOMA 2ELYA 2DGCA 2EJ4A 2EMLA 2EMXA 2LV2A 2YTQA 2LVHA 2EN1A 5KL5A 1F2IG 2EPPA 1BBOA 1YUIA 4R2PA 2EL5A 2DMIA 2EM0A 2EMIA 2EN3A 1BB8A 1AAYA 2EQ3A 2EMKA 2YU8A 5KL3A 2ELZA 2EOSA 2EN2A 2EOXA 2EMWA 2YTNA 2J7JA 2EOZA 2EN7A 1X6EA 4F2JC 5KL6A 1P47A 2EOIA 2EQ1A 2WBSA 2YTGA 2EM9A 2LO3A 2E72A 3M99B 4R2QA 2EOHA 2EORA 2GLIA 2EQ0A 1B69A 2BB8A 2YTIA 1YSAC 2LCEA 2DLQA 2HGHA 4IJDA 2EPZA 2EMGA 1X3CA 2CT1A 2YTPA 2A25A 1Z1BA 2DLKA 4X9JA 2EOOA 4R2CA 2NABA 1A1LA 1A1GA 3MHSC 2I13A 1KJKA 3EPHA 2CTDA 3VHTB 2PRTA 2MDGA 1NCSA 2EN4A 1TF6A 2EL4A 2EOFA 2YSPA 5KL7A 1X5WA 2EL6A 2M9AA 1DGCA 2EPCA 1ZR9A 2EM3A 2YTJA 2YTDA 2EPXA 2RSIA 1YUJA 2EM7A 2YTOA 2EM6A 2EPAA 2EMZA 3EPJA 2EM8A 2EOQA 1WJPA 1X6HA 2YSOA 1A1FA 2EN6A 2EM2A 2GHFA 2MKNA 4IS1C 1A1IA 2MKDA 1UBDC 2JP9A 2EOJA 4R2AA 4R2RA 1A1JA 4M9VC 1LLMC 4R2DA 1JK1A 1RMDA 2ENCA 1JK2A 2RPCA 5KL2A 1G2FC 2LT7A 5KL4A 2DRPA 4F6MA 1X6FA 2YRHA 2EPUA 1G2DC 2JPAA 2EMBA 2EMAA 3EPLA 1UN6B 3EPKA 2YRKA 1TF3A 2EMFA 2EOYA 2EMYA 4R2EA 4GZNC 1TN9A 2EE8A 1A1KA 1MEYC 4F6NA 2EPRA 1ZAAC 2YRMA 2EM5A 2VRDA 4R2SA 2CSHA 2EP3A 2EN8A 1ZU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBT A;  4FK5 C;  2D9H A;  2WBU A;  2EMC A;  2R1F A;  1A1H A;  2YTF A;  2EM4 A;  2WCC 3;  2ENA A;  2YU5 A;  4WSG A;  2YTE A;  2EMH A;  2EOE A;  2ADR A;  3UK3 C;  3MHH C;  2ENH A;  2EOM A;  2ELY A;  2DGC A;  2EJ4 A;  2EML A;  2EMX A;  2LV2 A;  2YTQ A;  2LVH A;  2EN1 A;  5KL5 A;  1F2I G;  2EPP A;  1BBO A;  1YUI A;  4R2P A;  2EL5 A;  2DMI A;  2EM0 A;  2EMI A;  2EN3 A;  1BB8 A;  1AAY A;  2EQ3 A;  2EMK A;  2YU8 A;  5KL3 A;  2ELZ A;  2EOS A;  2EN2 A;  2EOX A;  2EMW A;  2YTN A;  2J7J A;  2EOZ A;  2EN7 A;  1X6E A;  4F2J C;  5KL6 A;  1P47 A;  2EOI A;  2EQ1 A;  2WBS A;  2YTG A;  2EM9 A;  2LO3 A;  2E72 A;  3M99 B;  4R2Q A;  2EOH A;  2EOR A;  2GLI A;  2EQ0 A;  1B69 A;  2BB8 A;  2YTI A;  1YSA C;  2LCE A;  2DLQ A;  2HGH A;  4IJD A;  2EPZ A;  2EMG A;  1X3C A;  2CT1 A;  2YTP A;  2A25 A;  1Z1B A;  2DLK A;  4X9J A;  2EOO A;  4R2C A;  2NAB A;  1A1L A;  1A1G A;  3MHS C;  2I13 A;  1KJK A;  3EPH A;  2CTD A;  3VHT B;  2PRT A;  2MDG A;  1NCS A;  2EN4 A;  1TF6 A;  2EL4 A;  2EOF A;  2YSP A;  5KL7 A;  1X5W A;  2EL6 A;  2M9A A;  1DGC A;  2EPC A;  1ZR9 A;  2EM3 A;  2YTJ A;  2YTD A;  2EPX A;  2RSI A;  1YUJ A;  2EM7 A;  2YTO A;  2EM6 A;  2EPA A;  2EMZ A;  3EPJ A;  2EM8 A;  2EOQ A;  1WJP A;  1X6H A;  2YSO A;  1A1F A;  2EN6 A;  2EM2 A;  2GHF A;  2MKN A;  4IS1 C;  1A1I A;  2MKD A;  1UBD C;  2JP9 A;  2EOJ A;  4R2A A;  4R2R A;  1A1J A;  4M9V C;  1LLM C;  4R2D A;  1JK1 A;  1RMD A;  2ENC A;  1JK2 A;  2RPC A;  5KL2 A;  1G2F C;  2LT7 A;  5KL4 A;  2DRP A;  4F6M A;  1X6F A;  2YRH A;  2EPU A;  1G2D C;  2JPA A;  2EMB A;  2EMA A;  3EPL A;  1UN6 B;  3EPK A;  2YRK A;  1TF3 A;  2EMF A;  2EOY A;  2EMY A;  4R2E A;  4GZN C;  1TN9 A;  2EE8 A;  1A1K A;  1MEY C;  4F6N A;  2EPR A;  1ZAA C;  2YRM A;  2EM5 A;  2VRD A;  4R2S A;  2CSH A;  2EP3 A;  2EN8 A;  1ZU1 A; 
#chains in the Genus database with same CATH topology
 2WBT A;  4K0K E;  2WCC 3;  2EMH A;  2EOE A;  2ADR A;  4JI4 E;  2JOX A;  4JI5 E;  1I94 E;  4LFB E;  4JI3 E;  2EML A;  2LV2 A;  1EKZ A;  4DV3 E;  4TUI A;  1F2I G;  2EPP A;  2V87 A;  1STU A;  4GKJ E;  2DMI A;  2HC5 A;  2EMI A;  1AAY A;  1EH6 A;  2EQ3 A;  2ODR D;  4HTG A;  2LUQ A;  4JI6 E;  1RC7 A;  2EN2 A;  2JYA A;  4BHB A;  5AC5 A;  4F2J C;  2EOI A;  3ZOQ B;  3KWR A;  2B7T A;  2EM9 A;  2LO3 A;  4R2Q A;  1HR0 E;  5A6B D;  2ZM6 E;  2E5L E;  4JI1 E;  2LTR A;  2BB8 A;  2YTI A;  2LUP B;  1YSA C;  4BC9 A;  2JVA A;  4JYA E;  1IQO A;  2L8T A;  1T4O A;  1X3C A;  4BCA A;  4DV2 E;  4X9J A;  1HNZ E;  4B3T E;  4O24 A;  2G7H A;  2UUC E;  3P1X A;  2CTD A;  3JU0 A;  2MDG A;  1NCS A;  4KWY A;  1T4L B;  3C6K A;  2K4V A;  2EM3 A;  2YTD A;  1YPN A;  2EM6 A;  1YYO A;  2EMZ A;  3EPJ A;  1WJP A;  2R76 A;  4BC7 A;  4DR1 E;  3HPZ A;  1EH7 A;  3BGH A;  3VYY A;  2MKN A;  3BBG A;  3RMP A;  4B3S E;  2FV4 B;  2IHR 1;  4WSP A;  4GEQ B;  1A1J A;  4JI2 E;  1GQE A;  4LF9 E;  1LLM C;  2GPI A;  5A2Q C;  2WZO A;  4JI0 E;  4OX9 E;  1JK2 A;  1XMO E;  2RPC A;  2RTX A;  2CPN A;  2EPO A;  1NEI A;  5DNY A;  5IT9 C;  2DRP A;  4F6M A;  5TSE A;  2EPU A;  1PJT A;  2KHX A;  2L33 A;  3LLH A;  2L3J A;  1G2D C;  1XNR E;  2JPA A;  1UN6 B;  1TF3 A;  4GZN C;  1A1K A;  4F6N A;  1IBK E;  3AV0 A;  5LMN E;  4R2S A;  2CSH A;  3H09 A;  3AUZ A;  1ZU1 A;  4L5N C;  4FK5 C;  2EMC A;  2VF1 A;  3VK6 A;  4J8Z A;  3FIG A;  2V83 A;  3UK3 C;  4F9B B;  3ADJ A;  4TUG A;  2EMX A;  2YWQ A;  1O0W A;  2NA2 A;  2LVH A;  4YY3 E;  2NUE A;  1BB8 A;  1GZ6 A;  2RSM A;  2YPN A;  2EMK A;  5KL3 A;  1HNW E;  2DSY A;  2YTN A;  2EOZ A;  2EN7 A;  2LMZ A;  3JAM C;  1P47 A;  1IBM E;  2E72 A;  1FKA E;  4OOG C;  3J7A G;  2GLI A;  1B69 A;  3C4T A;  1UHZ A;  2MC5 A;  2YTP A;  1IBL E;  1RQ0 A;  2NAB A;  3BID A;  2UUA E;  3MHS C;  4DV4 E;  1N33 E;  2N3G A;  3VHT B;  2EN4 A;  3OTO E;  5KL7 A;  2EOF A;  1YYW A;  1FJG E;  2RS7 A;  4RH8 A;  1ZR9 A;  1BBG A;  4LFC E;  2RSI A;  2LRS A;  1YUJ A;  2EM7 A;  2L2N A;  2UXD E;  3DJW A;  5AC4 A;  1AH5 A;  4ZYG A;  2M7Q A;  3QG5 C;  2EOQ A;  4WX9 A;  5ADZ A;  1J5E E;  1WRJ A;  2UXC E;  2HHH E;  2GHF A;  4DR2 E;  4ZYD A;  4LF6 E;  2MKD A;  1UBD C;  3HTX A;  4F9C B;  5IWA E;  1QNT A;  1JK1 A;  1T4N A;  1RMD A;  4LF7 E;  5A6A A;  4YHH E;  2UU9 E;  3ADG A;  1X6F A;  4X62 E;  4B3M E;  4I8O A;  3T1Y E;  4P7D A;  3EPK A;  4M0V A;  2EMF A;  4R2E A;  2L3C A;  2M1S A;  4DV7 E;  2EPR A;  4M2Z A;  5FLX C;  2MDR A;  2EPM X;  2LJU A;  1J26 A;  2EP3 A;  2EPK X;  2B9D A;  4NHR A;  1WHQ A;  2EPN A;  2R1F A;  5IXM B;  1HNX E;  2YTF A;  2ENA A;  4WSG A;  2MC6 A;  3F6G A;  5CFF E;  3TQM A;  2NUF A;  2EWL A;  4NXM E;  2ENH A;  2EOM A;  5T6J A;  2DGC A;  4DR4 E;  2EJ4 A;  2YTQ A;  3IWC A;  2H36 X;  4NZV A;  4X8W A;  4LF5 E;  4ZYH A;  4DR5 E;  1T39 A;  3L00 A;  4R2P A;  2RS6 A;  2EL5 A;  2EM0 A;  4BBY A;  3HPS A;  2F4V E;  4O5G A;  2KOU A;  3J7Y p;  4DUZ E;  2EOS A;  1YZ9 A;  2EMW A;  1N3G A;  4O43 A;  1UIL A;  4Q35 B;  2LTS A;  5AE3 A;  2NUG A;  3KZZ A;  4DV1 E;  5IV8 B;  4BS9 A;  4DR3 E;  3VYX A;  5KL6 A;  2WBS A;  4MLQ A;  1DQ3 A;  3HQ1 A;  4HEI A;  1N32 E;  3THO B;  2EOR A;  3EQ1 A;  3ADI A;  2LCE A;  4DKK A;  2HGH A;  1WXR A;  2VQF E;  4IJD A;  2EMG A;  4DUY E;  4JV5 E;  2EPL X;  3HXL A;  1EH8 A;  2A25 A;  1KYQ A;  1IQS A;  1QU6 A;  4DV5 E;  2DLK A;  4DV6 E;  2EOO A;  3BF2 A;  1SFE A;  1A1G A;  2I13 A;  2FTX B;  3C4B A;  2PRT A;  2N3H A;  4DV0 E;  2JR1 A;  1TF6 A;  4X64 E;  2YSP A;  1X5W A;  4L8N A;  3JTZ A;  4B3R E;  4BHC A;  4KHP E;  2V89 A;  2M9A A;  2BBG A;  1DGC A;  2EPC A;  2Q8U A;  4ZYE A;  1WHN A;  1ZBT A;  2DIX A;  2UUB E;  4DR7 E;  4LTY A;  1YFH A;  2EM8 A;  2E1M A;  2V86 A;  1SR9 A;  4LF4 E;  1X6H A;  2YSO A;  3THN A;  1PDA A;  4GKK E;  5LMU E;  4R03 A;  2YT4 A;  1A1I A;  4Q28 A;  4LFA E;  1PJS A;  2LE2 A;  2JP9 A;  2N8X A;  4R2A A;  4NXN E;  3OML A;  3F6H A;  4M9V C;  3C6M A;  4R2D A;  5A6B A;  5A6J A;  2V88 A;  5A6K A;  2L92 A;  3K6Q A;  5AAS A;  3J81 C;  1X49 A;  4MLV A;  2LT7 A;  3KZY A;  5KL4 A;  3T1H E;  2YZT A;  5AE2 A;  4F9A B;  5LLQ A;  2L2M A;  2HJJ A;  2EZ6 A;  4WXD A;  2EMY A;  1TN9 A;  2EE8 A;  1MEY C;  2L2K B;  2EM5 A;  2VRD A;  4R8O A;  5AE1 A;  2D9H A;  2WBU A;  2L6M A;  1A1H A;  4M30 A;  2EM4 A;  2YU5 A;  2RQL A;  2YTE A;  1N34 E;  3MHH C;  2ELY A;  2V85 A;  2JY9 A;  1YYK A;  4X65 E;  2EN1 A;  4JI7 E;  5KL5 A;  1BBO A;  4N4R B;  1YUI A;  2JWO A;  2EN3 A;  1XNQ E;  2LJH A;  5LL6 R;  2VQE E;  3IWB A;  2V8Q B;  3MSW A;  2YU8 A;  4WXC A;  1ZBQ A;  2ELZ A;  2EOX A;  2J7J A;  1DI2 A;  1X6E A;  2I9I A;  3LML A;  4X66 E;  2EQ1 A;  2YTG A;  3M99 B;  2EOH A;  4P78 A;  3J80 C;  1GTK A;  2EQ0 A;  3DF6 A;  4LF8 E;  2B3T B;  2DLQ A;  4LU9 A;  2EPZ A;  2UXB E;  2CT1 A;  3ECR A;  1Z1B A;  4R2C A;  1PKP A;  1T38 A;  1A1L A;  1KJK A;  3EPH A;  2B7V A;  5A69 A;  1X48 A;  4BMJ A;  2LBS B;  2F8B A;  2KON A;  2EL4 A;  2DB2 A;  2EL6 A;  1L4S A;  2ODR C;  1MGT A;  4RHB B;  2FGG A;  2YTJ A;  2EPX A;  2YTO A;  2EPA A;  5F3W A;  1A1F A;  4WYQ B;  2EN6 A;  4JI8 E;  2EM2 A;  4O4K A;  3IWD A;  2M4I A;  4IS1 C;  2DMY A;  4DMI A;  1X47 A;  2EOJ A;  4R2R A;  2JXP A;  2ENC A;  4WPY A;  2K7I A;  1N36 E;  3ADL A;  4AQY E;  4KZS A;  2JOB A;  5KL2 A;  1G2F C;  4WFT A;  2YRH A;  4F54 A;  2EMB A;  2EMA A;  3EPL A;  4DR6 E;  2YRK A;  2EOY A;  2VE7 C;  1XMQ E;  1ZAA C;  2YRM A;  1IMU A;  5BR8 E;  1PJQ A;  2EN8 A; 
#chains in the Genus database with same CATH homology
 2WBT A;  4FK5 C;  2D9H A;  2WBU A;  2EMC A;  2R1F A;  1A1H A;  2YTF A;  2EM4 A;  2WCC 3;  2ENA A;  2YU5 A;  4WSG A;  2YTE A;  2EMH A;  2EOE A;  2ADR A;  3UK3 C;  3MHH C;  2ENH A;  2EOM A;  2ELY A;  2DGC A;  2EJ4 A;  2EML A;  2EMX A;  2LV2 A;  2YTQ A;  2LVH A;  2EN1 A;  5KL5 A;  1F2I G;  2EPP A;  1BBO A;  1YUI A;  4R2P A;  2EL5 A;  2DMI A;  2EM0 A;  2EMI A;  2EN3 A;  1BB8 A;  1AAY A;  2EQ3 A;  2EMK A;  2YU8 A;  5KL3 A;  2ELZ A;  2EOS A;  2EN2 A;  2EOX A;  2EMW A;  2YTN A;  2J7J A;  2EOZ A;  2EN7 A;  1X6E A;  4F2J C;  5KL6 A;  1P47 A;  2EOI A;  2EQ1 A;  2WBS A;  2YTG A;  2EM9 A;  2LO3 A;  2E72 A;  3M99 B;  4R2Q A;  2EOH A;  2EOR A;  2GLI A;  2EQ0 A;  1B69 A;  2BB8 A;  2YTI A;  1YSA C;  2LCE A;  2DLQ A;  2HGH A;  4IJD A;  2EPZ A;  2EMG A;  1X3C A;  2CT1 A;  2YTP A;  2A25 A;  1Z1B A;  2DLK A;  4X9J A;  2EOO A;  4R2C A;  2NAB A;  1A1L A;  1A1G A;  3MHS C;  2I13 A;  1KJK A;  3EPH A;  2CTD A;  3VHT B;  2PRT A;  2MDG A;  1NCS A;  2EN4 A;  1TF6 A;  2EL4 A;  2EOF A;  2YSP A;  5KL7 A;  1X5W A;  2EL6 A;  2M9A A;  1DGC A;  2EPC A;  1ZR9 A;  2EM3 A;  2YTJ A;  2YTD A;  2EPX A;  2RSI A;  1YUJ A;  2EM7 A;  2YTO A;  2EM6 A;  2EPA A;  2EMZ A;  3EPJ A;  2EM8 A;  2EOQ A;  1WJP A;  1X6H A;  2YSO A;  1A1F A;  2EN6 A;  2EM2 A;  2GHF A;  2MKN A;  4IS1 C;  1A1I A;  2MKD A;  1UBD C;  2JP9 A;  2EOJ A;  4R2A A;  4R2R A;  1A1J A;  4M9V C;  1LLM C;  4R2D A;  1JK1 A;  1RMD A;  2ENC A;  1JK2 A;  2RPC A;  5KL2 A;  1G2F C;  2LT7 A;  5KL4 A;  2DRP A;  4F6M A;  1X6F A;  2YRH A;  2EPU A;  1G2D C;  2JPA A;  2EMB A;  2EMA A;  3EPL A;  1UN6 B;  3EPK A;  2YRK A;  1TF3 A;  2EMF A;  2EOY A;  2EMY A;  4R2E A;  4GZN C;  1TN9 A;  2EE8 A;  1A1K A;  1MEY C;  4F6N A;  2EPR A;  1ZAA C;  2YRM A;  2EM5 A;  2VRD A;  4R2S A;  2CSH A;  2EP3 A;  2EN8 A;  1ZU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...