4WYQB

Crystal structure of the dicer-trbp interface
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
ALGPACCRVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLKIMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoribonuclease Dicer
publication title Dicer-TRBP Complex Formation Ensures Accurate Mammalian MicroRNA Biogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 20
structure length 75
sequence length 75
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wyqB00
4JYAE 1RC7A 1IBKE 1PKPA 1XMOE 3C4TA 4DV2E 2B7TA 4DV4E 5BR8E 2N3HA 3VYXA 2VQEE 2RS7A 2YT4A 2IHR1 3HTXA 4B3TE 2L2KB 1WHNA 2RS6A 1IBME 1YZ9A 1RQ0A 1N34E 2NUFA 2B3TB 2HHHE 4DUZE 2UXDE 3VYYA 1IBLE 1XNQE 1X48A 4X62E 4DV6E 2NA2A 4LF6E 4M2ZA 3T1HE 4DR4E 1N36E 2DMYA 4LFAE 5LMUE 2NUGA 4GKKE 2JVAA 4X66E 4JI5E 4DV3E 4YHHE 1HNWE 1HNZE 4LF8E 4AQYE 4DR6E 2L3JA 2UXBE 5IWAE 2UUBE 2LTRA 1YYWA 4LF5E 2MDRA 1HR0E 4JI1E 4JI7E 3ADGA 2LBSB 2L33A 2L2MA 1STUA 2LUPB 4DV7E 2CPNA 4JI6E 2NUEA 4JI8E 2UUCE 4LF4E 4WYQB 4NXME 2RSMA 4X64E 1FKAE 1O0WA 2VQFE 4WFTA 4DR2E 4DR7E 1X49A 2N3GA 1I94E 4JV5E 2F4VE 4B3ME 2LRSA 1ZBTA 4X8WA 3ADIA 3OTOE 1N32E 5LMNE 4YY3E 1X47A 2LJHA 2EZ6A 4GKJE 2LUQA 4DKKA 1N33E 4OOGC 3T1YE 2L3CA 4B3RE 1FJGE 2B7VA 4LF7E 4JI2E 3J7Yp 1T4LB 2DIXA 2ZM6E 4DV0E 4NXNE 1YYOA 1T4NA 3ADLA 4DR1E 4DUYE 2E5LE 4DV1E 3LLHA 2KHXA 2DB2A 4M30A 4B3SE 4JI3E 4LFBE 1HNXE 1QU6A 2UXCE 1WHQA 1UILA 4X65E 4DR3E 5CFFE 4OX9E 3C4BA 2UUAE 4JI4E 1DI2A 4JI0E 3P1XA 2UU9E 2LTSA 1EKZA 4LFCE 1J5EE 2RTXA 4DR5E 1UHZA 1XMQE 1XNRE 4LF9E 3ADJA 4KHPE 1J26A 1GQEA 2L2NA 2JY9A 1YYKA 4K0KE 1T4OA 4DV5E
chains in the Genus database with same CATH superfamily
4WX9A 1X3CA 1PKPA 2KOUA 4LTYA 2LCEA 2EM4A 2MC6A 2YTFA 2KONA 2L92A 3IWCA 5A6BA 2YRMA 4DV4E 1EH6A 2G7HA 1JK1A 2RS7A 1NEIA 2LT7A 1JK2A 4LU9A 2GHFA 1YZ9A 1A1KA 4X9JA 3VYYA 2EL4A 4R8OA 1A1FA 3TQMA 4LF6E 4M2ZA 1MEYC 2EMBA 4DV3E 4YHHE 1DQ3A 3JAMC 2WCC3 2ELZA 4LF8E 1BB8A 1AH5A 4DR6E 2UUBE 2EOHA 1UN6B 2LTRA 1YYWA 2V87A 1IMUA 4LF5E 4O43A 2YTGA 2LBSB 2L2MA 5AE2A 2LUPB 2NUEA 1DGCA 5DNYA 1QNTA 2YTJA 5T6JA 1FKAE 1X6FA 2EOSA 2F8BA 3HPSA 4WFTA 5IT9C 4DR7E 1X49A 2EM6A 2RSIA 4R2AA 2WZOA 5A6JA 4B3ME 4F9CB 3ZOQB 2LUQA 4DKKA 5AC4A 2WBSA 1N33E 3T1YE 4B3RE 2B7VA 2EOFA 2EJ4A 4JI2E 1MGTA 5IXMB 2EMGA 2EPNA 2DIXA 1ZU1A 1YYOA 4F2JC 3MHSC 4DV1E 3LLHA 4R03A 2EMHA 2EQ1A 2YPNA 4LFBE 1HNXE 2DSYA 2EOEA 2UXCE 4X65E 2EMKA 4WSPA 3EPLA 2EP3A 2EM7A 2EMLA 5F3WA 2RPCA 2LTSA 4BHBA 2EPZA 1X6EA 4DR5E 4LF9E 2M9AA 5A2QC 1T4OA 2V88A 3THOB 2J7JA 3J80C 1RC7A 1A1HA 3JU0A 4BHCA 2EN6A 4DV2E 5BR8E 2N3HA 2YT4A 3F6GA 1IQOA 2BBGA 2YTNA 2V85A 2MC5A 3HTXA 4B3TE 4F9AB 2WBUA 1WHNA 1IBME 1RQ0A 2NUFA 1YFHA 1KJKA 1A1LA 4L8NA 2EMYA 2M4IA 3C6KA 4DUZE 2EL5A 2EOIA 1IBLE 1XNQE 1X48A 4X62E 4DV6E 4ZYGA 3RMPA 3T1HE 2NUGA 2CSHA 4GKKE 2EPLX 2ODRD 4JI5E 2EPXA 4NHRA 3MHHC 1A1GA 1HNZE 3K6QA 2DLQA 2YSPA 2L3JA 2UXBE 4IS1C 4KWYA 2CTDA 5LL6R 2EOMA 3EPHA 3J7AG 2EE8A 2EOZA 2EN2A 2HGHA 2LMZA 4WXCA 4GZNC 2CPNA 2EN7A 2LV2A 2I9IA 4JI6E 2EL6A 1Z1BA 4NXME 3L00A 3KZYA 4MLQA 2YRKA 2V8QB 4DR2E 1GTKA 4TUIA 4WPYA 2F4VE 2LRSA 1SR9A 1ZBTA 2EQ3A 2A25A 2EM5A 1TF6A 2LJHA 4GKJE 3KZZA 1F2IG 4BC7A 5KL3A 4WSGA 4LF7E 2YU5A 3M99B 5KL2A 1WJPA 2PRTA 3VHTB 3J81C 4R2PA 2ZM6E 2EM9A 2NABA 1T4NA 4BMJA 5AE3A 5LLQA 1ZBQA 4DR1E 5A6BD 2KHXA 2DB2A 2E1MA 4Q28A 4JI3E 1QU6A 2EOJA 1A1JA 4TUGA 2EMAA 2EMFA 4DR3E 5AC5A 3C4BA 1PJSA 1SFEA 2EN1A 3EQ1A 4J8ZA 5TSEA 2GLIA 1ZR9A 2K7IA 1B69A 1G2FC 4O24A 1UHZA 1XMQE 4KHPE 1J26A 3ADJA 1T38A 1TF3A 2EMCA 1GQEA 2JY9A 3THNA 5AASA 2ENCA 4K0KE 4R2SA 4JYAE 1IBKE 3C4TA 2YSOA 2ELYA 2YTQA 2E72A 3KWRA 3H09A 2CT1A 2RQLA 2IHR1 2EOYA 4L5NC 2EMXA 5A6AA 5AE1A 5KL5A 3BGHA 2UXDE 2V89A 3HQ1A 2Q8UA 1LLMC 4GEQB 5IV8B 2JXPA 2DMYA 4R2RA 3BBGA 2V83A 1PJTA 2EM3A 5ADZA 1HNWE 4F6MA 4AQYE 5IWAE 4R2QA 2WBTA 2EMIA 2EORA 2MDRA 4ZYHA 1HR0E 2FV4B 1STUA 4DV7E 2B9DA 3C6MA 2EN3A 4Q35B 2EOXA 2UUCE 2EN8A 4RHBB 4LF4E 2JWOA 2RSMA 4X64E 4R2DA 3UK3C 1O0WA 2MKDA 2N3GA 4ZYDA 1WXRA 1NCSA 2YRHA 2I13A 1GZ6A 4X8WA 2VF1A 5LMNE 2LVHA 2YTPA 2EZ6A 2EMZA 2EPAA 1T39A 1ZAAC 4OOGC 2VRDA 1A1IA 2L6MA 1FJGE 4IJDA 3OMLA 2LO3A 2M7QA 3J7Yp 4NZVA 2YWQA 3AV0A 4DV0E 4NXNE 1UBDC 4O4KA 4F9BB 2VE7C 2JP9A 4DUYE 2MKNA 5A69A 4M30A 1YSAC 4B3SE 4RH8A 2EPCA 2BB8A 1UILA 1WHQA 1KYQA 4JI4E 1EH7A 1DI2A 4JI0E 2DGCA 4HEIA 3IWDA 1N3GA 1EH8A 2DLKA 3P1XA 2YTIA 2EPKX 2RTXA 4BCAA 1AAYA 1YPNA 2EWLA 2YTOA 5KL7A 2N8XA 4DV5E 1XMOE 4FK5C 1TN9A 2EM0A 2ENHA 2EPUA 2B7TA 2EMWA 5A6KA 4M9VC 4HTGA 4R2CA 3ECRA 2VQEE 3VYXA 3QG5C 2ADRA 2FGGA 2HJJA 2L2KB 2RS6A 3EPKA 4R2EA 2EPOA 1N34E 2B3TB 2YTDA 3FIGA 2EOOA 3BF2A 2M1SA 2HHHE 4N4RB 2K4VA 2NA2A 4DR4E 1N36E 2ENAA 5LMUE 4LFAE 2JVAA 1X5WA 4X66E 2EM8A 4I8OA 2GPIA 2R1FA 2YTEA 2JR1A 3HXLA 5FLXC 4KZSA 3BIDA 3DF6A 4MLVA 2YU8A 4JI1E 4JI7E 2FTXB 3ADGA 2R76A 2L33A 2JOBA 3DJWA 2LE2A 4JI8E 1G2DC 1X6HA 4WYQB 2L8TA 3AUZA 2ODRC 2VQFE 1RMDA 3MSWA 2D9HA 2V86A 3HPZA 1P47A 1I94E 1IQSA 4JV5E 2JYAA 3ADIA 1BBGA 4WXDA 3OTOE 1N32E 2MDGA 4YY3E 1X47A 3EPJA 2EOQA 1WRJA 2L3CA 4F6NA 4P78A 1PDAA 2EPPA 2DMIA 4ZYEA 2JPAA 1BBOA 3VK6A 3IWBA 1T4LB 4M0VA 1YUJA 2EN4A 1L4SA 3F6HA 3ADLA 2EPRA 3JTZA 4DMIA 1PJQA 2E5LE 5KL4A 2EM2A 4BS9A 4O5GA 4F54A 2EPMX 1YUIA 5CFFE 4OX9E 2DRPA 2UUAE 4P7DA 2LJUA 4BBYA 5KL6A 2H36X 4BC9A 2UU9E 1EKZA 4LFCE 1J5EE 2EQ0A 1XNRE 2JOXA 2L2NA 2YZTA 3LMLA 1YYKA 2HC5A
chains in the Genus database with same CATH topology
2V88A 4JYAE 3J80C 1RC7A 1IBKE 1PKPA 2KOUA 1XMOE 3C4TA 3JU0A 4LTYA 4DV2E 2B7TA 2MC6A 3IWCA 3KWRA 4DV4E 2KONA 2L92A 5BR8E 2N3HA 3H09A 3VYXA 2G7HA 2VQEE 2RS7A 2YT4A 3F6GA 2FGGA 2IHR1 2V85A 2MC5A 3HTXA 4B3TE 4F9AB 2L2KB 4LU9A 1WHNA 2RS6A 1IBME 1YZ9A 4L5NC 1RQ0A 1N34E 2NUFA 5AE1A 2B3TB 3FIGA 2M1SA 4L8NA 2M4IA 2HHHE 4DUZE 2K4VA 2UXDE 2V89A 3HQ1A 4R8OA 3VYYA 1IBLE 1X48A 4X62E 1XNQE 4DV6E 2NA2A 4GEQB 3RMPA 4LF6E 4M2ZA 3T1HE 4DR4E 1N36E 2DMYA 4LFAE 5LMUE 2NUGA 4GKKE 2JVAA 2V83A 2ODRD 4X66E 4JI5E 4DV3E 4I8OA 5ADZA 4YHHE 1DQ3A 3JAMC 2JR1A 3HXLA 1HNWE 1HNZE 3K6QA 5FLXC 4AQYE 4LF8E 4DR6E 2L3JA 4KZSA 2UXBE 5IWAE 2UUBE 5LL6R 3DF6A 2LTRA 1YYWA 2V87A 4LF5E 2MDRA 1HR0E 4JI1E 2FV4B 4JI7E 2FTXB 3ADGA 3J7AG 2LBSB 2L33A 2L2MA 1STUA 2JOBA 3DJWA 5AE2A 2LMZA 2LUPB 4DV7E 2B9DA 2CPNA 4JI6E 2NUEA 2LE2A 4JI8E 2UUCE 4LF4E 5DNYA 4WYQB 4NXME 2JWOA 2L8TA 2RSMA 4X64E 3AUZA 2ODRC 5T6JA 1FKAE 1O0WA 2VQFE 2F8BA 3HPSA 2V8QB 4WFTA 3MSWA 4DR2E 1X49A 2V86A 3HPZA 5IT9C 2N3GA 1I94E 4DR7E 4TUIA 4WPYA 4JV5E 2WZOA 1WXRA 2F4VE 4B3ME 2LRSA 1SR9A 1GZ6A 1ZBTA 4X8WA 2VF1A 3ADIA 3OTOE 1N32E 5LMNE 4YY3E 1X47A 2LJHA 2EZ6A 4GKJE 4F9CB 3ZOQB 2LUQA 4DKKA 1N33E 4OOGC 4BC7A 3T1YE 2L3CA 2L6MA 1FJGE 2B7VA 4P78A 4B3RE 4LF7E 3OMLA 4JI2E 2M7QA 3J7Yp 3VK6A 3IWBA 1T4LB 4M0VA 3AV0A 3J81C 2DIXA 3F6HA 2ZM6E 4DV0E 4NXNE 1YYOA 1T4NA 4BMJA 3ADLA 4F9BB 3JTZA 5AE3A 2VE7C 1ZBQA 4DUYE 4DMIA 4DR1E 2E5LE 4DV1E 3LLHA 4R03A 2KHXA 2DB2A 4BS9A 4F54A 4M30A 4B3SE 2E1MA 4Q28A 1HNXE 4JI3E 4LFBE 1QU6A 2DSYA 4TUGA 2UXCE 1WHQA 1UILA 4X65E 4DR3E 5CFFE 4OX9E 3C4BA 2UUAE 4WSPA 4JI4E 4P7DA 1DI2A 4K0KE 4JI0E 4BBYA 4J8ZA 3IWDA 2H36X 3P1XA 4BC9A 5F3WA 2UU9E 2LTSA 1EKZA 4LFCE 1J5EE 2RTXA 4BCAA 4DR5E 1UHZA 1XMQE 1XNRE 4LF9E 3ADJA 4KHPE 1J26A 5A2QC 1GQEA 2JOXA 2JY9A 2EWLA 2L2NA 2YZTA 3LMLA 5AASA 1YYKA 1T4OA 4DV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA E;  1RC7 A;  1IBK E;  1PKP A;  1XMO E;  3C4T A;  4DV2 E;  2B7T A;  4DV4 E;  5BR8 E;  2N3H A;  3VYX A;  2VQE E;  2RS7 A;  2YT4 A;  2IHR 1;  3HTX A;  4B3T E;  2L2K B;  1WHN A;  2RS6 A;  1IBM E;  1YZ9 A;  1RQ0 A;  1N34 E;  2NUF A;  2B3T B;  2HHH E;  4DUZ E;  2UXD E;  3VYY A;  1IBL E;  1XNQ E;  1X48 A;  4X62 E;  4DV6 E;  2NA2 A;  4LF6 E;  4M2Z A;  3T1H E;  4DR4 E;  1N36 E;  2DMY A;  4LFA E;  5LMU E;  2NUG A;  4GKK E;  2JVA A;  4X66 E;  4JI5 E;  4DV3 E;  4YHH E;  1HNW E;  1HNZ E;  4LF8 E;  4AQY E;  4DR6 E;  2L3J A;  2UXB E;  5IWA E;  2UUB E;  2LTR A;  1YYW A;  4LF5 E;  2MDR A;  1HR0 E;  4JI1 E;  4JI7 E;  3ADG A;  2LBS B;  2L33 A;  2L2M A;  1STU A;  2LUP B;  4DV7 E;  2CPN A;  4JI6 E;  2NUE A;  4JI8 E;  2UUC E;  4LF4 E;  4WYQ B;  4NXM E;  2RSM A;  4X64 E;  1FKA E;  1O0W A;  2VQF E;  4WFT A;  4DR2 E;  4DR7 E;  1X49 A;  2N3G A;  1I94 E;  4JV5 E;  2F4V E;  4B3M E;  2LRS A;  1ZBT A;  4X8W A;  3ADI A;  3OTO E;  1N32 E;  5LMN E;  4YY3 E;  1X47 A;  2LJH A;  2EZ6 A;  4GKJ E;  2LUQ A;  4DKK A;  1N33 E;  4OOG C;  3T1Y E;  2L3C A;  4B3R E;  1FJG E;  2B7V A;  4LF7 E;  4JI2 E;  3J7Y p;  1T4L B;  2DIX A;  2ZM6 E;  4DV0 E;  4NXN E;  1YYO A;  1T4N A;  3ADL A;  4DR1 E;  4DUY E;  2E5L E;  4DV1 E;  3LLH A;  2KHX A;  2DB2 A;  4M30 A;  4B3S E;  4JI3 E;  4LFB E;  1HNX E;  1QU6 A;  2UXC E;  1WHQ A;  1UIL A;  4X65 E;  4DR3 E;  5CFF E;  4OX9 E;  3C4B A;  2UUA E;  4JI4 E;  1DI2 A;  4JI0 E;  3P1X A;  2UU9 E;  2LTS A;  1EKZ A;  4LFC E;  1J5E E;  2RTX A;  4DR5 E;  1UHZ A;  1XMQ E;  1XNR E;  4LF9 E;  3ADJ A;  4KHP E;  1J26 A;  1GQE A;  2L2N A;  2JY9 A;  1YYK A;  4K0K E;  1T4O A;  4DV5 E; 
#chains in the Genus database with same CATH topology
 4WX9 A;  1X3C A;  1PKP A;  2KOU A;  4LTY A;  2LCE A;  2EM4 A;  2MC6 A;  2YTF A;  2KON A;  2L92 A;  3IWC A;  5A6B A;  2YRM A;  4DV4 E;  1EH6 A;  2G7H A;  1JK1 A;  2RS7 A;  1NEI A;  2LT7 A;  1JK2 A;  4LU9 A;  2GHF A;  1YZ9 A;  1A1K A;  4X9J A;  3VYY A;  2EL4 A;  4R8O A;  1A1F A;  3TQM A;  4LF6 E;  4M2Z A;  1MEY C;  2EMB A;  4DV3 E;  4YHH E;  1DQ3 A;  3JAM C;  2WCC 3;  2ELZ A;  4LF8 E;  1BB8 A;  1AH5 A;  4DR6 E;  2UUB E;  2EOH A;  1UN6 B;  2LTR A;  1YYW A;  2V87 A;  1IMU A;  4LF5 E;  4O43 A;  2YTG A;  2LBS B;  2L2M A;  5AE2 A;  2LUP B;  2NUE A;  1DGC A;  5DNY A;  1QNT A;  2YTJ A;  5T6J A;  1FKA E;  1X6F A;  2EOS A;  2F8B A;  3HPS A;  4WFT A;  5IT9 C;  4DR7 E;  1X49 A;  2EM6 A;  2RSI A;  4R2A A;  2WZO A;  5A6J A;  4B3M E;  4F9C B;  3ZOQ B;  2LUQ A;  4DKK A;  5AC4 A;  2WBS A;  1N33 E;  3T1Y E;  4B3R E;  2B7V A;  2EOF A;  2EJ4 A;  4JI2 E;  1MGT A;  5IXM B;  2EMG A;  2EPN A;  2DIX A;  1ZU1 A;  1YYO A;  4F2J C;  3MHS C;  4DV1 E;  3LLH A;  4R03 A;  2EMH A;  2EQ1 A;  2YPN A;  4LFB E;  1HNX E;  2DSY A;  2EOE A;  2UXC E;  4X65 E;  2EMK A;  4WSP A;  3EPL A;  2EP3 A;  2EM7 A;  2EML A;  5F3W A;  2RPC A;  2LTS A;  4BHB A;  2EPZ A;  1X6E A;  4DR5 E;  4LF9 E;  2M9A A;  5A2Q C;  1T4O A;  2V88 A;  3THO B;  2J7J A;  3J80 C;  1RC7 A;  1A1H A;  3JU0 A;  4BHC A;  2EN6 A;  4DV2 E;  5BR8 E;  2N3H A;  2YT4 A;  3F6G A;  1IQO A;  2BBG A;  2YTN A;  2V85 A;  2MC5 A;  3HTX A;  4B3T E;  4F9A B;  2WBU A;  1WHN A;  1IBM E;  1RQ0 A;  2NUF A;  1YFH A;  1KJK A;  1A1L A;  4L8N A;  2EMY A;  2M4I A;  3C6K A;  4DUZ E;  2EL5 A;  2EOI A;  1IBL E;  1XNQ E;  1X48 A;  4X62 E;  4DV6 E;  4ZYG A;  3RMP A;  3T1H E;  2NUG A;  2CSH A;  4GKK E;  2EPL X;  2ODR D;  4JI5 E;  2EPX A;  4NHR A;  3MHH C;  1A1G A;  1HNZ E;  3K6Q A;  2DLQ A;  2YSP A;  2L3J A;  2UXB E;  4IS1 C;  4KWY A;  2CTD A;  5LL6 R;  2EOM A;  3EPH A;  3J7A G;  2EE8 A;  2EOZ A;  2EN2 A;  2HGH A;  2LMZ A;  4WXC A;  4GZN C;  2CPN A;  2EN7 A;  2LV2 A;  2I9I A;  4JI6 E;  2EL6 A;  1Z1B A;  4NXM E;  3L00 A;  3KZY A;  4MLQ A;  2YRK A;  2V8Q B;  4DR2 E;  1GTK A;  4TUI A;  4WPY A;  2F4V E;  2LRS A;  1SR9 A;  1ZBT A;  2EQ3 A;  2A25 A;  2EM5 A;  1TF6 A;  2LJH A;  4GKJ E;  3KZZ A;  1F2I G;  4BC7 A;  5KL3 A;  4WSG A;  4LF7 E;  2YU5 A;  3M99 B;  5KL2 A;  1WJP A;  2PRT A;  3VHT B;  3J81 C;  4R2P A;  2ZM6 E;  2EM9 A;  2NAB A;  1T4N A;  4BMJ A;  5AE3 A;  5LLQ A;  1ZBQ A;  4DR1 E;  5A6B D;  2KHX A;  2DB2 A;  2E1M A;  4Q28 A;  4JI3 E;  1QU6 A;  2EOJ A;  1A1J A;  4TUG A;  2EMA A;  2EMF A;  4DR3 E;  5AC5 A;  3C4B A;  1PJS A;  1SFE A;  2EN1 A;  3EQ1 A;  4J8Z A;  5TSE A;  2GLI A;  1ZR9 A;  2K7I A;  1B69 A;  1G2F C;  4O24 A;  1UHZ A;  1XMQ E;  4KHP E;  1J26 A;  3ADJ A;  1T38 A;  1TF3 A;  2EMC A;  1GQE A;  2JY9 A;  3THN A;  5AAS A;  2ENC A;  4K0K E;  4R2S A;  4JYA E;  1IBK E;  3C4T A;  2YSO A;  2ELY A;  2YTQ A;  2E72 A;  3KWR A;  3H09 A;  2CT1 A;  2RQL A;  2IHR 1;  2EOY A;  4L5N C;  2EMX A;  5A6A A;  5AE1 A;  5KL5 A;  3BGH A;  2UXD E;  2V89 A;  3HQ1 A;  2Q8U A;  1LLM C;  4GEQ B;  5IV8 B;  2JXP A;  2DMY A;  4R2R A;  3BBG A;  2V83 A;  1PJT A;  2EM3 A;  5ADZ A;  1HNW E;  4F6M A;  4AQY E;  5IWA E;  4R2Q A;  2WBT A;  2EMI A;  2EOR A;  2MDR A;  4ZYH A;  1HR0 E;  2FV4 B;  1STU A;  4DV7 E;  2B9D A;  3C6M A;  2EN3 A;  4Q35 B;  2EOX A;  2UUC E;  2EN8 A;  4RHB B;  4LF4 E;  2JWO A;  2RSM A;  4X64 E;  4R2D A;  3UK3 C;  1O0W A;  2MKD A;  2N3G A;  4ZYD A;  1WXR A;  1NCS A;  2YRH A;  2I13 A;  1GZ6 A;  4X8W A;  2VF1 A;  5LMN E;  2LVH A;  2YTP A;  2EZ6 A;  2EMZ A;  2EPA A;  1T39 A;  1ZAA C;  4OOG C;  2VRD A;  1A1I A;  2L6M A;  1FJG E;  4IJD A;  3OML A;  2LO3 A;  2M7Q A;  3J7Y p;  4NZV A;  2YWQ A;  3AV0 A;  4DV0 E;  4NXN E;  1UBD C;  4O4K A;  4F9B B;  2VE7 C;  2JP9 A;  4DUY E;  2MKN A;  5A69 A;  4M30 A;  1YSA C;  4B3S E;  4RH8 A;  2EPC A;  2BB8 A;  1UIL A;  1WHQ A;  1KYQ A;  4JI4 E;  1EH7 A;  1DI2 A;  4JI0 E;  2DGC A;  4HEI A;  3IWD A;  1N3G A;  1EH8 A;  2DLK A;  3P1X A;  2YTI A;  2EPK X;  2RTX A;  4BCA A;  1AAY A;  1YPN A;  2EWL A;  2YTO A;  5KL7 A;  2N8X A;  4DV5 E;  1XMO E;  4FK5 C;  1TN9 A;  2EM0 A;  2ENH A;  2EPU A;  2B7T A;  2EMW A;  5A6K A;  4M9V C;  4HTG A;  4R2C A;  3ECR A;  2VQE E;  3VYX A;  3QG5 C;  2ADR A;  2FGG A;  2HJJ A;  2L2K B;  2RS6 A;  3EPK A;  4R2E A;  2EPO A;  1N34 E;  2B3T B;  2YTD A;  3FIG A;  2EOO A;  3BF2 A;  2M1S A;  2HHH E;  4N4R B;  2K4V A;  2NA2 A;  4DR4 E;  1N36 E;  2ENA A;  5LMU E;  4LFA E;  2JVA A;  1X5W A;  4X66 E;  2EM8 A;  4I8O A;  2GPI A;  2R1F A;  2YTE A;  2JR1 A;  3HXL A;  5FLX C;  4KZS A;  3BID A;  3DF6 A;  4MLV A;  2YU8 A;  4JI1 E;  4JI7 E;  2FTX B;  3ADG A;  2R76 A;  2L33 A;  2JOB A;  3DJW A;  2LE2 A;  4JI8 E;  1G2D C;  1X6H A;  4WYQ B;  2L8T A;  3AUZ A;  2ODR C;  2VQF E;  1RMD A;  3MSW A;  2D9H A;  2V86 A;  3HPZ A;  1P47 A;  1I94 E;  1IQS A;  4JV5 E;  2JYA A;  3ADI A;  1BBG A;  4WXD A;  3OTO E;  1N32 E;  2MDG A;  4YY3 E;  1X47 A;  3EPJ A;  2EOQ A;  1WRJ A;  2L3C A;  4F6N A;  4P78 A;  1PDA A;  2EPP A;  2DMI A;  4ZYE A;  2JPA A;  1BBO A;  3VK6 A;  3IWB A;  1T4L B;  4M0V A;  1YUJ A;  2EN4 A;  1L4S A;  3F6H A;  3ADL A;  2EPR A;  3JTZ A;  4DMI A;  1PJQ A;  2E5L E;  5KL4 A;  2EM2 A;  4BS9 A;  4O5G A;  4F54 A;  2EPM X;  1YUI A;  5CFF E;  4OX9 E;  2DRP A;  2UUA E;  4P7D A;  2LJU A;  4BBY A;  5KL6 A;  2H36 X;  4BC9 A;  2UU9 E;  1EKZ A;  4LFC E;  1J5E E;  2EQ0 A;  1XNR E;  2JOX A;  2L2N A;  2YZT A;  3LML A;  1YYK A;  2HC5 A; 
#chains in the Genus database with same CATH homology
 2V88 A;  4JYA E;  3J80 C;  1RC7 A;  1IBK E;  1PKP A;  2KOU A;  1XMO E;  3C4T A;  3JU0 A;  4LTY A;  4DV2 E;  2B7T A;  2MC6 A;  3IWC A;  3KWR A;  4DV4 E;  2KON A;  2L92 A;  5BR8 E;  2N3H A;  3H09 A;  3VYX A;  2G7H A;  2VQE E;  2RS7 A;  2YT4 A;  3F6G A;  2FGG A;  2IHR 1;  2V85 A;  2MC5 A;  3HTX A;  4B3T E;  4F9A B;  2L2K B;  4LU9 A;  1WHN A;  2RS6 A;  1IBM E;  1YZ9 A;  4L5N C;  1RQ0 A;  1N34 E;  2NUF A;  5AE1 A;  2B3T B;  3FIG A;  2M1S A;  4L8N A;  2M4I A;  2HHH E;  4DUZ E;  2K4V A;  2UXD E;  2V89 A;  3HQ1 A;  4R8O A;  3VYY A;  1IBL E;  1X48 A;  4X62 E;  1XNQ E;  4DV6 E;  2NA2 A;  4GEQ B;  3RMP A;  4LF6 E;  4M2Z A;  3T1H E;  4DR4 E;  1N36 E;  2DMY A;  4LFA E;  5LMU E;  2NUG A;  4GKK E;  2JVA A;  2V83 A;  2ODR D;  4X66 E;  4JI5 E;  4DV3 E;  4I8O A;  5ADZ A;  4YHH E;  1DQ3 A;  3JAM C;  2JR1 A;  3HXL A;  1HNW E;  1HNZ E;  3K6Q A;  5FLX C;  4AQY E;  4LF8 E;  4DR6 E;  2L3J A;  4KZS A;  2UXB E;  5IWA E;  2UUB E;  5LL6 R;  3DF6 A;  2LTR A;  1YYW A;  2V87 A;  4LF5 E;  2MDR A;  1HR0 E;  4JI1 E;  2FV4 B;  4JI7 E;  2FTX B;  3ADG A;  3J7A G;  2LBS B;  2L33 A;  2L2M A;  1STU A;  2JOB A;  3DJW A;  5AE2 A;  2LMZ A;  2LUP B;  4DV7 E;  2B9D A;  2CPN A;  4JI6 E;  2NUE A;  2LE2 A;  4JI8 E;  2UUC E;  4LF4 E;  5DNY A;  4WYQ B;  4NXM E;  2JWO A;  2L8T A;  2RSM A;  4X64 E;  3AUZ A;  2ODR C;  5T6J A;  1FKA E;  1O0W A;  2VQF E;  2F8B A;  3HPS A;  2V8Q B;  4WFT A;  3MSW A;  4DR2 E;  1X49 A;  2V86 A;  3HPZ A;  5IT9 C;  2N3G A;  1I94 E;  4DR7 E;  4TUI A;  4WPY A;  4JV5 E;  2WZO A;  1WXR A;  2F4V E;  4B3M E;  2LRS A;  1SR9 A;  1GZ6 A;  1ZBT A;  4X8W A;  2VF1 A;  3ADI A;  3OTO E;  1N32 E;  5LMN E;  4YY3 E;  1X47 A;  2LJH A;  2EZ6 A;  4GKJ E;  4F9C B;  3ZOQ B;  2LUQ A;  4DKK A;  1N33 E;  4OOG C;  4BC7 A;  3T1Y E;  2L3C A;  2L6M A;  1FJG E;  2B7V A;  4P78 A;  4B3R E;  4LF7 E;  3OML A;  4JI2 E;  2M7Q A;  3J7Y p;  3VK6 A;  3IWB A;  1T4L B;  4M0V A;  3AV0 A;  3J81 C;  2DIX A;  3F6H A;  2ZM6 E;  4DV0 E;  4NXN E;  1YYO A;  1T4N A;  4BMJ A;  3ADL A;  4F9B B;  3JTZ A;  5AE3 A;  2VE7 C;  1ZBQ A;  4DUY E;  4DMI A;  4DR1 E;  2E5L E;  4DV1 E;  3LLH A;  4R03 A;  2KHX A;  2DB2 A;  4BS9 A;  4F54 A;  4M30 A;  4B3S E;  2E1M A;  4Q28 A;  1HNX E;  4JI3 E;  4LFB E;  1QU6 A;  2DSY A;  4TUG A;  2UXC E;  1WHQ A;  1UIL A;  4X65 E;  4DR3 E;  5CFF E;  4OX9 E;  3C4B A;  2UUA E;  4WSP A;  4JI4 E;  4P7D A;  1DI2 A;  4K0K E;  4JI0 E;  4BBY A;  4J8Z A;  3IWD A;  2H36 X;  3P1X A;  4BC9 A;  5F3W A;  2UU9 E;  2LTS A;  1EKZ A;  4LFC E;  1J5E E;  2RTX A;  4BCA A;  4DR5 E;  1UHZ A;  1XMQ E;  1XNR E;  4LF9 E;  3ADJ A;  4KHP E;  1J26 A;  5A2Q C;  1GQE A;  2JOX A;  2JY9 A;  2EWL A;  2L2N A;  2YZT A;  3LML A;  5AAS A;  1YYK A;  1T4O A;  4DV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...