2GHFA

Solution structure of the complete zinc-finger region of human zinc-fingers and homeoboxes 1 (zhx1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
b'MAHHHHHHNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNNQTIFEQTINDLTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc fingers and homeoboxes protein 1
publication title Solution structure of the zinc-finger region of human zinc-fingers and homeoboxes 1 (ZHX1)
rcsb
source organism Homo sapiens
molecule tags Transcription, metal binding protein
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18387 zf_C2H2_ZHX Zinc-fingers and homeoboxes C2H2 finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ghfA01
1YUJA 2EOOA 1AAYA 1A1GA 2EPAA 3EPKA 2ELYA 2EOSA 2YTJA 4R2PA 2EM2A 2EMFA 2MKDA 2EMGA 2EOFA 2YU8A 2VRDA 2EL4A 2I13A 1BB8A 4M9VC 2ENCA 4F2JC 2EMXA 4F6NA 2EN2A 2EL5A 2EQ3A 2EPXA 2YTOA 5KL3A 1A1FA 1X3CA 2ADRA 2YTNA 2EMWA 2A25A 2EOEA 4GZNC 2EOXA 4F6MA 2EN4A 1YUIA 2ELZA 2EM3A 2DGCA 2EPUA 2PRTA 2EOIA 2WBSA 5KL2A 1ZU1A 2LT7A 1TN9A 2EMLA 1TF3A 2NABA 2YRMA 4R2QA 2EORA 2EN3A 4R2RA 5KL6A 1JK1A 2MDGA 1UBDC 1X6FA 2EOQA 2YTQA 4WSGA 3MHHC 2DMIA 5KL5A 1F2IG 2EE8A 1NCSA 2ENAA 2EPCA 2EM9A 1DGCA 2EMYA 1X6HA 2YU5A 1UN6B 2LO3A 1ZAAC 2JP9A 2YTGA 2EOZA 2LVHA 1A1LA 3M99B 5KL4A 2CSHA 2EPZA 2EN6A 1LLMC 1RMDA 2EOMA 2WBTA 2EMKA 2HGHA 1A1IA 1X5WA 1WJPA 2EL6A 2EM7A 2R1FA 1Z1BA 2DRPA 2EMIA 4R2CA 2JPAA 2EPRA 2WCC3 2EM6A 1A1HA 1TF6A 2YRHA 2RPCA 3UK3C 2EJ4A 3EPHA 1G2FC 2WBUA 2EMAA 2EN1A 2YSOA 1B69A 2CTDA 4R2EA 2EN8A 2YSPA 5KL7A 4R2SA 3EPLA 1P47A 1A1JA 2EOHA 2ENHA 2GHFA 2MKNA 3VHTB 2EMBA 1MEYC 2EMCA 2EM4A 1X6EA 2EPPA 2BB8A 2YTEA 4R2AA 2D9HA 2RSIA 2YTFA 2YTIA 2E72A 2EM8A 2YTPA 2DLQA 2YTDA 2LCEA 2EMHA 3EPJA 2EM0A 2GLIA 1A1KA 2DLKA 2EQ0A 2EM5A 3MHSC 2M9AA 4IS1C 1JK2A 2LV2A 2CT1A 4IJDA 4FK5C 2EOJA 2J7JA 1ZR9A 2EP3A 2EQ1A 4X9JA 2EN7A 1G2DC 1KJKA 1BBOA 2EMZA 2YRKA 4R2DA 1YSAC 2EOYA
chains in the Genus database with same CATH superfamily
3HXLA 3OTOE 5AC5A 3ZOQB 3J80C 2M7QA 2FGGA 2YTJA 3K6QA 2UUBE 1FJGE 2EMFA 1GTKA 4O5GA 2YU8A 2N3GA 5FLXC 3HQ1A 4GKKE 1YZ9A 2KHXA 2EMXA 5ADZA 2LBSB 2UXCE 2EN2A 2EQ3A 2MC6A 1X47A 3JU0A 2YTOA 1PKPA 2EMWA 3J7Yp 1XMOE 1YUIA 4JI4E 2ELZA 2EM3A 2G7HA 4O4KA 3C4TA 4WYQB 2WBSA 5KL2A 2LRSA 1TN9A 4DR4E 3THOB 2I9IA 1YYOA 4BHBA 2EORA 2JR1A 5KL6A 2UXBE 1JK1A 3ADLA 5A2QC 2Q8UA 1YYWA 3QG5C 2VQEE 2DMIA 2JOBA 3ADJA 2EE8A 3VYYA 1SFEA 1HR0E 2LE2A 1UN6B 1T4NA 1N36E 1DI2A 4DR3E 2EN6A 2RTXA 1RMDA 2EOMA 2H36X 2HGHA 4M30A 1WJPA 2R1FA 2EMIA 4R2CA 4YHHE 2RPCA 4TUGA 1G2FC 4TUIA 2EN1A 5T6JA 4DR6E 3EPLA 1P47A 2NUFA 3ADGA 4BMJA 4DV2E 2RSIA 3F6GA 2YTIA 3OMLA 3DF6A 5AC4A 1PJSA 4X8WA 1PJTA 2ODRC 2L6MA 2VQFE 3EQ1A 4DKKA 2GLIA 1A1KA 1YFHA 2DLKA 2EQ0A 3AUZA 2M9AA 4NXNE 2V8QB 4DUYE 1IQSA 2KOUA 4YY3E 4X62E 4X9JA 5A6BD 1X48A 2WZOA 4JI2E 2UXDE 2EMZA 4JYAE 4B3ME 1YUJA 2EPAA 4O43A 4R03A 1WXRA 2ELYA 3ECRA 4R2PA 1AH5A 4ZYGA 2NUEA 2EPLX 2IHR1 2MKDA 3AV0A 2EOFA 4NXME 2EL4A 2I13A 4OX9E 2ENCA 2B9DA 2UUCE 4WXCA 2V85A 4DV7E 1IBLE 2EL5A 3MSWA 1A1FA 1X3CA 2ADRA 2YTNA 2A25A 3BF2A 4GZNC 1BBGA 4BCAA 1FKAE 1T4LB 2DGCA 1YPNA 1WHQA 3J7AG 2LUQA 2GPIA 4R2RA 4BHCA 2EOQA 4N4RB 4JI1E 4WSGA 1EH8A 1EH6A 4DV1E 4F9BB 1UHZA 2EM9A 1DGCA 2V87A 2YU5A 4BS9A 2L3CA 4DR2E 2JVAA 4LU9A 4LFCE 2YTGA 3HPZA 2N3HA 2JOXA 3M99B 5LMUE 1A1LA 4MLQA 2F8BA 2RSMA 2FTXB 4JV5E 4KWYA 1PDAA 1X49A 4DUZE 3IWDA 2DRPA 1KYQA 2FV4B 4KHPE 1Z1BA 2JPAA 2LUPB 2EPRA 2V83A 2EM6A 2B7VA 3VYXA 1TF6A 2YRHA 3UK3C 3EPHA 4M2ZA 2ODRD 4P7DA 5IV8B 2YSPA 5KL7A 4R2SA 5IWAE 2L2KB 2GHFA 3JTZA 2YPNA 1XNQE 3VHTB 4Q35B 1MEYC 1X6EA 4JI6E 2E72A 2K4VA 2V89A 1STUA 5BR8E 2BBGA 4ZYHA 3EPJA 5AE2A 4F9AB 4B3SE 2LTRA 4WXDA 4IS1C 1JK2A 4IJDA 2LJHA 2YT4A 2DIXA 2J7JA 1HNZE 4AQYE 1ZR9A 3LMLA 1NEIA 2EQ1A 4X65E 2EN7A 3BIDA 1J26A 4NHRA 2DMYA 3HTXA 4HTGA 4DV6E 3LLHA 2EOOA 4HEIA 1A1GA 3EPKA 2EOSA 4DV0E 2EMGA 1MGTA 4M9VC 3ADIA 4LFAE 4F6NA 2EPMX 4DR7E 4WPYA 1T38A 5A6AA 5LMNE 2EOXA 2JYAA 1I94E 2EOIA 2LT7A 1ZU1A 3KZZA 2NABA 1RC7A 4R2QA 1ZBTA 5DNYA 4LF6E 1O0WA 2EN3A 3IWBA 1YYKA 4JI7E 1X6FA 2E1MA 2JWOA 3MHHC 1GQEA 1F2IG 1XNRE 2EPCA 5A6JA 4DMIA 1J5EE 2EMYA 2JP9A 3DJWA 4MLVA 2EOZA 2N8XA 1RQ0A 2CSHA 2L92A 1LLMC 4JI8E 1PJQA 1IBME 4DV5E 2EL6A 2EM7A 2ZM6E 2LJUA 2WBUA 2EMAA 1B69A 2YSOA 2K7IA 2EN8A 1A1JA 1SR9A 4BC7A 2ENHA 2MKNA 4RH8A 2EMCA 2EM4A 2YTEA 2BB8A 2UU9E 2YTFA 2F4VE 3BGHA 2L3JA 2DLQA 4F9CB 2EPNA 5AE1A 4X64E 3T1HE 2EMHA 2JXPA 2EM0A 2RS6A 5IXMB 2E5LE 4R8OA 2B7TA 1N32E 3KZYA 3MHSC 3C6MA 1DQ3A 2EPOA 2LV2A 4LF8E 3L00A 2EP3A 1T4OA 1KJKA 2LMZA 1BBOA 2HJJA 3RMPA 4DV4E 4Q28A 2V86A 4R2DA 1YSAC 3HPSA 5AASA 2KONA 4L8NA 4DV3E 1GZ6A 1AAYA 4K0KE 1QNTA 3TQMA 2EM2A 4J8ZA 1N33E 3J81C 4B3TE 3C4BA 2NA2A 4DR5E 2VRDA 4WX9A 1BB8A 1EH7A 5AE3A 2R76A 2M1SA 4F2JC 2B3TB 1HNXE 3H09A 4O24A 1T39A 2CPNA 2EPXA 3KWRA 5KL3A 3BBGA 1WHNA 2L2MA 2EOEA 1N34E 4LF7E 4F6MA 1IMUA 2EN4A 4DR1E 1UILA 2VF1A 4BBYA 1N3GA 2EPUA 2PRTA 4JI0E 3JAMC 2M4IA 2YZTA 2EMLA 1XMQE 4RHBB 1TF3A 2YRMA 4LF5E 4LTYA 4JI3E 5A6KA 2L33A 5F3WA 2MDGA 3F6HA 1UBDC 4WSPA 4B3RE 4ZYEA 2RQLA 2YTQA 4LF4E 4KZSA 2DSYA 4X66E 5KL5A 4BC9A 2HC5A 2LTSA 1NCSA 2ENAA 2MDRA 1X6HA 2VE7C 2JY9A 2LO3A 4JI5E 1ZAAC 2EWLA 3C6KA 5A69A 5IT9C 2HHHE 2LVHA 2EZ6A 5KL4A 2EPZA 1WRJA 2L2NA 4M0VA 4WFTA 2WBTA 2EMKA 1A1IA 1X5WA 4ZYDA 2UUAE 5LLQA 2WCC3 5CFFE 2V88A 1A1HA 4LF9E 3IWCA 4L5NC 3T1YE 2EJ4A 1ZBQA 2DB2A 4OOGC 1EKZA 2NUGA 2MC5A 2CTDA 4R2EA 1L4SA 2EOHA 5A6BA 5LL6R 2EMBA 2EPPA 4R2AA 2D9HA 3VK6A 2EM8A 2YTPA 2EPKX 2YTDA 1IQOA 2LCEA 4I8OA 4LFBE 4NZVA 2EM5A 2L8TA 3P1XA 1QU6A 4P78A 4F54A 2CT1A 4GEQB 3FIGA 4FK5C 2EOJA 2YWQA 1HNWE 4GKJE 1IBKE 1G2DC 2RS7A 5TSEA 2YRKA 3THNA 2EOYA
chains in the Genus database with same CATH topology
1YUJA 2EOOA 1AAYA 1A1GA 2EPAA 3EPKA 2ELYA 2EOSA 2YTJA 4R2PA 2EM2A 2EMFA 2MKDA 2EMGA 2EOFA 2YU8A 2VRDA 2EL4A 2I13A 1BB8A 4M9VC 2ENCA 4F2JC 2EMXA 4F6NA 2EN2A 2EL5A 2EQ3A 2EPXA 2YTOA 5KL3A 1A1FA 1X3CA 2ADRA 2YTNA 2EMWA 2A25A 2EOEA 4GZNC 2EOXA 4F6MA 2EN4A 1YUIA 2ELZA 2EM3A 2DGCA 2EPUA 2PRTA 2EOIA 2WBSA 5KL2A 1ZU1A 2LT7A 1TN9A 2EMLA 1TF3A 2NABA 2YRMA 4R2QA 2EORA 2EN3A 4R2RA 5KL6A 1JK1A 2MDGA 1UBDC 1X6FA 2EOQA 2YTQA 4WSGA 3MHHC 2DMIA 5KL5A 1F2IG 2EE8A 1NCSA 2ENAA 2EPCA 2EM9A 1DGCA 2EMYA 1X6HA 2YU5A 1UN6B 2LO3A 1ZAAC 2JP9A 2YTGA 2EOZA 2LVHA 1A1LA 3M99B 5KL4A 2CSHA 2EPZA 2EN6A 1LLMC 1RMDA 2EOMA 2WBTA 2EMKA 2HGHA 1A1IA 1X5WA 1WJPA 2EL6A 2EM7A 2R1FA 1Z1BA 2DRPA 2EMIA 4R2CA 2JPAA 2EPRA 2WCC3 2EM6A 1A1HA 1TF6A 2YRHA 2RPCA 3UK3C 2EJ4A 3EPHA 1G2FC 2WBUA 2EMAA 2EN1A 2YSOA 1B69A 2CTDA 4R2EA 2EN8A 2YSPA 5KL7A 4R2SA 3EPLA 1P47A 1A1JA 2EOHA 2ENHA 2GHFA 2MKNA 3VHTB 2EMBA 1MEYC 2EMCA 2EM4A 1X6EA 2EPPA 2BB8A 2YTEA 4R2AA 2D9HA 2RSIA 2YTFA 2YTIA 2E72A 2EM8A 2YTPA 2DLQA 2YTDA 2LCEA 2EMHA 3EPJA 2EM0A 2GLIA 1A1KA 2DLKA 2EQ0A 2EM5A 3MHSC 2M9AA 4IS1C 1JK2A 2LV2A 2CT1A 4IJDA 4FK5C 2EOJA 2J7JA 1ZR9A 2EP3A 2EQ1A 4X9JA 2EN7A 1G2DC 1KJKA 1BBOA 2EMZA 2YRKA 4R2DA 1YSAC 2EOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUJ A;  2EOO A;  1AAY A;  1A1G A;  2EPA A;  3EPK A;  2ELY A;  2EOS A;  2YTJ A;  4R2P A;  2EM2 A;  2EMF A;  2MKD A;  2EMG A;  2EOF A;  2YU8 A;  2VRD A;  2EL4 A;  2I13 A;  1BB8 A;  4M9V C;  2ENC A;  4F2J C;  2EMX A;  4F6N A;  2EN2 A;  2EL5 A;  2EQ3 A;  2EPX A;  2YTO A;  5KL3 A;  1A1F A;  1X3C A;  2ADR A;  2YTN A;  2EMW A;  2A25 A;  2EOE A;  4GZN C;  2EOX A;  4F6M A;  2EN4 A;  1YUI A;  2ELZ A;  2EM3 A;  2DGC A;  2EPU A;  2PRT A;  2EOI A;  2WBS A;  5KL2 A;  1ZU1 A;  2LT7 A;  1TN9 A;  2EML A;  1TF3 A;  2NAB A;  2YRM A;  4R2Q A;  2EOR A;  2EN3 A;  4R2R A;  5KL6 A;  1JK1 A;  2MDG A;  1UBD C;  1X6F A;  2EOQ A;  2YTQ A;  4WSG A;  3MHH C;  2DMI A;  5KL5 A;  1F2I G;  2EE8 A;  1NCS A;  2ENA A;  2EPC A;  2EM9 A;  1DGC A;  2EMY A;  1X6H A;  2YU5 A;  1UN6 B;  2LO3 A;  1ZAA C;  2JP9 A;  2YTG A;  2EOZ A;  2LVH A;  1A1L A;  3M99 B;  5KL4 A;  2CSH A;  2EPZ A;  2EN6 A;  1LLM C;  1RMD A;  2EOM A;  2WBT A;  2EMK A;  2HGH A;  1A1I A;  1X5W A;  1WJP A;  2EL6 A;  2EM7 A;  2R1F A;  1Z1B A;  2DRP A;  2EMI A;  4R2C A;  2JPA A;  2EPR A;  2WCC 3;  2EM6 A;  1A1H A;  1TF6 A;  2YRH A;  2RPC A;  3UK3 C;  2EJ4 A;  3EPH A;  1G2F C;  2WBU A;  2EMA A;  2EN1 A;  2YSO A;  1B69 A;  2CTD A;  4R2E A;  2EN8 A;  2YSP A;  5KL7 A;  4R2S A;  3EPL A;  1P47 A;  1A1J A;  2EOH A;  2ENH A;  2GHF A;  2MKN A;  3VHT B;  2EMB A;  1MEY C;  2EMC A;  2EM4 A;  1X6E A;  2EPP A;  2BB8 A;  2YTE A;  4R2A A;  2D9H A;  2RSI A;  2YTF A;  2YTI A;  2E72 A;  2EM8 A;  2YTP A;  2DLQ A;  2YTD A;  2LCE A;  2EMH A;  3EPJ A;  2EM0 A;  2GLI A;  1A1K A;  2DLK A;  2EQ0 A;  2EM5 A;  3MHS C;  2M9A A;  4IS1 C;  1JK2 A;  2LV2 A;  2CT1 A;  4IJD A;  4FK5 C;  2EOJ A;  2J7J A;  1ZR9 A;  2EP3 A;  2EQ1 A;  4X9J A;  2EN7 A;  1G2D C;  1KJK A;  1BBO A;  2EMZ A;  2YRK A;  4R2D A;  1YSA C;  2EOY A; 
#chains in the Genus database with same CATH topology
 3HXL A;  3OTO E;  5AC5 A;  3ZOQ B;  3J80 C;  2M7Q A;  2FGG A;  2YTJ A;  3K6Q A;  2UUB E;  1FJG E;  2EMF A;  1GTK A;  4O5G A;  2YU8 A;  2N3G A;  5FLX C;  3HQ1 A;  4GKK E;  1YZ9 A;  2KHX A;  2EMX A;  5ADZ A;  2LBS B;  2UXC E;  2EN2 A;  2EQ3 A;  2MC6 A;  1X47 A;  3JU0 A;  2YTO A;  1PKP A;  2EMW A;  3J7Y p;  1XMO E;  1YUI A;  4JI4 E;  2ELZ A;  2EM3 A;  2G7H A;  4O4K A;  3C4T A;  4WYQ B;  2WBS A;  5KL2 A;  2LRS A;  1TN9 A;  4DR4 E;  3THO B;  2I9I A;  1YYO A;  4BHB A;  2EOR A;  2JR1 A;  5KL6 A;  2UXB E;  1JK1 A;  3ADL A;  5A2Q C;  2Q8U A;  1YYW A;  3QG5 C;  2VQE E;  2DMI A;  2JOB A;  3ADJ A;  2EE8 A;  3VYY A;  1SFE A;  1HR0 E;  2LE2 A;  1UN6 B;  1T4N A;  1N36 E;  1DI2 A;  4DR3 E;  2EN6 A;  2RTX A;  1RMD A;  2EOM A;  2H36 X;  2HGH A;  4M30 A;  1WJP A;  2R1F A;  2EMI A;  4R2C A;  4YHH E;  2RPC A;  4TUG A;  1G2F C;  4TUI A;  2EN1 A;  5T6J A;  4DR6 E;  3EPL A;  1P47 A;  2NUF A;  3ADG A;  4BMJ A;  4DV2 E;  2RSI A;  3F6G A;  2YTI A;  3OML A;  3DF6 A;  5AC4 A;  1PJS A;  4X8W A;  1PJT A;  2ODR C;  2L6M A;  2VQF E;  3EQ1 A;  4DKK A;  2GLI A;  1A1K A;  1YFH A;  2DLK A;  2EQ0 A;  3AUZ A;  2M9A A;  4NXN E;  2V8Q B;  4DUY E;  1IQS A;  2KOU A;  4YY3 E;  4X62 E;  4X9J A;  5A6B D;  1X48 A;  2WZO A;  4JI2 E;  2UXD E;  2EMZ A;  4JYA E;  4B3M E;  1YUJ A;  2EPA A;  4O43 A;  4R03 A;  1WXR A;  2ELY A;  3ECR A;  4R2P A;  1AH5 A;  4ZYG A;  2NUE A;  2EPL X;  2IHR 1;  2MKD A;  3AV0 A;  2EOF A;  4NXM E;  2EL4 A;  2I13 A;  4OX9 E;  2ENC A;  2B9D A;  2UUC E;  4WXC A;  2V85 A;  4DV7 E;  1IBL E;  2EL5 A;  3MSW A;  1A1F A;  1X3C A;  2ADR A;  2YTN A;  2A25 A;  3BF2 A;  4GZN C;  1BBG A;  4BCA A;  1FKA E;  1T4L B;  2DGC A;  1YPN A;  1WHQ A;  3J7A G;  2LUQ A;  2GPI A;  4R2R A;  4BHC A;  2EOQ A;  4N4R B;  4JI1 E;  4WSG A;  1EH8 A;  1EH6 A;  4DV1 E;  4F9B B;  1UHZ A;  2EM9 A;  1DGC A;  2V87 A;  2YU5 A;  4BS9 A;  2L3C A;  4DR2 E;  2JVA A;  4LU9 A;  4LFC E;  2YTG A;  3HPZ A;  2N3H A;  2JOX A;  3M99 B;  5LMU E;  1A1L A;  4MLQ A;  2F8B A;  2RSM A;  2FTX B;  4JV5 E;  4KWY A;  1PDA A;  1X49 A;  4DUZ E;  3IWD A;  2DRP A;  1KYQ A;  2FV4 B;  4KHP E;  1Z1B A;  2JPA A;  2LUP B;  2EPR A;  2V83 A;  2EM6 A;  2B7V A;  3VYX A;  1TF6 A;  2YRH A;  3UK3 C;  3EPH A;  4M2Z A;  2ODR D;  4P7D A;  5IV8 B;  2YSP A;  5KL7 A;  4R2S A;  5IWA E;  2L2K B;  2GHF A;  3JTZ A;  2YPN A;  1XNQ E;  3VHT B;  4Q35 B;  1MEY C;  1X6E A;  4JI6 E;  2E72 A;  2K4V A;  2V89 A;  1STU A;  5BR8 E;  2BBG A;  4ZYH A;  3EPJ A;  5AE2 A;  4F9A B;  4B3S E;  2LTR A;  4WXD A;  4IS1 C;  1JK2 A;  4IJD A;  2LJH A;  2YT4 A;  2DIX A;  2J7J A;  1HNZ E;  4AQY E;  1ZR9 A;  3LML A;  1NEI A;  2EQ1 A;  4X65 E;  2EN7 A;  3BID A;  1J26 A;  4NHR A;  2DMY A;  3HTX A;  4HTG A;  4DV6 E;  3LLH A;  2EOO A;  4HEI A;  1A1G A;  3EPK A;  2EOS A;  4DV0 E;  2EMG A;  1MGT A;  4M9V C;  3ADI A;  4LFA E;  4F6N A;  2EPM X;  4DR7 E;  4WPY A;  1T38 A;  5A6A A;  5LMN E;  2EOX A;  2JYA A;  1I94 E;  2EOI A;  2LT7 A;  1ZU1 A;  3KZZ A;  2NAB A;  1RC7 A;  4R2Q A;  1ZBT A;  5DNY A;  4LF6 E;  1O0W A;  2EN3 A;  3IWB A;  1YYK A;  4JI7 E;  1X6F A;  2E1M A;  2JWO A;  3MHH C;  1GQE A;  1F2I G;  1XNR E;  2EPC A;  5A6J A;  4DMI A;  1J5E E;  2EMY A;  2JP9 A;  3DJW A;  4MLV A;  2EOZ A;  2N8X A;  1RQ0 A;  2CSH A;  2L92 A;  1LLM C;  4JI8 E;  1PJQ A;  1IBM E;  4DV5 E;  2EL6 A;  2EM7 A;  2ZM6 E;  2LJU A;  2WBU A;  2EMA A;  1B69 A;  2YSO A;  2K7I A;  2EN8 A;  1A1J A;  1SR9 A;  4BC7 A;  2ENH A;  2MKN A;  4RH8 A;  2EMC A;  2EM4 A;  2YTE A;  2BB8 A;  2UU9 E;  2YTF A;  2F4V E;  3BGH A;  2L3J A;  2DLQ A;  4F9C B;  2EPN A;  5AE1 A;  4X64 E;  3T1H E;  2EMH A;  2JXP A;  2EM0 A;  2RS6 A;  5IXM B;  2E5L E;  4R8O A;  2B7T A;  1N32 E;  3KZY A;  3MHS C;  3C6M A;  1DQ3 A;  2EPO A;  2LV2 A;  4LF8 E;  3L00 A;  2EP3 A;  1T4O A;  1KJK A;  2LMZ A;  1BBO A;  2HJJ A;  3RMP A;  4DV4 E;  4Q28 A;  2V86 A;  4R2D A;  1YSA C;  3HPS A;  5AAS A;  2KON A;  4L8N A;  4DV3 E;  1GZ6 A;  1AAY A;  4K0K E;  1QNT A;  3TQM A;  2EM2 A;  4J8Z A;  1N33 E;  3J81 C;  4B3T E;  3C4B A;  2NA2 A;  4DR5 E;  2VRD A;  4WX9 A;  1BB8 A;  1EH7 A;  5AE3 A;  2R76 A;  2M1S A;  4F2J C;  2B3T B;  1HNX E;  3H09 A;  4O24 A;  1T39 A;  2CPN A;  2EPX A;  3KWR A;  5KL3 A;  3BBG A;  1WHN A;  2L2M A;  2EOE A;  1N34 E;  4LF7 E;  4F6M A;  1IMU A;  2EN4 A;  4DR1 E;  1UIL A;  2VF1 A;  4BBY A;  1N3G A;  2EPU A;  2PRT A;  4JI0 E;  3JAM C;  2M4I A;  2YZT A;  2EML A;  1XMQ E;  4RHB B;  1TF3 A;  2YRM A;  4LF5 E;  4LTY A;  4JI3 E;  5A6K A;  2L33 A;  5F3W A;  2MDG A;  3F6H A;  1UBD C;  4WSP A;  4B3R E;  4ZYE A;  2RQL A;  2YTQ A;  4LF4 E;  4KZS A;  2DSY A;  4X66 E;  5KL5 A;  4BC9 A;  2HC5 A;  2LTS A;  1NCS A;  2ENA A;  2MDR A;  1X6H A;  2VE7 C;  2JY9 A;  2LO3 A;  4JI5 E;  1ZAA C;  2EWL A;  3C6K A;  5A69 A;  5IT9 C;  2HHH E;  2LVH A;  2EZ6 A;  5KL4 A;  2EPZ A;  1WRJ A;  2L2N A;  4M0V A;  4WFT A;  2WBT A;  2EMK A;  1A1I A;  1X5W A;  4ZYD A;  2UUA E;  5LLQ A;  2WCC 3;  5CFF E;  2V88 A;  1A1H A;  4LF9 E;  3IWC A;  4L5N C;  3T1Y E;  2EJ4 A;  1ZBQ A;  2DB2 A;  4OOG C;  1EKZ A;  2NUG A;  2MC5 A;  2CTD A;  4R2E A;  1L4S A;  2EOH A;  5A6B A;  5LL6 R;  2EMB A;  2EPP A;  4R2A A;  2D9H A;  3VK6 A;  2EM8 A;  2YTP A;  2EPK X;  2YTD A;  1IQO A;  2LCE A;  4I8O A;  4LFB E;  4NZV A;  2EM5 A;  2L8T A;  3P1X A;  1QU6 A;  4P78 A;  4F54 A;  2CT1 A;  4GEQ B;  3FIG A;  4FK5 C;  2EOJ A;  2YWQ A;  1HNW E;  4GKJ E;  1IBK E;  1G2D C;  2RS7 A;  5TSE A;  2YRK A;  3THN A;  2EOY A; 
#chains in the Genus database with same CATH homology
 1YUJ A;  2EOO A;  1AAY A;  1A1G A;  2EPA A;  3EPK A;  2ELY A;  2EOS A;  2YTJ A;  4R2P A;  2EM2 A;  2EMF A;  2MKD A;  2EMG A;  2EOF A;  2YU8 A;  2VRD A;  2EL4 A;  2I13 A;  1BB8 A;  4M9V C;  2ENC A;  4F2J C;  2EMX A;  4F6N A;  2EN2 A;  2EL5 A;  2EQ3 A;  2EPX A;  2YTO A;  5KL3 A;  1A1F A;  1X3C A;  2ADR A;  2YTN A;  2EMW A;  2A25 A;  2EOE A;  4GZN C;  2EOX A;  4F6M A;  2EN4 A;  1YUI A;  2ELZ A;  2EM3 A;  2DGC A;  2EPU A;  2PRT A;  2EOI A;  2WBS A;  5KL2 A;  1ZU1 A;  2LT7 A;  1TN9 A;  2EML A;  1TF3 A;  2NAB A;  2YRM A;  4R2Q A;  2EOR A;  2EN3 A;  4R2R A;  5KL6 A;  1JK1 A;  2MDG A;  1UBD C;  1X6F A;  2EOQ A;  2YTQ A;  4WSG A;  3MHH C;  2DMI A;  5KL5 A;  1F2I G;  2EE8 A;  1NCS A;  2ENA A;  2EPC A;  2EM9 A;  1DGC A;  2EMY A;  1X6H A;  2YU5 A;  1UN6 B;  2LO3 A;  1ZAA C;  2JP9 A;  2YTG A;  2EOZ A;  2LVH A;  1A1L A;  3M99 B;  5KL4 A;  2CSH A;  2EPZ A;  2EN6 A;  1LLM C;  1RMD A;  2EOM A;  2WBT A;  2EMK A;  2HGH A;  1A1I A;  1X5W A;  1WJP A;  2EL6 A;  2EM7 A;  2R1F A;  1Z1B A;  2DRP A;  2EMI A;  4R2C A;  2JPA A;  2EPR A;  2WCC 3;  2EM6 A;  1A1H A;  1TF6 A;  2YRH A;  2RPC A;  3UK3 C;  2EJ4 A;  3EPH A;  1G2F C;  2WBU A;  2EMA A;  2EN1 A;  2YSO A;  1B69 A;  2CTD A;  4R2E A;  2EN8 A;  2YSP A;  5KL7 A;  4R2S A;  3EPL A;  1P47 A;  1A1J A;  2EOH A;  2ENH A;  2GHF A;  2MKN A;  3VHT B;  2EMB A;  1MEY C;  2EMC A;  2EM4 A;  1X6E A;  2EPP A;  2BB8 A;  2YTE A;  4R2A A;  2D9H A;  2RSI A;  2YTF A;  2YTI A;  2E72 A;  2EM8 A;  2YTP A;  2DLQ A;  2YTD A;  2LCE A;  2EMH A;  3EPJ A;  2EM0 A;  2GLI A;  1A1K A;  2DLK A;  2EQ0 A;  2EM5 A;  3MHS C;  2M9A A;  4IS1 C;  1JK2 A;  2LV2 A;  2CT1 A;  4IJD A;  4FK5 C;  2EOJ A;  2J7J A;  1ZR9 A;  2EP3 A;  2EQ1 A;  4X9J A;  2EN7 A;  1G2D C;  1KJK A;  1BBO A;  2EMZ A;  2YRK A;  4R2D A;  1YSA C;  2EOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...