4WYQB

Crystal structure of the dicer-trbp interface
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
ALGPACCRVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLKIMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dicer-TRBP Complex Formation Ensures Accurate Mammalian MicroRNA Biogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Endoribonuclease Dicer
total genus 20
structure length 75
sequence length 75
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wyqB00
4JI5E 4JI8E 5BR8E 4DV0E 4GKJE 2RTXA 1IBKE 4DV5E 2L3JA 4JI6E 3ADLA 1J5EE 4M2ZA 2NA2A 4LF5E 4LF9E 4JYAE 1N34E 2RS6A 3C4TA 4WYQB 4DR1E 1ZBTA 2L2NA 1YZ9A 4LFAE 4X65E 2KHXA 4DV2E 1HNWE 2LUQA 4DUZE 1HNXE 5LMNE 2MDRA 2LBSB 4DR7E 2NUFA 4DV3E 2JY9A 3ADGA 1X47A 4DR3E 2DB2A 1XMQE 4B3TE 4DV7E 4B3SE 1WHNA 2LTSA 2VQFE 2UXBE 2F4VE 2N3GA 1XNRE 1T4NA 4M30A 1STUA 2L33A 2CPNA 4LF8E 4LF4E 4JI7E 4DV1E 1YYKA 1EKZA 2B3TB 3C4BA 5IWAE 4JI2E 2LTRA 4DV6E 3J7Yp 1N36E 4JI4E 3VYXA 2B7VA 2L2MA 2RSMA 1UILA 2YT4A 2DIXA 2IHR1 4AQYE 1YYOA 4LF6E 1IBME 1QU6A 1I94E 1WHQA 2VQEE 2E5LE 4LF7E 2L3CA 4GKKE 1DI2A 1XNQE 1PKPA 2UXDE 2EZ6A 2NUEA 2ZM6E 4DR4E 4KHPE 1N33E 1X48A 2UUAE 3OTOE 1UHZA 4JI1E 4DV4E 1FKAE 4NXME 4B3RE 3ADJA 2B7TA 4YY3E 5CFFE 4OOGC 4X8WA 3LLHA 4OX9E 4K0KE 1HR0E 4DKKA 1XMOE 3T1HE 4JV5E 4NXNE 2DMYA 1RC7A 1RQ0A 3HTXA 2L2KB 4DUYE 5LMUE 3T1YE 2JVAA 1T4LB 3VYYA 4X66E 4DR2E 1YYWA 3P1XA 3ADIA 1FJGE 2UXCE 4WFTA 2NUGA 4X64E 1IBLE 2UU9E 4DR5E 4X62E 4YHHE 4LFCE 2LRSA 2HHHE 4B3ME 1O0WA 1HNZE 1GQEA 1N32E 1T4OA 4DR6E 2N3HA 2LUPB 4LFBE 1X49A 2UUCE 1J26A 2UUBE 4JI3E 2RS7A 2LJHA 4JI0E
chains in the Genus database with same CATH superfamily
4TUGA 3IWBA 4O4KA 4JI8E 1LLMC 1YPNA 4ZYDA 2JWOA 1X6HA 4GZNC 2EOZA 2WBSA 2EPNA 4LF5E 3AV0A 2RS6A 4DR1E 2BBGA 2GHFA 4F6MA 4X65E 2EL5A 4BHBA 1MEYC 2EPPA 2EMWA 2LT7A 2V89A 2NUFA 2LCEA 3ADGA 2EOXA 2V85A 2DB2A 3THOB 4ZYEA 1XMQE 2K4VA 2FV4B 2EL4A 2UXBE 2LTSA 2N3GA 4M30A 1STUA 1JK2A 2V86A 2B3TB 4WX9A 4JI2E 4DV6E 2JP9A 3J7Yp 1N36E 3K6QA 2EM3A 3TQMA 2HGHA 3JAMC 2B7VA 2MKDA 2V83A 2YT4A 4LF6E 4AQYE 4GKKE 1WHQA 2L3CA 2WZOA 2YTOA 2NUEA 4DR4E 1Z1BA 5A6AA 4R2CA 3M99B 1FKAE 2B7TA 4YY3E 5CFFE 2E1MA 2EOEA 2JOXA 5KL4A 5LLQA 1X5WA 1XMOE 3T1HE 4NXNE 2DMYA 1RQ0A 3H09A 2YU8A 4LU9A 2JVAA 2EPMX 2EM6A 2EOFA 2N8XA 4BCAA 2EMZA 4ZYHA 1T4LB 4NZVA 4BMJA 5AASA 3VYYA 4X66E 1AH5A 2M1SA 3P1XA 2NUGA 4J8ZA 1IBLE 2UU9E 4LFCE 2EPAA 3EPKA 1G2DC 4B3ME 2EM9A 2EMFA 1B69A 2N3HA 2YPNA 3IWDA 5AC4A 4R2AA 1J26A 2UUBE 4JI3E 2RS7A 2LJHA 1UILA 4JI5E 2M9AA 5ADZA 3C6MA 3L00A 1IBKE 4DV5E 2FGGA 3EPHA 1SFEA 4WSPA 4WSGA 4BBYA 4LF9E 4JYAE 1N34E 2L6MA 3C4TA 1ZBTA 1YZ9A 2EPUA 2EQ3A 1T39A 4BC9A 5IXMB 4N4RB 2G7HA 2LUQA 4DUZE 3C6KA 1PJTA 2M4IA 1X47A 2ODRC 2EQ1A 4DR3E 3HXLA 5A69A 4GEQB 2MC6A 1L4SA 1KJKA 3JU0A 3AUZA 2EM5A 1YUIA 4B3TE 5IT9C 2V88A 5DNYA 4B3SE 1WHNA 2YTGA 2VQFE 1T4NA 2L33A 2YSPA 3EPJA 4LF8E 4LF4E 2EN1A 1YYKA 3MSWA 3C4BA 3KWRA 4O43A 2EOSA 2JXPA 4JI4E 1G2FC 1PDAA 3HQ1A 2RQLA 2RSMA 2YTNA 2L92A 1GZ6A 1XNQE 4M0VA 2EN3A 5T6JA 2MDGA 1QNTA 4KHPE 2EPRA 1X3CA 1X48A 1WXRA 2UUAE 1UHZA 1UN6B 2EN7A 1A1GA 4O5GA 2EMKA 2YTQA 1YFHA 2EOYA 2DSYA 5AE3A 4OX9E 4K0KE 1HR0E 2F8BA 1RC7A 3HTXA 4L8NA 1F2IG 4HTGA 2R76A 2EM8A 4X9JA 2M7QA 4WXCA 2MC5A 2JR1A 2DMIA 2JYAA 2VF1A 2EOQA 2DRPA 2ENCA 2EPKX 1MGTA 1YYWA 3JTZA 3ADIA 4R2QA 3DJWA 4WFTA 4LTYA 1N3GA 4X62E 1A1IA 4R2DA 2KOUA 2ADRA 2LRSA 2HHHE 3J7AG 1HNZE 2VRDA 4F2JC 1T4OA 2EMHA 2ELZA 4IJDA 4Q35B 1IQSA 2EMXA 2EOJA 4MLVA 4JI0E 2YTJA 2YWQA 2EN4A 1X6EA 3IWCA 2LVHA 5BR8E 1KYQA 5KL5A 2EMCA 3UK3C 3ADLA 4M2ZA 1IQOA 4WYQB 2L2NA 4LFAE 4WXDA 2H36X 4BS9A 5FLXC 3BGHA 3EQ1A 2EM2A 2Q8UA 2R1FA 1HNWE 2EM7A 1SR9A 2EWLA 2DLQA 1HNXE 1T38A 1PJQA 4HEIA 2MDRA 2EMLA 2LBSB 2WBTA 3BBGA 4DV3E 1WRJA 4I8OA 2RSIA 1EH8A 1A1HA 2CSHA 1A1KA 4P7DA 1ZU1A 3LMLA 2YTDA 1YSAC 4O24A 2J7JA 2F4VE 4P78A 4R2SA 2CPNA 2LMZA 1TN9A 2EPOA 4KWYA 4JI7E 4DV1E 1NEIA 2NABA 5KL3A 5IWAE 1AAYA 5KL6A 2EMIA 2EPCA 2L2MA 2DIXA 2IHR1 3DF6A 1YYOA 4LF7E 4FK5C 2EOIA 1IBME 2VQEE 2YTEA 2E5LE 2WBUA 2FTXB 2UXDE 2JOBA 1DGCA 1GTKA 2WCC3 4L5NC 2HJJA 5F3WA 3OTOE 4F54A 1ZR9A 2CT1A 4NXME 3ADJA 4R2PA 2LO3A 4X8WA 2EMYA 5A6BA 3LLHA 1JK1A 2YTPA 1BBGA 3THNA 2YRKA 1RMDA 4R03A 4DKKA 4NHRA 4JV5E 5AE2A 3T1YE 2VE7C 2B9DA 2EE8A 3BIDA 2CTDA 2ENHA 2EQ0A 1NCSA 5AC5A 3BF2A 1DQ3A 4F9BB 1IMUA 3KZZA 1FJGE 1ZBQA 3FIGA 2UXCE 4X64E 4DR5E 3OMLA 4YHHE 5KL7A 4F9CB 2EMBA 3EPLA 3HPZA 1O0WA 1EH7A 4DR6E 4BHCA 2LUPB 4LFBE 1BBOA 4IS1C 1X49A 2UUCE 1X6FA 5IV8B 2EN8A 2L8TA 2MKNA 4DV0E 1P47A 4GKJE 4R2RA 2RTXA 2EORA 2RPCA 2EOOA 2L3JA 4JI6E 1J5EE 1A1FA 2NA2A 4TUIA 2EN2A 2V87A 5A6BD 3QG5C 4F6NA 4DV2E 2KHXA 1ZAAC 1YUJA 1BB8A 2ODRD 2EM4A 5LMNE 3MHHC 2EN6A 2JPAA 4RH8A 2YRMA 4DR7E 2LE2A 2A25A 2JY9A 2LV2A 2EPXA 2V8QB 2EPZA 2EL6A 2I9IA 4DV7E 2EP3A 2EOHA 1XNRE 2YTFA 4ZYGA 3HPSA 5TSEA 2EMAA 2YU5A 1EKZA 2DGCA 1WJPA 2I13A 2K7IA 2LTRA 3VYXA 4R2EA 3RMPA 1QU6A 5AE1A 2PRTA 1I94E 1DI2A 1PKPA 4M9VC 2YZTA 2EZ6A 2ZM6E 3MHSC 1TF3A 1N33E 2ENAA 3ECRA 4JI1E 4WPYA 4DV4E 2YSOA 4B3RE 4OOGC 2ELYA 5A2QC 1EH6A 5KL2A 2YTIA 5LL6R 1A1JA 2EPLX 4MLQA 3ZOQB 3F6GA 2YRHA 5A6KA 3F6HA 4RHBB 2L2KB 4DUYE 5LMUE 2BB8A 2HC5A 2KONA 3J80C 4Q28A 3VHTB 4DMIA 4DR2E 2DLKA 1PJSA 2EM0A 4BC7A 2GLIA 1UBDC 5A6JA 2EOMA 4R8OA 2LJUA 2E72A 1GQEA 1N32E 4KZSA 2D9HA 2EMGA 3VK6A 1A1LA 4F9AB 2EJ4A 3KZYA 1TF6A 2GPIA 3J81C
chains in the Genus database with same CATH topology
4JI5E 4TUGA 3IWBA 4JI8E 3IWCA 5BR8E 4DV0E 2JWOA 5ADZA 4GKJE 2RTXA 1IBKE 4DV5E 2L3JA 4JI6E 2FGGA 3ADLA 1J5EE 4M2ZA 4WSPA 2NA2A 4BBYA 4LF5E 4LF9E 4TUIA 2L6MA 2V87A 1N34E 3AV0A 4JYAE 2RS6A 3C4TA 4WYQB 4DR1E 1ZBTA 2L2NA 1YZ9A 4LFAE 4BS9A 2H36X 4X65E 2KHXA 5FLXC 4DV2E 4BC9A 1HNWE 1SR9A 2ODRD 2EWLA 2G7HA 2LUQA 4DUZE 1HNXE 5LMNE 2M4IA 2MDRA 2LBSB 4DR7E 2V89A 2NUFA 2LE2A 4DV3E 2JY9A 2ODRC 1X47A 3ADGA 4I8OA 2V85A 4DR3E 2DB2A 3HXLA 2V8QB 4GEQB 4LF6E 2MC6A 3JU0A 1XMQE 2K4VA 2FV4B 3AUZA 4P7DA 4B3TE 3LMLA 4DV7E 5IT9C 2V88A 5DNYA 4B3SE 1WHNA 2LTSA 2VQFE 2UXBE 2F4VE 2N3GA 1XNRE 1T4NA 4P78A 4M30A 1STUA 2L33A 2CPNA 4LF8E 4JV5E 2LMZA 2V86A 4LF4E 3HPSA 4JI7E 4DV1E 1YYKA 3MSWA 2B3TB 3C4BA 3KWRA 1EKZA 5IWAE 4JI2E 2LTRA 4DV6E 3J7Yp 1N36E 3K6QA 4JI4E 3VYXA 3JAMC 3HQ1A 2B7VA 2L2MA 2RSMA 2V83A 1UILA 2DIXA 2IHR1 2YT4A 3DF6A 4AQYE 3RMPA 1QU6A 5AE1A 1WHQA 2VQEE 1YYOA 1I94E 2L3CA 1IBME 2E5LE 1DI2A 2L92A 1GZ6A 2FTXB 2WZOA 1PKPA 4M0VA 1XNQE 2JOBA 2UXDE 2YZTA 2EZ6A 2ZM6E 5T6JA 2NUEA 4DR4E 4KHPE 4L5NC 1N33E 1X48A 1WXRA 2UUAE 5F3WA 3OTOE 1UHZA 4F54A 4JI1E 4WPYA 4DV4E 1FKAE 4NXME 4B3RE 3ADJA 2B7TA 4YY3E 5CFFE 2E1MA 4LF7E 4OOGC 5A2QC 4X8WA 2JOXA 2DSYA 3LLHA 5AE3A 4OX9E 5LL6R 4K0KE 1HR0E 4R03A 4DKKA 3ZOQB 3F6GA 3T1HE 1XMOE 2F8BA 2DMYA 1RC7A 1RQ0A 4NXNE 5AE2A 3HTXA 4L8NA 3F6HA 3H09A 2L2KB 4DUYE 4LU9A 5LMUE 2JVAA 3T1YE 2VE7C 2B9DA 2KONA 2M7QA 4BCAA 3J80C 2MC5A 2JR1A 1T4LB 4BMJA 5AASA 2VF1A 4Q28A 3VYYA 4X66E 4DMIA 4DR2E 2M1SA 1YYWA 3JTZA 1DQ3A 3P1XA 4F9BB 3ADIA 1FJGE 1ZBQA 3FIGA 3DJWA 2UXCE 4WFTA 2NUGA 4J8ZA 4BC7A 4X64E 4LTYA 1IBLE 4DR5E 4X62E 3OMLA 2UU9E 4YHHE 4F9CB 2KOUA 4LFCE 2LRSA 3HPZA 2HHHE 3J7AG 4R8OA 4B3ME 1O0WA 1HNZE 1GQEA 1N32E 2L8TA 1T4OA 4KZSA 4DR6E 2N3HA 3VK6A 2LUPB 4LFBE 4F9AB 4JI3E 3IWDA 4GKKE 1X49A 2UUCE 1J26A 2UUBE 3J81C 2RS7A 2LJHA 4JI0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 E;  4JI8 E;  5BR8 E;  4DV0 E;  4GKJ E;  2RTX A;  1IBK E;  4DV5 E;  2L3J A;  4JI6 E;  3ADL A;  1J5E E;  4M2Z A;  2NA2 A;  4LF5 E;  4LF9 E;  4JYA E;  1N34 E;  2RS6 A;  3C4T A;  4WYQ B;  4DR1 E;  1ZBT A;  2L2N A;  1YZ9 A;  4LFA E;  4X65 E;  2KHX A;  4DV2 E;  1HNW E;  2LUQ A;  4DUZ E;  1HNX E;  5LMN E;  2MDR A;  2LBS B;  4DR7 E;  2NUF A;  4DV3 E;  2JY9 A;  3ADG A;  1X47 A;  4DR3 E;  2DB2 A;  1XMQ E;  4B3T E;  4DV7 E;  4B3S E;  1WHN A;  2LTS A;  2VQF E;  2UXB E;  2F4V E;  2N3G A;  1XNR E;  1T4N A;  4M30 A;  1STU A;  2L33 A;  2CPN A;  4LF8 E;  4LF4 E;  4JI7 E;  4DV1 E;  1YYK A;  1EKZ A;  2B3T B;  3C4B A;  5IWA E;  4JI2 E;  2LTR A;  4DV6 E;  3J7Y p;  1N36 E;  4JI4 E;  3VYX A;  2B7V A;  2L2M A;  2RSM A;  1UIL A;  2YT4 A;  2DIX A;  2IHR 1;  4AQY E;  1YYO A;  4LF6 E;  1IBM E;  1QU6 A;  1I94 E;  1WHQ A;  2VQE E;  2E5L E;  4LF7 E;  2L3C A;  4GKK E;  1DI2 A;  1XNQ E;  1PKP A;  2UXD E;  2EZ6 A;  2NUE A;  2ZM6 E;  4DR4 E;  4KHP E;  1N33 E;  1X48 A;  2UUA E;  3OTO E;  1UHZ A;  4JI1 E;  4DV4 E;  1FKA E;  4NXM E;  4B3R E;  3ADJ A;  2B7T A;  4YY3 E;  5CFF E;  4OOG C;  4X8W A;  3LLH A;  4OX9 E;  4K0K E;  1HR0 E;  4DKK A;  1XMO E;  3T1H E;  4JV5 E;  4NXN E;  2DMY A;  1RC7 A;  1RQ0 A;  3HTX A;  2L2K B;  4DUY E;  5LMU E;  3T1Y E;  2JVA A;  1T4L B;  3VYY A;  4X66 E;  4DR2 E;  1YYW A;  3P1X A;  3ADI A;  1FJG E;  2UXC E;  4WFT A;  2NUG A;  4X64 E;  1IBL E;  2UU9 E;  4DR5 E;  4X62 E;  4YHH E;  4LFC E;  2LRS A;  2HHH E;  4B3M E;  1O0W A;  1HNZ E;  1GQE A;  1N32 E;  1T4O A;  4DR6 E;  2N3H A;  2LUP B;  4LFB E;  1X49 A;  2UUC E;  1J26 A;  2UUB E;  4JI3 E;  2RS7 A;  2LJH A;  4JI0 E; 
#chains in the Genus database with same CATH topology
 4TUG A;  3IWB A;  4O4K A;  4JI8 E;  1LLM C;  1YPN A;  4ZYD A;  2JWO A;  1X6H A;  4GZN C;  2EOZ A;  2WBS A;  2EPN A;  4LF5 E;  3AV0 A;  2RS6 A;  4DR1 E;  2BBG A;  2GHF A;  4F6M A;  4X65 E;  2EL5 A;  4BHB A;  1MEY C;  2EPP A;  2EMW A;  2LT7 A;  2V89 A;  2NUF A;  2LCE A;  3ADG A;  2EOX A;  2V85 A;  2DB2 A;  3THO B;  4ZYE A;  1XMQ E;  2K4V A;  2FV4 B;  2EL4 A;  2UXB E;  2LTS A;  2N3G A;  4M30 A;  1STU A;  1JK2 A;  2V86 A;  2B3T B;  4WX9 A;  4JI2 E;  4DV6 E;  2JP9 A;  3J7Y p;  1N36 E;  3K6Q A;  2EM3 A;  3TQM A;  2HGH A;  3JAM C;  2B7V A;  2MKD A;  2V83 A;  2YT4 A;  4LF6 E;  4AQY E;  4GKK E;  1WHQ A;  2L3C A;  2WZO A;  2YTO A;  2NUE A;  4DR4 E;  1Z1B A;  5A6A A;  4R2C A;  3M99 B;  1FKA E;  2B7T A;  4YY3 E;  5CFF E;  2E1M A;  2EOE A;  2JOX A;  5KL4 A;  5LLQ A;  1X5W A;  1XMO E;  3T1H E;  4NXN E;  2DMY A;  1RQ0 A;  3H09 A;  2YU8 A;  4LU9 A;  2JVA A;  2EPM X;  2EM6 A;  2EOF A;  2N8X A;  4BCA A;  2EMZ A;  4ZYH A;  1T4L B;  4NZV A;  4BMJ A;  5AAS A;  3VYY A;  4X66 E;  1AH5 A;  2M1S A;  3P1X A;  2NUG A;  4J8Z A;  1IBL E;  2UU9 E;  4LFC E;  2EPA A;  3EPK A;  1G2D C;  4B3M E;  2EM9 A;  2EMF A;  1B69 A;  2N3H A;  2YPN A;  3IWD A;  5AC4 A;  4R2A A;  1J26 A;  2UUB E;  4JI3 E;  2RS7 A;  2LJH A;  1UIL A;  4JI5 E;  2M9A A;  5ADZ A;  3C6M A;  3L00 A;  1IBK E;  4DV5 E;  2FGG A;  3EPH A;  1SFE A;  4WSP A;  4WSG A;  4BBY A;  4LF9 E;  4JYA E;  1N34 E;  2L6M A;  3C4T A;  1ZBT A;  1YZ9 A;  2EPU A;  2EQ3 A;  1T39 A;  4BC9 A;  5IXM B;  4N4R B;  2G7H A;  2LUQ A;  4DUZ E;  3C6K A;  1PJT A;  2M4I A;  1X47 A;  2ODR C;  2EQ1 A;  4DR3 E;  3HXL A;  5A69 A;  4GEQ B;  2MC6 A;  1L4S A;  1KJK A;  3JU0 A;  3AUZ A;  2EM5 A;  1YUI A;  4B3T E;  5IT9 C;  2V88 A;  5DNY A;  4B3S E;  1WHN A;  2YTG A;  2VQF E;  1T4N A;  2L33 A;  2YSP A;  3EPJ A;  4LF8 E;  4LF4 E;  2EN1 A;  1YYK A;  3MSW A;  3C4B A;  3KWR A;  4O43 A;  2EOS A;  2JXP A;  4JI4 E;  1G2F C;  1PDA A;  3HQ1 A;  2RQL A;  2RSM A;  2YTN A;  2L92 A;  1GZ6 A;  1XNQ E;  4M0V A;  2EN3 A;  5T6J A;  2MDG A;  1QNT A;  4KHP E;  2EPR A;  1X3C A;  1X48 A;  1WXR A;  2UUA E;  1UHZ A;  1UN6 B;  2EN7 A;  1A1G A;  4O5G A;  2EMK A;  2YTQ A;  1YFH A;  2EOY A;  2DSY A;  5AE3 A;  4OX9 E;  4K0K E;  1HR0 E;  2F8B A;  1RC7 A;  3HTX A;  4L8N A;  1F2I G;  4HTG A;  2R76 A;  2EM8 A;  4X9J A;  2M7Q A;  4WXC A;  2MC5 A;  2JR1 A;  2DMI A;  2JYA A;  2VF1 A;  2EOQ A;  2DRP A;  2ENC A;  2EPK X;  1MGT A;  1YYW A;  3JTZ A;  3ADI A;  4R2Q A;  3DJW A;  4WFT A;  4LTY A;  1N3G A;  4X62 E;  1A1I A;  4R2D A;  2KOU A;  2ADR A;  2LRS A;  2HHH E;  3J7A G;  1HNZ E;  2VRD A;  4F2J C;  1T4O A;  2EMH A;  2ELZ A;  4IJD A;  4Q35 B;  1IQS A;  2EMX A;  2EOJ A;  4MLV A;  4JI0 E;  2YTJ A;  2YWQ A;  2EN4 A;  1X6E A;  3IWC A;  2LVH A;  5BR8 E;  1KYQ A;  5KL5 A;  2EMC A;  3UK3 C;  3ADL A;  4M2Z A;  1IQO A;  4WYQ B;  2L2N A;  4LFA E;  4WXD A;  2H36 X;  4BS9 A;  5FLX C;  3BGH A;  3EQ1 A;  2EM2 A;  2Q8U A;  2R1F A;  1HNW E;  2EM7 A;  1SR9 A;  2EWL A;  2DLQ A;  1HNX E;  1T38 A;  1PJQ A;  4HEI A;  2MDR A;  2EML A;  2LBS B;  2WBT A;  3BBG A;  4DV3 E;  1WRJ A;  4I8O A;  2RSI A;  1EH8 A;  1A1H A;  2CSH A;  1A1K A;  4P7D A;  1ZU1 A;  3LML A;  2YTD A;  1YSA C;  4O24 A;  2J7J A;  2F4V E;  4P78 A;  4R2S A;  2CPN A;  2LMZ A;  1TN9 A;  2EPO A;  4KWY A;  4JI7 E;  4DV1 E;  1NEI A;  2NAB A;  5KL3 A;  5IWA E;  1AAY A;  5KL6 A;  2EMI A;  2EPC A;  2L2M A;  2DIX A;  2IHR 1;  3DF6 A;  1YYO A;  4LF7 E;  4FK5 C;  2EOI A;  1IBM E;  2VQE E;  2YTE A;  2E5L E;  2WBU A;  2FTX B;  2UXD E;  2JOB A;  1DGC A;  1GTK A;  2WCC 3;  4L5N C;  2HJJ A;  5F3W A;  3OTO E;  4F54 A;  1ZR9 A;  2CT1 A;  4NXM E;  3ADJ A;  4R2P A;  2LO3 A;  4X8W A;  2EMY A;  5A6B A;  3LLH A;  1JK1 A;  2YTP A;  1BBG A;  3THN A;  2YRK A;  1RMD A;  4R03 A;  4DKK A;  4NHR A;  4JV5 E;  5AE2 A;  3T1Y E;  2VE7 C;  2B9D A;  2EE8 A;  3BID A;  2CTD A;  2ENH A;  2EQ0 A;  1NCS A;  5AC5 A;  3BF2 A;  1DQ3 A;  4F9B B;  1IMU A;  3KZZ A;  1FJG E;  1ZBQ A;  3FIG A;  2UXC E;  4X64 E;  4DR5 E;  3OML A;  4YHH E;  5KL7 A;  4F9C B;  2EMB A;  3EPL A;  3HPZ A;  1O0W A;  1EH7 A;  4DR6 E;  4BHC A;  2LUP B;  4LFB E;  1BBO A;  4IS1 C;  1X49 A;  2UUC E;  1X6F A;  5IV8 B;  2EN8 A;  2L8T A;  2MKN A;  4DV0 E;  1P47 A;  4GKJ E;  4R2R A;  2RTX A;  2EOR A;  2RPC A;  2EOO A;  2L3J A;  4JI6 E;  1J5E E;  1A1F A;  2NA2 A;  4TUI A;  2EN2 A;  2V87 A;  5A6B D;  3QG5 C;  4F6N A;  4DV2 E;  2KHX A;  1ZAA C;  1YUJ A;  1BB8 A;  2ODR D;  2EM4 A;  5LMN E;  3MHH C;  2EN6 A;  2JPA A;  4RH8 A;  2YRM A;  4DR7 E;  2LE2 A;  2A25 A;  2JY9 A;  2LV2 A;  2EPX A;  2V8Q B;  2EPZ A;  2EL6 A;  2I9I A;  4DV7 E;  2EP3 A;  2EOH A;  1XNR E;  2YTF A;  4ZYG A;  3HPS A;  5TSE A;  2EMA A;  2YU5 A;  1EKZ A;  2DGC A;  1WJP A;  2I13 A;  2K7I A;  2LTR A;  3VYX A;  4R2E A;  3RMP A;  1QU6 A;  5AE1 A;  2PRT A;  1I94 E;  1DI2 A;  1PKP A;  4M9V C;  2YZT A;  2EZ6 A;  2ZM6 E;  3MHS C;  1TF3 A;  1N33 E;  2ENA A;  3ECR A;  4JI1 E;  4WPY A;  4DV4 E;  2YSO A;  4B3R E;  4OOG C;  2ELY A;  5A2Q C;  1EH6 A;  5KL2 A;  2YTI A;  5LL6 R;  1A1J A;  2EPL X;  4MLQ A;  3ZOQ B;  3F6G A;  2YRH A;  5A6K A;  3F6H A;  4RHB B;  2L2K B;  4DUY E;  5LMU E;  2BB8 A;  2HC5 A;  2KON A;  3J80 C;  4Q28 A;  3VHT B;  4DMI A;  4DR2 E;  2DLK A;  1PJS A;  2EM0 A;  4BC7 A;  2GLI A;  1UBD C;  5A6J A;  2EOM A;  4R8O A;  2LJU A;  2E72 A;  1GQE A;  1N32 E;  4KZS A;  2D9H A;  2EMG A;  3VK6 A;  1A1L A;  4F9A B;  2EJ4 A;  3KZY A;  1TF6 A;  2GPI A;  3J81 C; 
#chains in the Genus database with same CATH homology
 4JI5 E;  4TUG A;  3IWB A;  4JI8 E;  3IWC A;  5BR8 E;  4DV0 E;  2JWO A;  5ADZ A;  4GKJ E;  2RTX A;  1IBK E;  4DV5 E;  2L3J A;  4JI6 E;  2FGG A;  3ADL A;  1J5E E;  4M2Z A;  4WSP A;  2NA2 A;  4BBY A;  4LF5 E;  4LF9 E;  4TUI A;  2L6M A;  2V87 A;  1N34 E;  3AV0 A;  4JYA E;  2RS6 A;  3C4T A;  4WYQ B;  4DR1 E;  1ZBT A;  2L2N A;  1YZ9 A;  4LFA E;  4BS9 A;  2H36 X;  4X65 E;  2KHX A;  5FLX C;  4DV2 E;  4BC9 A;  1HNW E;  1SR9 A;  2ODR D;  2EWL A;  2G7H A;  2LUQ A;  4DUZ E;  1HNX E;  5LMN E;  2M4I A;  2MDR A;  2LBS B;  4DR7 E;  2V89 A;  2NUF A;  2LE2 A;  4DV3 E;  2JY9 A;  2ODR C;  1X47 A;  3ADG A;  4I8O A;  2V85 A;  4DR3 E;  2DB2 A;  3HXL A;  2V8Q B;  4GEQ B;  4LF6 E;  2MC6 A;  3JU0 A;  1XMQ E;  2K4V A;  2FV4 B;  3AUZ A;  4P7D A;  4B3T E;  3LML A;  4DV7 E;  5IT9 C;  2V88 A;  5DNY A;  4B3S E;  1WHN A;  2LTS A;  2VQF E;  2UXB E;  2F4V E;  2N3G A;  1XNR E;  1T4N A;  4P78 A;  4M30 A;  1STU A;  2L33 A;  2CPN A;  4LF8 E;  4JV5 E;  2LMZ A;  2V86 A;  4LF4 E;  3HPS A;  4JI7 E;  4DV1 E;  1YYK A;  3MSW A;  2B3T B;  3C4B A;  3KWR A;  1EKZ A;  5IWA E;  4JI2 E;  2LTR A;  4DV6 E;  3J7Y p;  1N36 E;  3K6Q A;  4JI4 E;  3VYX A;  3JAM C;  3HQ1 A;  2B7V A;  2L2M A;  2RSM A;  2V83 A;  1UIL A;  2DIX A;  2IHR 1;  2YT4 A;  3DF6 A;  4AQY E;  3RMP A;  1QU6 A;  5AE1 A;  1WHQ A;  2VQE E;  1YYO A;  1I94 E;  2L3C A;  1IBM E;  2E5L E;  1DI2 A;  2L92 A;  1GZ6 A;  2FTX B;  2WZO A;  1PKP A;  4M0V A;  1XNQ E;  2JOB A;  2UXD E;  2YZT A;  2EZ6 A;  2ZM6 E;  5T6J A;  2NUE A;  4DR4 E;  4KHP E;  4L5N C;  1N33 E;  1X48 A;  1WXR A;  2UUA E;  5F3W A;  3OTO E;  1UHZ A;  4F54 A;  4JI1 E;  4WPY A;  4DV4 E;  1FKA E;  4NXM E;  4B3R E;  3ADJ A;  2B7T A;  4YY3 E;  5CFF E;  2E1M A;  4LF7 E;  4OOG C;  5A2Q C;  4X8W A;  2JOX A;  2DSY A;  3LLH A;  5AE3 A;  4OX9 E;  5LL6 R;  4K0K E;  1HR0 E;  4R03 A;  4DKK A;  3ZOQ B;  3F6G A;  3T1H E;  1XMO E;  2F8B A;  2DMY A;  1RC7 A;  1RQ0 A;  4NXN E;  5AE2 A;  3HTX A;  4L8N A;  3F6H A;  3H09 A;  2L2K B;  4DUY E;  4LU9 A;  5LMU E;  2JVA A;  3T1Y E;  2VE7 C;  2B9D A;  2KON A;  2M7Q A;  4BCA A;  3J80 C;  2MC5 A;  2JR1 A;  1T4L B;  4BMJ A;  5AAS A;  2VF1 A;  4Q28 A;  3VYY A;  4X66 E;  4DMI A;  4DR2 E;  2M1S A;  1YYW A;  3JTZ A;  1DQ3 A;  3P1X A;  4F9B B;  3ADI A;  1FJG E;  1ZBQ A;  3FIG A;  3DJW A;  2UXC E;  4WFT A;  2NUG A;  4J8Z A;  4BC7 A;  4X64 E;  4LTY A;  1IBL E;  4DR5 E;  4X62 E;  3OML A;  2UU9 E;  4YHH E;  4F9C B;  2KOU A;  4LFC E;  2LRS A;  3HPZ A;  2HHH E;  3J7A G;  4R8O A;  4B3M E;  1O0W A;  1HNZ E;  1GQE A;  1N32 E;  2L8T A;  1T4O A;  4KZS A;  4DR6 E;  2N3H A;  3VK6 A;  2LUP B;  4LFB E;  4F9A B;  4JI3 E;  3IWD A;  4GKK E;  1X49 A;  2UUC E;  1J26 A;  2UUB E;  3J81 C;  2RS7 A;  2LJH A;  4JI0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...