2GHFA

Solution structure of the complete zinc-finger region of human zinc-fingers and homeoboxes 1 (zhx1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
MAHHHHHHNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTINDLTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc fingers and homeoboxes protein 1
publication title Solution structure of the zinc-finger region of human zinc-fingers and homeoboxes 1 (ZHX1)
rcsb
source organism Homo sapiens
molecule tags Transcription, metal binding protein
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18387 zf_C2H2_ZHX Zinc-fingers and homeoboxes C2H2 finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ghfA01
2D9HA 2CSHA 2EN4A 1BBOA 1X3CA 1ZAAC 1A1KA 2EOMA 2EN7A 4IS1C 1ZR9A 2YSOA 1YUIA 2EP3A 4M9VC 2EPZA 2NABA 3VHTB 2MKDA 1F2IG 2EQ1A 2YSPA 4R2EA 1A1JA 2I13A 2DMIA 2EOSA 2YU8A 2EM5A 2JPAA 2EN8A 2EOZA 1G2DC 2EMAA 2EMGA 2EPXA 2EN1A 2BB8A 3UK3C 2ENCA 2DLKA 5KL2A 1ZU1A 2GHFA 2LO3A 2M9AA 5KL3A 2R1FA 2EMIA 4R2SA 2DLQA 2EPAA 2WBUA 1A1GA 2EOHA 2EL4A 4R2QA 2EQ3A 2EM0A 2EN2A 4GZNC 2YTJA 1A1LA 3EPLA 2YTDA 4F6MA 2PRTA 1UN6B 2YTPA 2EL5A 1BB8A 2EN6A 5KL6A 2E72A 1Z1BA 1TN9A 4R2PA 4R2DA 2EMZA 1P47A 1X6FA 3EPKA 1KJKA 5KL5A 2EM9A 1A1IA 2YU5A 2LCEA 2EOEA 5KL4A 2EPCA 1JK2A 2YTOA 2EQ0A 1JK1A 2EM2A 1TF3A 2JP9A 2EOXA 3M99B 1UBDC 1YSAC 3MHHC 1NCSA 4F6NA 2MKNA 3EPHA 4X9JA 2YTEA 4FK5C 2LT7A 2EJ4A 2EN3A 2EMXA 1X6HA 2EM7A 2EL6A 2EOJA 2DGCA 2EM4A 2EMYA 2CT1A 4IJDA 2WCC3 2YTFA 2EPPA 1AAYA 2EPUA 2CTDA 2YRKA 2EORA 1G2FC 2J7JA 1A1HA 2EOOA 2EOQA 2YTNA 2YTQA 2EOFA 2LV2A 2EM3A 2WBTA 2EM8A 4R2AA 2EOIA 4F2JC 2DRPA 2YRHA 2YTGA 2EMLA 2EPRA 2EMWA 2EMKA 1TF6A 2ELZA 2EMCA 2VRDA 2RSIA 3MHSC 1X6EA 1YUJA 1WJPA 2LVHA 1LLMC 2HGHA 2A25A 2ADRA 2EMHA 2YRMA 2YTIA 1A1FA 2EMBA 2GLIA 1DGCA 2EM6A 2EE8A 2MDGA 4R2CA 1RMDA 1MEYC 2EMFA 2RPCA 4R2RA 3EPJA 2EOYA 2ELYA 1X5WA 2ENAA 2ENHA 5KL7A 4WSGA 2WBSA 1B69A
chains in the Genus database with same CATH superfamily
4DKKA 1UHZA 3QG5C 2B7TA 1MGTA 1ZAAC 4ZYDA 4BCAA 3ADIA 4IS1C 1J26A 3J81C 2EPZA 4O24A 2JWOA 3VHTB 2V8QB 1F2IG 1A1JA 2DMIA 2EOSA 2RS7A 4GKKE 3J7AG 1G2DC 1PJTA 2EMAA 2EMGA 4NHRA 2EN1A 2NA2A 5BR8E 1N32E 1ZU1A 2B3TB 1PJSA 5KL3A 2EMIA 1A1GA 2EL4A 4DV2E 2YTJA 1A1LA 5TSEA 4JI6E 4DR1E 1WHNA 5KL6A 1BBGA 2L2MA 1TN9A 4DR6E 2EMZA 4NXME 1X6FA 4X8WA 3HXLA 4N4RB 2EM9A 3JU0A 2KHXA 5KL5A 1A1IA 4OX9E 2YU5A 3MSWA 2LCEA 1T38A 2EPCA 3LLHA 1JK2A 1GTKA 4RHBB 3DF6A 3BF2A 2N3GA 1WHQA 3LMLA 5AC4A 2VQEE 2EPNA 1ZBTA 1PDAA 1HR0E 2MC5A 1L4SA 2LBSB 2EMXA 4BHBA 4DV0E 2MC6A 2EM4A 3AV0A 2BBGA 3THNA 4NXNE 4WX9A 3THOB 5A2QC 2YTQA 4LFAE 2Q8UA 2EOFA 2LV2A 1KYQA 3F6GA 4BBYA 1IBLE 4R2AA 5LL6R 4F2JC 2DRPA 2RSMA 4LTYA 2EMLA 1STUA 4LF6E 2EMKA 2RSIA 3L00A 2L92A 4BS9A 5AE1A 1WXRA 1YUJA 2L2NA 2F8BA 1IQOA 2ADRA 2YTIA 2E5LE 1NEIA 1DGCA 2B7VA 4BC7A 5CFFE 2EE8A 2DIXA 4R2CA 1RMDA 3ZOQB 5AASA 2EMFA 3OMLA 5DNYA 4BC9A 2ELYA 2L3CA 2ENAA 2ENHA 4WSGA 2EPLX 1QNTA 4J8ZA 3KWRA 1X3CA 2V87A 2UXBE 1RQ0A 4O43A 1A1KA 1ZR9A 2YSOA 2EP3A 4B3ME 4M9VC 4JI1E 5IWAE 3RMPA 2HC5A 2I13A 4KHPE 4JI7E 1XNRE 1J5EE 2BB8A 1XNQE 1HNZE 4DR7E 1IQSA 2M9AA 2EPAA 2WBUA 4GZNC 2EM0A 1EKZA 4M2ZA 2EWLA 4M0VA 2PRTA 2L6MA 2DSYA 1GQEA 1Z1BA 4R2PA 1YYKA 1KJKA 2V83A 4ZYEA 4JI8E 4ZYHA 2LRSA 2GPIA 1TF3A 2JP9A 1PJQA 4JV5E 2YT4A 4KZSA 4F6NA 2KONA 2M4IA 2EPMX 3TQMA 4K0KE 4OOGC 5LLQA 5A6JA 2EL6A 4JI3E 2EMYA 2V88A 2WCC3 2DB2A 2YTFA 2CTDA 4LF5E 1G2FC 1A1HA 1XMOE 2EM3A 4RH8A 1YYOA 4YY3E 2E1MA 2EOIA 3ADLA 4YHHE 2LJHA 2YRHA 2YTGA 4B3SE 5LMUE 2EPRA 4P78A 4I8OA 1TF6A 4GKJE 2VE7C 2VRDA 2EMCA 4JI0E 4TUGA 4BHCA 1X6EA 1YPNA 2LVHA 1LLMC 2HGHA 1IMUA 4DR5E 1RC7A 2A25A 2EMHA 2L8TA 2YRMA 1A1FA 2EM6A 2V85A 2MDGA 1QU6A 5A6BD 4DUYE 2EOYA 5IT9C 2VF1A 1X5WA 4LF9E 2FGGA 3C4TA 5KL7A 2UXCE 5A6KA 4HTGA 2WBSA 2D9HA 2EPKX 2CSHA 2LE2A 2V89A 5IXMB 4L8NA 1WRJA 2EN7A 1YUIA 4DV6E 2LTRA 2MKDA 1HNWE 3FIGA 3HQ1A 2EQ1A 4R2EA 4MLQA 2YU8A 2WZOA 2EM5A 2EN8A 2EOZA 2ENCA 2FV4B 4DV3E 2DLKA 5KL2A 5LMNE 3IWDA 3IWBA 3AUZA 2R1FA 2LMZA 4R2SA 2JOBA 1FJGE 2EOHA 4R2QA 1EH8A 4F9CB 1X48A 3EPLA 2YTDA 1IBME 4F6MA 2YTPA 1BB8A 4DR3E 2EN6A 2UXDE 3J7Yp 3BBGA 1FKAE 2HJJA 4R2DA 1P47A 5FLXC 2EPOA 3T1YE 4R03A 5A69A 2EOEA 2HHHE 5KL4A 2EQ0A 1JK1A 2EM2A 4KWYA 2UU9E 4WXDA 1UBDC 1YSAC 3JTZA 3MHHC 1T4NA 2MKNA 2R76A 2RS6A 2LUQA 4X9JA 2YTEA 3JAMC 1DI2A 3BGHA 3T1HE 1N33E 2LJUA 2LT7A 2EJ4A 5A6AA 4TUIA 2EM7A 2DGCA 4DMIA 2CT1A 4X65E 2EPPA 1AAYA 2EPUA 4LF4E 2EORA 5A6BA 2J7JA 2EOOA 2EOQA 2WBTA 2UUBE 2EZ6A 2EM8A 4P7DA 2I9IA 4DUZE 2RTXA 2EMWA 4WPYA 4LF7E 3MHSC 1N36E 2JR1A 1T4OA 1WJPA 2YWQA 2H36X 1PKPA 1EH6A 3ADJA 2GLIA 1SR9A 4BMJA 4LFCE 2KOUA 4F9AB 3HPSA 2MDRA 1MEYC 2RPCA 2NUGA 2K4VA 3ECRA 3VK6A 1N34E 1DQ3A 3DJWA 2YPNA 3EQ1A 2JY9A 1B69A 2EN4A 2K7IA 3K6QA 4L5NC 1AH5A 4LU9A 3IWCA 1BBOA 2V86A 2NUEA 1X49A 4JI4E 2L2KB 2B9DA 2RQLA 4JYAE 2N8XA 2UUAE 1ZBQA 4O5GA 1IBKE 4B3TE 2EOMA 1X47A 3OTOE 2NABA 1N3GA 3C4BA 2F4VE 5AE3A 2YSPA 4GEQB 4Q35B 4AQYE 1SFEA 5IV8B 2JOXA 2JPAA 3H09A 2EPXA 1UILA 3VYYA 1XMQE 3UK3C 4DR2E 4HEIA 3BIDA 2GHFA 3ADGA 3KZZA 1EH7A 2LO3A 4Q28A 2DLQA 2EQ3A 2EN2A 2L33A 3C6MA 2NUFA 4M30A 4WYQB 1UN6B 2EL5A 5AE2A 3C6KA 2N3HA 4X62E 2E72A 2ODRC 2L3JA 4DV4E 2M1SA 3EPKA 1YFHA 4DV1E 4F9BB 4B3RE 4LF8E 1GZ6A 2IHR1 4O4KA 2VQFE 4X66E 2JYAA 1I94E 2YTOA 2UUCE 2EOXA 3M99B 3HPZA 2DMYA 2YZTA 1NCSA 3EPHA 5AC5A 2FTXB 4DV5E 4FK5C 3P1XA 2EN3A 1X6HA 1YZ9A 2EOJA 5ADZA 4IJDA 2LTSA 2LUPB 4DR4E 4WSPA 2CPNA 2YRKA 4F54A 4ZYGA 2YTNA 4WFTA 5F3WA 3J80C 3F6HA 4MLVA 4R8OA 3HTXA 4JI2E 2M7QA 2ODRD 4DV7E 2ELZA 4X64E 1O0WA 5T6JA 3VYXA 4NZVA 1YYWA 2ZM6E 2JVAA 2EMBA 3KZYA 4JI5E 1T39A 1HNXE 4R2RA 2JXPA 3EPJA 4LFBE 2G7HA 1T4LB 4WXCA
chains in the Genus database with same CATH topology
2D9HA 2CSHA 2EN4A 1BBOA 1X3CA 1ZAAC 1A1KA 2EOMA 2EN7A 4IS1C 1ZR9A 2YSOA 1YUIA 2EP3A 4M9VC 2EPZA 2NABA 3VHTB 2MKDA 1F2IG 2EQ1A 2YSPA 4R2EA 1A1JA 2I13A 2DMIA 2EOSA 2YU8A 2EM5A 2JPAA 2EN8A 2EOZA 1G2DC 2EMAA 2EMGA 2EPXA 2EN1A 2BB8A 3UK3C 2ENCA 2DLKA 5KL2A 1ZU1A 2GHFA 2LO3A 2M9AA 5KL3A 2R1FA 2EMIA 4R2SA 2DLQA 2EPAA 2WBUA 1A1GA 2EOHA 2EL4A 4R2QA 2EQ3A 2EM0A 2EN2A 4GZNC 2YTJA 1A1LA 3EPLA 2YTDA 4F6MA 2PRTA 1UN6B 2YTPA 2EL5A 1BB8A 2EN6A 5KL6A 2E72A 1Z1BA 1TN9A 4R2PA 4R2DA 2EMZA 1P47A 1X6FA 3EPKA 1KJKA 5KL5A 2EM9A 1A1IA 2YU5A 2LCEA 2EOEA 5KL4A 2EPCA 1JK2A 2YTOA 2EQ0A 1JK1A 2EM2A 1TF3A 2JP9A 2EOXA 3M99B 1UBDC 1YSAC 3MHHC 1NCSA 4F6NA 2MKNA 3EPHA 4X9JA 2YTEA 4FK5C 2LT7A 2EJ4A 2EN3A 2EMXA 1X6HA 2EM7A 2EL6A 2EOJA 2DGCA 2EM4A 2EMYA 2CT1A 4IJDA 2WCC3 2YTFA 2EPPA 1AAYA 2EPUA 2CTDA 2YRKA 2EORA 1G2FC 2J7JA 1A1HA 2EOOA 2EOQA 2YTNA 2YTQA 2EOFA 2LV2A 2EM3A 2WBTA 2EM8A 4R2AA 2EOIA 4F2JC 2DRPA 2YRHA 2YTGA 2EMLA 2EPRA 2EMWA 2EMKA 1TF6A 2ELZA 2EMCA 2VRDA 2RSIA 3MHSC 1X6EA 1YUJA 1WJPA 2LVHA 1LLMC 2HGHA 2A25A 2ADRA 2EMHA 2YRMA 2YTIA 1A1FA 2EMBA 2GLIA 1DGCA 2EM6A 2EE8A 2MDGA 4R2CA 1RMDA 1MEYC 2EMFA 2RPCA 4R2RA 3EPJA 2EOYA 2ELYA 1X5WA 2ENAA 2ENHA 5KL7A 4WSGA 2WBSA 1B69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9H A;  2CSH A;  2EN4 A;  1BBO A;  1X3C A;  1ZAA C;  1A1K A;  2EOM A;  2EN7 A;  4IS1 C;  1ZR9 A;  2YSO A;  1YUI A;  2EP3 A;  4M9V C;  2EPZ A;  2NAB A;  3VHT B;  2MKD A;  1F2I G;  2EQ1 A;  2YSP A;  4R2E A;  1A1J A;  2I13 A;  2DMI A;  2EOS A;  2YU8 A;  2EM5 A;  2JPA A;  2EN8 A;  2EOZ A;  1G2D C;  2EMA A;  2EMG A;  2EPX A;  2EN1 A;  2BB8 A;  3UK3 C;  2ENC A;  2DLK A;  5KL2 A;  1ZU1 A;  2GHF A;  2LO3 A;  2M9A A;  5KL3 A;  2R1F A;  2EMI A;  4R2S A;  2DLQ A;  2EPA A;  2WBU A;  1A1G A;  2EOH A;  2EL4 A;  4R2Q A;  2EQ3 A;  2EM0 A;  2EN2 A;  4GZN C;  2YTJ A;  1A1L A;  3EPL A;  2YTD A;  4F6M A;  2PRT A;  1UN6 B;  2YTP A;  2EL5 A;  1BB8 A;  2EN6 A;  5KL6 A;  2E72 A;  1Z1B A;  1TN9 A;  4R2P A;  4R2D A;  2EMZ A;  1P47 A;  1X6F A;  3EPK A;  1KJK A;  5KL5 A;  2EM9 A;  1A1I A;  2YU5 A;  2LCE A;  2EOE A;  5KL4 A;  2EPC A;  1JK2 A;  2YTO A;  2EQ0 A;  1JK1 A;  2EM2 A;  1TF3 A;  2JP9 A;  2EOX A;  3M99 B;  1UBD C;  1YSA C;  3MHH C;  1NCS A;  4F6N A;  2MKN A;  3EPH A;  4X9J A;  2YTE A;  4FK5 C;  2LT7 A;  2EJ4 A;  2EN3 A;  2EMX A;  1X6H A;  2EM7 A;  2EL6 A;  2EOJ A;  2DGC A;  2EM4 A;  2EMY A;  2CT1 A;  4IJD A;  2WCC 3;  2YTF A;  2EPP A;  1AAY A;  2EPU A;  2CTD A;  2YRK A;  2EOR A;  1G2F C;  2J7J A;  1A1H A;  2EOO A;  2EOQ A;  2YTN A;  2YTQ A;  2EOF A;  2LV2 A;  2EM3 A;  2WBT A;  2EM8 A;  4R2A A;  2EOI A;  4F2J C;  2DRP A;  2YRH A;  2YTG A;  2EML A;  2EPR A;  2EMW A;  2EMK A;  1TF6 A;  2ELZ A;  2EMC A;  2VRD A;  2RSI A;  3MHS C;  1X6E A;  1YUJ A;  1WJP A;  2LVH A;  1LLM C;  2HGH A;  2A25 A;  2ADR A;  2EMH A;  2YRM A;  2YTI A;  1A1F A;  2EMB A;  2GLI A;  1DGC A;  2EM6 A;  2EE8 A;  2MDG A;  4R2C A;  1RMD A;  1MEY C;  2EMF A;  2RPC A;  4R2R A;  3EPJ A;  2EOY A;  2ELY A;  1X5W A;  2ENA A;  2ENH A;  5KL7 A;  4WSG A;  2WBS A;  1B69 A; 
#chains in the Genus database with same CATH topology
 4DKK A;  1UHZ A;  3QG5 C;  2B7T A;  1MGT A;  1ZAA C;  4ZYD A;  4BCA A;  3ADI A;  4IS1 C;  1J26 A;  3J81 C;  2EPZ A;  4O24 A;  2JWO A;  3VHT B;  2V8Q B;  1F2I G;  1A1J A;  2DMI A;  2EOS A;  2RS7 A;  4GKK E;  3J7A G;  1G2D C;  1PJT A;  2EMA A;  2EMG A;  4NHR A;  2EN1 A;  2NA2 A;  5BR8 E;  1N32 E;  1ZU1 A;  2B3T B;  1PJS A;  5KL3 A;  2EMI A;  1A1G A;  2EL4 A;  4DV2 E;  2YTJ A;  1A1L A;  5TSE A;  4JI6 E;  4DR1 E;  1WHN A;  5KL6 A;  1BBG A;  2L2M A;  1TN9 A;  4DR6 E;  2EMZ A;  4NXM E;  1X6F A;  4X8W A;  3HXL A;  4N4R B;  2EM9 A;  3JU0 A;  2KHX A;  5KL5 A;  1A1I A;  4OX9 E;  2YU5 A;  3MSW A;  2LCE A;  1T38 A;  2EPC A;  3LLH A;  1JK2 A;  1GTK A;  4RHB B;  3DF6 A;  3BF2 A;  2N3G A;  1WHQ A;  3LML A;  5AC4 A;  2VQE E;  2EPN A;  1ZBT A;  1PDA A;  1HR0 E;  2MC5 A;  1L4S A;  2LBS B;  2EMX A;  4BHB A;  4DV0 E;  2MC6 A;  2EM4 A;  3AV0 A;  2BBG A;  3THN A;  4NXN E;  4WX9 A;  3THO B;  5A2Q C;  2YTQ A;  4LFA E;  2Q8U A;  2EOF A;  2LV2 A;  1KYQ A;  3F6G A;  4BBY A;  1IBL E;  4R2A A;  5LL6 R;  4F2J C;  2DRP A;  2RSM A;  4LTY A;  2EML A;  1STU A;  4LF6 E;  2EMK A;  2RSI A;  3L00 A;  2L92 A;  4BS9 A;  5AE1 A;  1WXR A;  1YUJ A;  2L2N A;  2F8B A;  1IQO A;  2ADR A;  2YTI A;  2E5L E;  1NEI A;  1DGC A;  2B7V A;  4BC7 A;  5CFF E;  2EE8 A;  2DIX A;  4R2C A;  1RMD A;  3ZOQ B;  5AAS A;  2EMF A;  3OML A;  5DNY A;  4BC9 A;  2ELY A;  2L3C A;  2ENA A;  2ENH A;  4WSG A;  2EPL X;  1QNT A;  4J8Z A;  3KWR A;  1X3C A;  2V87 A;  2UXB E;  1RQ0 A;  4O43 A;  1A1K A;  1ZR9 A;  2YSO A;  2EP3 A;  4B3M E;  4M9V C;  4JI1 E;  5IWA E;  3RMP A;  2HC5 A;  2I13 A;  4KHP E;  4JI7 E;  1XNR E;  1J5E E;  2BB8 A;  1XNQ E;  1HNZ E;  4DR7 E;  1IQS A;  2M9A A;  2EPA A;  2WBU A;  4GZN C;  2EM0 A;  1EKZ A;  4M2Z A;  2EWL A;  4M0V A;  2PRT A;  2L6M A;  2DSY A;  1GQE A;  1Z1B A;  4R2P A;  1YYK A;  1KJK A;  2V83 A;  4ZYE A;  4JI8 E;  4ZYH A;  2LRS A;  2GPI A;  1TF3 A;  2JP9 A;  1PJQ A;  4JV5 E;  2YT4 A;  4KZS A;  4F6N A;  2KON A;  2M4I A;  2EPM X;  3TQM A;  4K0K E;  4OOG C;  5LLQ A;  5A6J A;  2EL6 A;  4JI3 E;  2EMY A;  2V88 A;  2WCC 3;  2DB2 A;  2YTF A;  2CTD A;  4LF5 E;  1G2F C;  1A1H A;  1XMO E;  2EM3 A;  4RH8 A;  1YYO A;  4YY3 E;  2E1M A;  2EOI A;  3ADL A;  4YHH E;  2LJH A;  2YRH A;  2YTG A;  4B3S E;  5LMU E;  2EPR A;  4P78 A;  4I8O A;  1TF6 A;  4GKJ E;  2VE7 C;  2VRD A;  2EMC A;  4JI0 E;  4TUG A;  4BHC A;  1X6E A;  1YPN A;  2LVH A;  1LLM C;  2HGH A;  1IMU A;  4DR5 E;  1RC7 A;  2A25 A;  2EMH A;  2L8T A;  2YRM A;  1A1F A;  2EM6 A;  2V85 A;  2MDG A;  1QU6 A;  5A6B D;  4DUY E;  2EOY A;  5IT9 C;  2VF1 A;  1X5W A;  4LF9 E;  2FGG A;  3C4T A;  5KL7 A;  2UXC E;  5A6K A;  4HTG A;  2WBS A;  2D9H A;  2EPK X;  2CSH A;  2LE2 A;  2V89 A;  5IXM B;  4L8N A;  1WRJ A;  2EN7 A;  1YUI A;  4DV6 E;  2LTR A;  2MKD A;  1HNW E;  3FIG A;  3HQ1 A;  2EQ1 A;  4R2E A;  4MLQ A;  2YU8 A;  2WZO A;  2EM5 A;  2EN8 A;  2EOZ A;  2ENC A;  2FV4 B;  4DV3 E;  2DLK A;  5KL2 A;  5LMN E;  3IWD A;  3IWB A;  3AUZ A;  2R1F A;  2LMZ A;  4R2S A;  2JOB A;  1FJG E;  2EOH A;  4R2Q A;  1EH8 A;  4F9C B;  1X48 A;  3EPL A;  2YTD A;  1IBM E;  4F6M A;  2YTP A;  1BB8 A;  4DR3 E;  2EN6 A;  2UXD E;  3J7Y p;  3BBG A;  1FKA E;  2HJJ A;  4R2D A;  1P47 A;  5FLX C;  2EPO A;  3T1Y E;  4R03 A;  5A69 A;  2EOE A;  2HHH E;  5KL4 A;  2EQ0 A;  1JK1 A;  2EM2 A;  4KWY A;  2UU9 E;  4WXD A;  1UBD C;  1YSA C;  3JTZ A;  3MHH C;  1T4N A;  2MKN A;  2R76 A;  2RS6 A;  2LUQ A;  4X9J A;  2YTE A;  3JAM C;  1DI2 A;  3BGH A;  3T1H E;  1N33 E;  2LJU A;  2LT7 A;  2EJ4 A;  5A6A A;  4TUI A;  2EM7 A;  2DGC A;  4DMI A;  2CT1 A;  4X65 E;  2EPP A;  1AAY A;  2EPU A;  4LF4 E;  2EOR A;  5A6B A;  2J7J A;  2EOO A;  2EOQ A;  2WBT A;  2UUB E;  2EZ6 A;  2EM8 A;  4P7D A;  2I9I A;  4DUZ E;  2RTX A;  2EMW A;  4WPY A;  4LF7 E;  3MHS C;  1N36 E;  2JR1 A;  1T4O A;  1WJP A;  2YWQ A;  2H36 X;  1PKP A;  1EH6 A;  3ADJ A;  2GLI A;  1SR9 A;  4BMJ A;  4LFC E;  2KOU A;  4F9A B;  3HPS A;  2MDR A;  1MEY C;  2RPC A;  2NUG A;  2K4V A;  3ECR A;  3VK6 A;  1N34 E;  1DQ3 A;  3DJW A;  2YPN A;  3EQ1 A;  2JY9 A;  1B69 A;  2EN4 A;  2K7I A;  3K6Q A;  4L5N C;  1AH5 A;  4LU9 A;  3IWC A;  1BBO A;  2V86 A;  2NUE A;  1X49 A;  4JI4 E;  2L2K B;  2B9D A;  2RQL A;  4JYA E;  2N8X A;  2UUA E;  1ZBQ A;  4O5G A;  1IBK E;  4B3T E;  2EOM A;  1X47 A;  3OTO E;  2NAB A;  1N3G A;  3C4B A;  2F4V E;  5AE3 A;  2YSP A;  4GEQ B;  4Q35 B;  4AQY E;  1SFE A;  5IV8 B;  2JOX A;  2JPA A;  3H09 A;  2EPX A;  1UIL A;  3VYY A;  1XMQ E;  3UK3 C;  4DR2 E;  4HEI A;  3BID A;  2GHF A;  3ADG A;  3KZZ A;  1EH7 A;  2LO3 A;  4Q28 A;  2DLQ A;  2EQ3 A;  2EN2 A;  2L33 A;  3C6M A;  2NUF A;  4M30 A;  4WYQ B;  1UN6 B;  2EL5 A;  5AE2 A;  3C6K A;  2N3H A;  4X62 E;  2E72 A;  2ODR C;  2L3J A;  4DV4 E;  2M1S A;  3EPK A;  1YFH A;  4DV1 E;  4F9B B;  4B3R E;  4LF8 E;  1GZ6 A;  2IHR 1;  4O4K A;  2VQF E;  4X66 E;  2JYA A;  1I94 E;  2YTO A;  2UUC E;  2EOX A;  3M99 B;  3HPZ A;  2DMY A;  2YZT A;  1NCS A;  3EPH A;  5AC5 A;  2FTX B;  4DV5 E;  4FK5 C;  3P1X A;  2EN3 A;  1X6H A;  1YZ9 A;  2EOJ A;  5ADZ A;  4IJD A;  2LTS A;  2LUP B;  4DR4 E;  4WSP A;  2CPN A;  2YRK A;  4F54 A;  4ZYG A;  2YTN A;  4WFT A;  5F3W A;  3J80 C;  3F6H A;  4MLV A;  4R8O A;  3HTX A;  4JI2 E;  2M7Q A;  2ODR D;  4DV7 E;  2ELZ A;  4X64 E;  1O0W A;  5T6J A;  3VYX A;  4NZV A;  1YYW A;  2ZM6 E;  2JVA A;  2EMB A;  3KZY A;  4JI5 E;  1T39 A;  1HNX E;  4R2R A;  2JXP A;  3EPJ A;  4LFB E;  2G7H A;  1T4L B;  4WXC A; 
#chains in the Genus database with same CATH homology
 2D9H A;  2CSH A;  2EN4 A;  1BBO A;  1X3C A;  1ZAA C;  1A1K A;  2EOM A;  2EN7 A;  4IS1 C;  1ZR9 A;  2YSO A;  1YUI A;  2EP3 A;  4M9V C;  2EPZ A;  2NAB A;  3VHT B;  2MKD A;  1F2I G;  2EQ1 A;  2YSP A;  4R2E A;  1A1J A;  2I13 A;  2DMI A;  2EOS A;  2YU8 A;  2EM5 A;  2JPA A;  2EN8 A;  2EOZ A;  1G2D C;  2EMA A;  2EMG A;  2EPX A;  2EN1 A;  2BB8 A;  3UK3 C;  2ENC A;  2DLK A;  5KL2 A;  1ZU1 A;  2GHF A;  2LO3 A;  2M9A A;  5KL3 A;  2R1F A;  2EMI A;  4R2S A;  2DLQ A;  2EPA A;  2WBU A;  1A1G A;  2EOH A;  2EL4 A;  4R2Q A;  2EQ3 A;  2EM0 A;  2EN2 A;  4GZN C;  2YTJ A;  1A1L A;  3EPL A;  2YTD A;  4F6M A;  2PRT A;  1UN6 B;  2YTP A;  2EL5 A;  1BB8 A;  2EN6 A;  5KL6 A;  2E72 A;  1Z1B A;  1TN9 A;  4R2P A;  4R2D A;  2EMZ A;  1P47 A;  1X6F A;  3EPK A;  1KJK A;  5KL5 A;  2EM9 A;  1A1I A;  2YU5 A;  2LCE A;  2EOE A;  5KL4 A;  2EPC A;  1JK2 A;  2YTO A;  2EQ0 A;  1JK1 A;  2EM2 A;  1TF3 A;  2JP9 A;  2EOX A;  3M99 B;  1UBD C;  1YSA C;  3MHH C;  1NCS A;  4F6N A;  2MKN A;  3EPH A;  4X9J A;  2YTE A;  4FK5 C;  2LT7 A;  2EJ4 A;  2EN3 A;  2EMX A;  1X6H A;  2EM7 A;  2EL6 A;  2EOJ A;  2DGC A;  2EM4 A;  2EMY A;  2CT1 A;  4IJD A;  2WCC 3;  2YTF A;  2EPP A;  1AAY A;  2EPU A;  2CTD A;  2YRK A;  2EOR A;  1G2F C;  2J7J A;  1A1H A;  2EOO A;  2EOQ A;  2YTN A;  2YTQ A;  2EOF A;  2LV2 A;  2EM3 A;  2WBT A;  2EM8 A;  4R2A A;  2EOI A;  4F2J C;  2DRP A;  2YRH A;  2YTG A;  2EML A;  2EPR A;  2EMW A;  2EMK A;  1TF6 A;  2ELZ A;  2EMC A;  2VRD A;  2RSI A;  3MHS C;  1X6E A;  1YUJ A;  1WJP A;  2LVH A;  1LLM C;  2HGH A;  2A25 A;  2ADR A;  2EMH A;  2YRM A;  2YTI A;  1A1F A;  2EMB A;  2GLI A;  1DGC A;  2EM6 A;  2EE8 A;  2MDG A;  4R2C A;  1RMD A;  1MEY C;  2EMF A;  2RPC A;  4R2R A;  3EPJ A;  2EOY A;  2ELY A;  1X5W A;  2ENA A;  2ENH A;  5KL7 A;  4WSG A;  2WBS A;  1B69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...