4WYQB

Crystal structure of the dicer-trbp interface
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
ALGPACCRVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLKIMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/protein binding
molecule keywords Endoribonuclease Dicer
publication title Dicer-TRBP Complex Formation Ensures Accurate Mammalian MicroRNA Biogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 75
sequence length 75
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4wyqB00
4X62E 3ADJA 2VQEE 1I94E 4LFAE 4YHHE 2DB2A 1FJGE 4JI1E 4DV2E 3P1XA 4LFCE 1HNXE 2L33A 1J5EE 2UXDE 4JI6E 2VQFE 1T4OA 1HNWE 4DV1E 4LF7E 4GKJE 1XMOE 3ADLA 3VYYA 4WFTA 4OX9E 1N33E 2UUBE 4JI8E 2MDRA 3C4TA 4B3RE 2LUPB 4DR5E 5IWAE 1HNZE 1FKAE 1T4NA 4B3TE 1RQ0A 4JI5E 4B3ME 2NA2A 2N3GA 4X66E 1X48A 4LF5E 5LMUE 4DV6E 1YYWA 2L2MA 1O0WA 2LJHA 4JI2E 1RC7A 1XNRE 4DV3E 2L3CA 4DR2E 2RSMA 2L2NA 1UILA 2UXBE 4DUYE 1IBLE 2DMYA 2YT4A 1X49A 2LUQA 2UUAE 1GQEA 1YYKA 1HR0E 2EZ6A 4X64E 4X65E 3VYXA 2B3TB 3T1HE 2LTRA 1YYOA 1XMQE 3T1YE 2L2KB 4DV0E 1N32E 4YY3E 1YZ9A 2NUGA 1XNQE 2B7VA 2NUFA 4OOGC 2NUEA 2IHR1 4M30A 4LFBE 2B7TA 4DR4E 3ADGA 4DV4E 1IBKE 3ADIA 4X8WA 1J26A 4M2ZA 4JV5E 4DR6E 4DV7E 1PKPA 4DV5E 1EKZA 1STUA 2ZM6E 4GKKE 1WHQA 3OTOE 4LF4E 4B3SE 4LF8E 2KHXA 2JVAA 2LTSA 1X47A 1WHNA 4LF6E 2L3JA 2RTXA 4DUZE 4DR7E 2LBSB 4DKKA 2RS6A 1IBME 4LF9E 4KHPE 3J7Yp 2HHHE 2RS7A 3C4BA 2N3HA 4JI0E 1QU6A 1UHZA 4AQYE 1N36E 4JYAE 1DI2A 4NXME 4JI4E 2LRSA 5BR8E 2E5LE 2DIXA 1T4LB 5LMNE 2F4VE 2UUCE 2CPNA 1N34E 2UU9E 4JI3E 2UXCE 4NXNE 4DR3E 4WYQB 3LLHA 1ZBTA 4JI7E 5CFFE 4K0KE 2JY9A 4DR1E 3HTXA
chains in the Genus database with same CATH superfamily
4F6MA 2RPCA 3L00A 4X62E 3MHHC 1I94E 4LFAE 3JAMC 2YU5A 2EOEA 1ZAAC 2EPUA 5IT9C 3VHTB 2EQ3A 2LV2A 1A1LA 1P47A 4GKJE 5TSEA 5KL3A 2EOXA 2EM4A 1N3GA 2I9IA 2LJUA 1RMDA 1EH7A 2DMIA 4JI8E 2EPCA 2G7HA 1JK2A 1HNZE 2JP9A 1FKAE 2MC6A 2BBGA 4B3ME 2NA2A 1X48A 5DNYA 2V83A 2MDGA 4WXCA 3BF2A 5A6BD 2L3CA 4ZYEA 2EN4A 5IXMB 4WX9A 4DR2E 2FV4B 1KJKA 4F54A 1UILA 2YTDA 1MGTA 2L8TA 4O43A 3EQ1A 5A6BA 3F6GA 3T1HE 2LTRA 1YYOA 1XMQE 4MLQA 3T1YE 4GEQB 3OMLA 4DV0E 1AAYA 1YZ9A 1XNQE 2EM5A 4OOGC 1SFEA 2EMIA 2ADRA 2NUEA 4LFBE 2EQ0A 1YPNA 1IBKE 3J80C 3ADIA 4X8WA 1TF3A 2EP3A 3ECRA 4P7DA 2EMGA 2EOQA 1STUA 4RHBB 3BGHA 3BBGA 3F6HA 4LF4E 2DLQA 2ENAA 2EOHA 4B3SE 4LF8E 2JVAA 1A1HA 2LVHA 2JWOA 1WJPA 2YRMA 4LTYA 2RTXA 4DUZE 2ENCA 4BHBA 2EMBA 2MC5A 5KL6A 4DKKA 5AC5A 1IBME 4LF9E 5AE1A 4O24A 2RS7A 3C4BA 2VF1A 2EJ4A 5BR8E 2ODRD 2BB8A 1X5WA 3K6QA 2EM6A 2EM9A 2UUCE 2UXCE 5A6JA 3LLHA 4IS1C 4F9CB 4HEIA 4R2CA 2EPNA 4GZNC 4YHHE 3HPZA 2HGHA 3BIDA 3DJWA 1AH5A 3P1XA 1ZBQA 2WBUA 1J5EE 4O4KA 1HNWE 2DLKA 3EPKA 4LF7E 3EPJA 3VYYA 2EPZA 2UUBE 2DSYA 5IV8B 2ELZA 2MDRA 3C4TA 2EMWA 2LE2A 4DR5E 5IWAE 1A1GA 3EPHA 4X66E 2ELYA 3AUZA 4DV6E 1YYWA 2E1MA 2YTGA 4NZVA 4R2QA 2RSMA 2N8XA 2UXBE 2K7IA 4BC7A 2DMYA 2D9HA 3QG5C 4F2JC 1YFHA 2EOJA 2UUAE 2EPXA 1HR0E 2EOSA 2EOFA 2NABA 2F8BA 1TF6A 2I13A 3DF6A 1WXRA 1YSAC 2L2KB 1BB8A 4R8OA 1N32E 4F6NA 5A6KA 2NUGA 1GTKA 2V88A 3IWDA 2EOIA 1A1FA 3IWCA 5AASA 2LCEA 3FIGA 2B7TA 3ADGA 4DV4E 1J26A 1BBOA 4JV5E 3ZOQB 1PKPA 2EPAA 1A1JA 4GKKE 2WBTA 1LLMC 1WHQA 1X3CA 3OTOE 1X6FA 2LTSA 2L3JA 4DR7E 1T38A 2YTJA 1B69A 2RS6A 2V8QB 2EL5A 1PDAA 2EN1A 5F3WA 1NCSA 2EOMA 1UHZA 4AQYE 2CTDA 4HTGA 4BC9A 4BBYA 2DIXA 2F4VE 2UU9E 4JI3E 4WYQB 1ZBTA 2EMZA 2V89A 2VRDA 4DR1E 3HTXA 1DGCA 3THOB 4BMJA 2L92A 3ADJA 2EOYA 5KL2A 3H09A 2YZTA 5FLXC 5AC4A 2L6MA 2EPOA 4DV2E 4I8OA 2LT7A 2ODRC 2EM3A 3J7AG 2PRTA 1HNXE 2L33A 2YU8A 1MEYC 4JI6E 2EMKA 2VE7C 2YTPA 2M1SA 1XMOE 2JPAA 2YTNA 1N33E 2EL6A 3MHSC 2V85A 1X6HA 4RH8A 3JU0A 4B3RE 1TN9A 4B3TE 5T6JA 4TUIA 1RQ0A 2M7QA 2EN2A 5LMUE 1PJTA 2L2MA 1O0WA 5KL4A 4R2DA 2EM8A 1RC7A 4L8NA 2YWQA 1A1KA 4DV3E 2CT1A 4J8ZA 2L2NA 2YSOA 4WSPA 2ENHA 3HPSA 2YT4A 5A6AA 1YUJA 2WBSA 1WRJA 4X64E 3MSWA 3VYXA 1Z1BA 4NHRA 3LMLA 4YY3E 2FTXB 5A69A 2YSPA 2H36X 4M30A 4R03A 5AE2A 4O5GA 2JR1A 2EMCA 2YTQA 2Q8UA 2YTEA 4DR6E 1NEIA 1G2DC 3THNA 4F9AB 1EKZA 2FGGA 5KL5A 1T39A 3VK6A 2EMXA 2EN8A 2EMLA 1X47A 5A2QC 2JYAA 2KONA 4BS9A 2YRHA 4R2PA 2EPLX 2J7JA 3C6MA 2V87A 2B9DA 2KOUA 2N3HA 1QU6A 2YTOA 2YPNA 1N36E 1DI2A 2M4IA 2E72A 2EMYA 2LRSA 4TUGA 2YTFA 4M9VC 1QNTA 1T4LB 5LMNE 1EH8A 2EN7A 1N34E 2EE8A 4NXNE 3HQ1A 2GHFA 1UN6B 5CFFE 1G2FC 4L5NC 2JY9A 2WCC3 2VQEE 2EMAA 4KWYA 2DRPA 2EWLA 4FK5C 2WZOA 3RMPA 2DB2A 3AV0A 4Q35B 1FJGE 4JI1E 2YTIA 4LU9A 1IMUA 2LMZA 4LFCE 1IQOA 2EM0A 4N4RB 2UXDE 2VQFE 1T4OA 3JTZA 4DV1E 3J81C 3ADLA 3KZYA 3TQMA 4WFTA 4OX9E 2K4VA 1GZ6A 2LUPB 1PJSA 3C6KA 1T4NA 2EN3A 4JI5E 4BCAA 2N3GA 1YUIA 4ZYDA 4LF5E 2CSHA 2LJHA 4JI2E 1XNRE 2MKDA 4ZYGA 2EPPA 4R2SA 1F2IG 2EPMX 4KZSA 2LO3A 4BHCA 3M99B 4DUYE 1IBLE 1UBDC 1X49A 4WXDA 4P78A 2LUQA 1GQEA 1YYKA 2EZ6A 4DMIA 1ZU1A 4MLVA 4X65E 5LLQA 2JOXA 2B3TB 3HXLA 2EPRA 1A1IA 2GPIA 2EN6A 1EH6A 3KWRA 2B7VA 2NUFA 1IQSA 2GLIA 3EPLA 2JXPA 2IHR1 2EPKX 2EMFA 2RQLA 2EORA 4IJDA 4M0VA 4WSGA 2R1FA 4DR4E 1X6EA 2RSIA 2V86A 4M2ZA 1JK1A 1L4SA 4ZYHA 4DV7E 2HC5A 4R2RA 4DV5E 2ZM6E 2EM2A 5AE3A 4R2AA 1BBGA 2KHXA 4X9JA 2R76A 5ADZA 1SR9A 1WHNA 5LL6R 1DQ3A 2EQ1A 4LF6E 4WPYA 2EOOA 2LBSB 4KHPE 2A25A 3KZZA 2JOBA 2HJJA 3IWBA 3J7Yp 2HHHE 2EOZA 2EMHA 3UK3C 4JI0E 2M9AA 4R2EA 4JYAE 4NXME 2MKNA 2YRKA 5KL7A 4JI4E 1ZR9A 2EM7A 1KYQA 1PJQA 2E5LE 2EL4A 4F9BB 2CPNA 4DR3E 4Q28A 4JI7E 4K0KE 2DGCA
chains in the Genus database with same CATH topology
4BMJA 4X62E 2L92A 3ADJA 2VQEE 1I94E 4LFAE 4YHHE 2EWLA 3HPZA 3JAMC 3H09A 2WZOA 2YZTA 5FLXC 3RMPA 2DB2A 3AV0A 1FJGE 4JI1E 2L6MA 4DV2E 3DJWA 4I8OA 2ODRC 4LU9A 3P1XA 3J7AG 1ZBQA 2LMZA 5IT9C 1HNXE 4LFCE 2L33A 1J5EE 2UXDE 4JI6E 2VQFE 1T4OA 2VE7C 1HNWE 3JTZA 2M1SA 4DV1E 3J81C 4LF7E 4GKJE 1XMOE 3ADLA 3VYYA 4WFTA 4OX9E 2K4VA 1N33E 2UUBE 2DSYA 2V85A 4JI8E 1GZ6A 2G7HA 2MDRA 3C4TA 4B3RE 2LUPB 3JU0A 2LE2A 4DR5E 5IWAE 1HNZE 1FKAE 1T4NA 5T6JA 4TUIA 4B3TE 1RQ0A 2MC6A 2M7QA 4B3ME 2NA2A 4JI5E 4BCAA 2N3GA 4X66E 1X48A 3AUZA 4LF5E 5DNYA 5LMUE 4DV6E 1YYWA 2L2MA 1O0WA 2V83A 2E1MA 2LJHA 4JI2E 1RC7A 4L8NA 1XNRE 4DV3E 2L3CA 4DR2E 4J8ZA 2FV4B 2RSMA 2L2NA 4F54A 1UILA 4KZSA 2UXBE 4BC7A 4WSPA 4DUYE 1IBLE 2DMYA 3HPSA 2YT4A 1X49A 4P78A 2LUQA 2UUAE 1GQEA 2L8TA 1HR0E 1YYKA 2EZ6A 4DMIA 2F8BA 3F6GA 3MSWA 4X64E 4X65E 2JOXA 3VYXA 2B3TB 3DF6A 3HXLA 2LTRA 1WXRA 3T1HE 1YYOA 3T1YE 2L2KB 4GEQB 3OMLA 1XMQE 4R8OA 4DV0E 1N32E 3LMLA 4YY3E 1YZ9A 2NUGA 3KWRA 1XNQE 2B7VA 2V88A 2NUFA 2FTXB 4OOGC 3IWDA 2H36X 2NUEA 2IHR1 3IWCA 4M30A 4LFBE 4M0VA 4R03A 5AASA 3FIGA 5AE2A 2JR1A 2B7TA 4DR4E 2V86A 3ADGA 4DV4E 1IBKE 3J80C 3ADIA 4X8WA 1J26A 4M2ZA 4JV5E 4DR6E 3ZOQB 4DV7E 1PKPA 4P7DA 4DV5E 4F9AB 1EKZA 1STUA 2ZM6E 4GKKE 1WHQA 3OTOE 2FGGA 3F6HA 4LF4E 3VK6A 5AE3A 4B3SE 4LF8E 2KHXA 2JVAA 2LTSA 1X47A 5A2QC 2JWOA 5ADZA 1SR9A 2KONA 1WHNA 5LL6R 4BS9A 1DQ3A 4LTYA 4LF6E 2L3JA 2RTXA 4WPYA 4DUZE 4DR7E 2LBSB 2MC5A 4DKKA 2RS6A 1IBME 4LF9E 2V8QB 5AE1A 4KHPE 3J7Yp 2JOBA 3IWBA 2HHHE 2V87A 2B9DA 2RS7A 2KOUA 3C4BA 2N3HA 4JI0E 1QU6A 5F3WA 1UHZA 4AQYE 1N36E 4JYAE 1DI2A 4NXME 2M4IA 2VF1A 4JI4E 4BC9A 2LRSA 5BR8E 4TUGA 4BBYA 2E5LE 2ODRD 2DIXA 1T4LB 3K6QA 5LMNE 4F9BB 2F4VE 2UUCE 2CPNA 1N34E 2UU9E 4JI3E 2UXCE 4NXNE 4DR3E 3HQ1A 4WYQB 3LLHA 1ZBTA 4Q28A 4JI7E 5CFFE 4K0KE 4F9CB 4L5NC 2V89A 2JY9A 4DR1E 3HTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 E;  3ADJ A;  2VQE E;  1I94 E;  4LFA E;  4YHH E;  2DB2 A;  1FJG E;  4JI1 E;  4DV2 E;  3P1X A;  4LFC E;  1HNX E;  2L33 A;  1J5E E;  2UXD E;  4JI6 E;  2VQF E;  1T4O A;  1HNW E;  4DV1 E;  4LF7 E;  4GKJ E;  1XMO E;  3ADL A;  3VYY A;  4WFT A;  4OX9 E;  1N33 E;  2UUB E;  4JI8 E;  2MDR A;  3C4T A;  4B3R E;  2LUP B;  4DR5 E;  5IWA E;  1HNZ E;  1FKA E;  1T4N A;  4B3T E;  1RQ0 A;  4JI5 E;  4B3M E;  2NA2 A;  2N3G A;  4X66 E;  1X48 A;  4LF5 E;  5LMU E;  4DV6 E;  1YYW A;  2L2M A;  1O0W A;  2LJH A;  4JI2 E;  1RC7 A;  1XNR E;  4DV3 E;  2L3C A;  4DR2 E;  2RSM A;  2L2N A;  1UIL A;  2UXB E;  4DUY E;  1IBL E;  2DMY A;  2YT4 A;  1X49 A;  2LUQ A;  2UUA E;  1GQE A;  1YYK A;  1HR0 E;  2EZ6 A;  4X64 E;  4X65 E;  3VYX A;  2B3T B;  3T1H E;  2LTR A;  1YYO A;  1XMQ E;  3T1Y E;  2L2K B;  4DV0 E;  1N32 E;  4YY3 E;  1YZ9 A;  2NUG A;  1XNQ E;  2B7V A;  2NUF A;  4OOG C;  2NUE A;  2IHR 1;  4M30 A;  4LFB E;  2B7T A;  4DR4 E;  3ADG A;  4DV4 E;  1IBK E;  3ADI A;  4X8W A;  1J26 A;  4M2Z A;  4JV5 E;  4DR6 E;  4DV7 E;  1PKP A;  4DV5 E;  1EKZ A;  1STU A;  2ZM6 E;  4GKK E;  1WHQ A;  3OTO E;  4LF4 E;  4B3S E;  4LF8 E;  2KHX A;  2JVA A;  2LTS A;  1X47 A;  1WHN A;  4LF6 E;  2L3J A;  2RTX A;  4DUZ E;  4DR7 E;  2LBS B;  4DKK A;  2RS6 A;  1IBM E;  4LF9 E;  4KHP E;  3J7Y p;  2HHH E;  2RS7 A;  3C4B A;  2N3H A;  4JI0 E;  1QU6 A;  1UHZ A;  4AQY E;  1N36 E;  4JYA E;  1DI2 A;  4NXM E;  4JI4 E;  2LRS A;  5BR8 E;  2E5L E;  2DIX A;  1T4L B;  5LMN E;  2F4V E;  2UUC E;  2CPN A;  1N34 E;  2UU9 E;  4JI3 E;  2UXC E;  4NXN E;  4DR3 E;  4WYQ B;  3LLH A;  1ZBT A;  4JI7 E;  5CFF E;  4K0K E;  2JY9 A;  4DR1 E;  3HTX A; 
#chains in the Genus database with same CATH topology
 4F6M A;  2RPC A;  3L00 A;  4X62 E;  3MHH C;  1I94 E;  4LFA E;  3JAM C;  2YU5 A;  2EOE A;  1ZAA C;  2EPU A;  5IT9 C;  3VHT B;  2EQ3 A;  2LV2 A;  1A1L A;  1P47 A;  4GKJ E;  5TSE A;  5KL3 A;  2EOX A;  2EM4 A;  1N3G A;  2I9I A;  2LJU A;  1RMD A;  1EH7 A;  2DMI A;  4JI8 E;  2EPC A;  2G7H A;  1JK2 A;  1HNZ E;  2JP9 A;  1FKA E;  2MC6 A;  2BBG A;  4B3M E;  2NA2 A;  1X48 A;  5DNY A;  2V83 A;  2MDG A;  4WXC A;  3BF2 A;  5A6B D;  2L3C A;  4ZYE A;  2EN4 A;  5IXM B;  4WX9 A;  4DR2 E;  2FV4 B;  1KJK A;  4F54 A;  1UIL A;  2YTD A;  1MGT A;  2L8T A;  4O43 A;  3EQ1 A;  5A6B A;  3F6G A;  3T1H E;  2LTR A;  1YYO A;  1XMQ E;  4MLQ A;  3T1Y E;  4GEQ B;  3OML A;  4DV0 E;  1AAY A;  1YZ9 A;  1XNQ E;  2EM5 A;  4OOG C;  1SFE A;  2EMI A;  2ADR A;  2NUE A;  4LFB E;  2EQ0 A;  1YPN A;  1IBK E;  3J80 C;  3ADI A;  4X8W A;  1TF3 A;  2EP3 A;  3ECR A;  4P7D A;  2EMG A;  2EOQ A;  1STU A;  4RHB B;  3BGH A;  3BBG A;  3F6H A;  4LF4 E;  2DLQ A;  2ENA A;  2EOH A;  4B3S E;  4LF8 E;  2JVA A;  1A1H A;  2LVH A;  2JWO A;  1WJP A;  2YRM A;  4LTY A;  2RTX A;  4DUZ E;  2ENC A;  4BHB A;  2EMB A;  2MC5 A;  5KL6 A;  4DKK A;  5AC5 A;  1IBM E;  4LF9 E;  5AE1 A;  4O24 A;  2RS7 A;  3C4B A;  2VF1 A;  2EJ4 A;  5BR8 E;  2ODR D;  2BB8 A;  1X5W A;  3K6Q A;  2EM6 A;  2EM9 A;  2UUC E;  2UXC E;  5A6J A;  3LLH A;  4IS1 C;  4F9C B;  4HEI A;  4R2C A;  2EPN A;  4GZN C;  4YHH E;  3HPZ A;  2HGH A;  3BID A;  3DJW A;  1AH5 A;  3P1X A;  1ZBQ A;  2WBU A;  1J5E E;  4O4K A;  1HNW E;  2DLK A;  3EPK A;  4LF7 E;  3EPJ A;  3VYY A;  2EPZ A;  2UUB E;  2DSY A;  5IV8 B;  2ELZ A;  2MDR A;  3C4T A;  2EMW A;  2LE2 A;  4DR5 E;  5IWA E;  1A1G A;  3EPH A;  4X66 E;  2ELY A;  3AUZ A;  4DV6 E;  1YYW A;  2E1M A;  2YTG A;  4NZV A;  4R2Q A;  2RSM A;  2N8X A;  2UXB E;  2K7I A;  4BC7 A;  2DMY A;  2D9H A;  3QG5 C;  4F2J C;  1YFH A;  2EOJ A;  2UUA E;  2EPX A;  1HR0 E;  2EOS A;  2EOF A;  2NAB A;  2F8B A;  1TF6 A;  2I13 A;  3DF6 A;  1WXR A;  1YSA C;  2L2K B;  1BB8 A;  4R8O A;  1N32 E;  4F6N A;  5A6K A;  2NUG A;  1GTK A;  2V88 A;  3IWD A;  2EOI A;  1A1F A;  3IWC A;  5AAS A;  2LCE A;  3FIG A;  2B7T A;  3ADG A;  4DV4 E;  1J26 A;  1BBO A;  4JV5 E;  3ZOQ B;  1PKP A;  2EPA A;  1A1J A;  4GKK E;  2WBT A;  1LLM C;  1WHQ A;  1X3C A;  3OTO E;  1X6F A;  2LTS A;  2L3J A;  4DR7 E;  1T38 A;  2YTJ A;  1B69 A;  2RS6 A;  2V8Q B;  2EL5 A;  1PDA A;  2EN1 A;  5F3W A;  1NCS A;  2EOM A;  1UHZ A;  4AQY E;  2CTD A;  4HTG A;  4BC9 A;  4BBY A;  2DIX A;  2F4V E;  2UU9 E;  4JI3 E;  4WYQ B;  1ZBT A;  2EMZ A;  2V89 A;  2VRD A;  4DR1 E;  3HTX A;  1DGC A;  3THO B;  4BMJ A;  2L92 A;  3ADJ A;  2EOY A;  5KL2 A;  3H09 A;  2YZT A;  5FLX C;  5AC4 A;  2L6M A;  2EPO A;  4DV2 E;  4I8O A;  2LT7 A;  2ODR C;  2EM3 A;  3J7A G;  2PRT A;  1HNX E;  2L33 A;  2YU8 A;  1MEY C;  4JI6 E;  2EMK A;  2VE7 C;  2YTP A;  2M1S A;  1XMO E;  2JPA A;  2YTN A;  1N33 E;  2EL6 A;  3MHS C;  2V85 A;  1X6H A;  4RH8 A;  3JU0 A;  4B3R E;  1TN9 A;  4B3T E;  5T6J A;  4TUI A;  1RQ0 A;  2M7Q A;  2EN2 A;  5LMU E;  1PJT A;  2L2M A;  1O0W A;  5KL4 A;  4R2D A;  2EM8 A;  1RC7 A;  4L8N A;  2YWQ A;  1A1K A;  4DV3 E;  2CT1 A;  4J8Z A;  2L2N A;  2YSO A;  4WSP A;  2ENH A;  3HPS A;  2YT4 A;  5A6A A;  1YUJ A;  2WBS A;  1WRJ A;  4X64 E;  3MSW A;  3VYX A;  1Z1B A;  4NHR A;  3LML A;  4YY3 E;  2FTX B;  5A69 A;  2YSP A;  2H36 X;  4M30 A;  4R03 A;  5AE2 A;  4O5G A;  2JR1 A;  2EMC A;  2YTQ A;  2Q8U A;  2YTE A;  4DR6 E;  1NEI A;  1G2D C;  3THN A;  4F9A B;  1EKZ A;  2FGG A;  5KL5 A;  1T39 A;  3VK6 A;  2EMX A;  2EN8 A;  2EML A;  1X47 A;  5A2Q C;  2JYA A;  2KON A;  4BS9 A;  2YRH A;  4R2P A;  2EPL X;  2J7J A;  3C6M A;  2V87 A;  2B9D A;  2KOU A;  2N3H A;  1QU6 A;  2YTO A;  2YPN A;  1N36 E;  1DI2 A;  2M4I A;  2E72 A;  2EMY A;  2LRS A;  4TUG A;  2YTF A;  4M9V C;  1QNT A;  1T4L B;  5LMN E;  1EH8 A;  2EN7 A;  1N34 E;  2EE8 A;  4NXN E;  3HQ1 A;  2GHF A;  1UN6 B;  5CFF E;  1G2F C;  4L5N C;  2JY9 A;  2WCC 3;  2VQE E;  2EMA A;  4KWY A;  2DRP A;  2EWL A;  4FK5 C;  2WZO A;  3RMP A;  2DB2 A;  3AV0 A;  4Q35 B;  1FJG E;  4JI1 E;  2YTI A;  4LU9 A;  1IMU A;  2LMZ A;  4LFC E;  1IQO A;  2EM0 A;  4N4R B;  2UXD E;  2VQF E;  1T4O A;  3JTZ A;  4DV1 E;  3J81 C;  3ADL A;  3KZY A;  3TQM A;  4WFT A;  4OX9 E;  2K4V A;  1GZ6 A;  2LUP B;  1PJS A;  3C6K A;  1T4N A;  2EN3 A;  4JI5 E;  4BCA A;  2N3G A;  1YUI A;  4ZYD A;  4LF5 E;  2CSH A;  2LJH A;  4JI2 E;  1XNR E;  2MKD A;  4ZYG A;  2EPP A;  4R2S A;  1F2I G;  2EPM X;  4KZS A;  2LO3 A;  4BHC A;  3M99 B;  4DUY E;  1IBL E;  1UBD C;  1X49 A;  4WXD A;  4P78 A;  2LUQ A;  1GQE A;  1YYK A;  2EZ6 A;  4DMI A;  1ZU1 A;  4MLV A;  4X65 E;  5LLQ A;  2JOX A;  2B3T B;  3HXL A;  2EPR A;  1A1I A;  2GPI A;  2EN6 A;  1EH6 A;  3KWR A;  2B7V A;  2NUF A;  1IQS A;  2GLI A;  3EPL A;  2JXP A;  2IHR 1;  2EPK X;  2EMF A;  2RQL A;  2EOR A;  4IJD A;  4M0V A;  4WSG A;  2R1F A;  4DR4 E;  1X6E A;  2RSI A;  2V86 A;  4M2Z A;  1JK1 A;  1L4S A;  4ZYH A;  4DV7 E;  2HC5 A;  4R2R A;  4DV5 E;  2ZM6 E;  2EM2 A;  5AE3 A;  4R2A A;  1BBG A;  2KHX A;  4X9J A;  2R76 A;  5ADZ A;  1SR9 A;  1WHN A;  5LL6 R;  1DQ3 A;  2EQ1 A;  4LF6 E;  4WPY A;  2EOO A;  2LBS B;  4KHP E;  2A25 A;  3KZZ A;  2JOB A;  2HJJ A;  3IWB A;  3J7Y p;  2HHH E;  2EOZ A;  2EMH A;  3UK3 C;  4JI0 E;  2M9A A;  4R2E A;  4JYA E;  4NXM E;  2MKN A;  2YRK A;  5KL7 A;  4JI4 E;  1ZR9 A;  2EM7 A;  1KYQ A;  1PJQ A;  2E5L E;  2EL4 A;  4F9B B;  2CPN A;  4DR3 E;  4Q28 A;  4JI7 E;  4K0K E;  2DGC A; 
#chains in the Genus database with same CATH homology
 4BMJ A;  4X62 E;  2L92 A;  3ADJ A;  2VQE E;  1I94 E;  4LFA E;  4YHH E;  2EWL A;  3HPZ A;  3JAM C;  3H09 A;  2WZO A;  2YZT A;  5FLX C;  3RMP A;  2DB2 A;  3AV0 A;  1FJG E;  4JI1 E;  2L6M A;  4DV2 E;  3DJW A;  4I8O A;  2ODR C;  4LU9 A;  3P1X A;  3J7A G;  1ZBQ A;  2LMZ A;  5IT9 C;  1HNX E;  4LFC E;  2L33 A;  1J5E E;  2UXD E;  4JI6 E;  2VQF E;  1T4O A;  2VE7 C;  1HNW E;  3JTZ A;  2M1S A;  4DV1 E;  3J81 C;  4LF7 E;  4GKJ E;  1XMO E;  3ADL A;  3VYY A;  4WFT A;  4OX9 E;  2K4V A;  1N33 E;  2UUB E;  2DSY A;  2V85 A;  4JI8 E;  1GZ6 A;  2G7H A;  2MDR A;  3C4T A;  4B3R E;  2LUP B;  3JU0 A;  2LE2 A;  4DR5 E;  5IWA E;  1HNZ E;  1FKA E;  1T4N A;  5T6J A;  4TUI A;  4B3T E;  1RQ0 A;  2MC6 A;  2M7Q A;  4B3M E;  2NA2 A;  4JI5 E;  4BCA A;  2N3G A;  4X66 E;  1X48 A;  3AUZ A;  4LF5 E;  5DNY A;  5LMU E;  4DV6 E;  1YYW A;  2L2M A;  1O0W A;  2V83 A;  2E1M A;  2LJH A;  4JI2 E;  1RC7 A;  4L8N A;  1XNR E;  4DV3 E;  2L3C A;  4DR2 E;  4J8Z A;  2FV4 B;  2RSM A;  2L2N A;  4F54 A;  1UIL A;  4KZS A;  2UXB E;  4BC7 A;  4WSP A;  4DUY E;  1IBL E;  2DMY A;  3HPS A;  2YT4 A;  1X49 A;  4P78 A;  2LUQ A;  2UUA E;  1GQE A;  2L8T A;  1HR0 E;  1YYK A;  2EZ6 A;  4DMI A;  2F8B A;  3F6G A;  3MSW A;  4X64 E;  4X65 E;  2JOX A;  3VYX A;  2B3T B;  3DF6 A;  3HXL A;  2LTR A;  1WXR A;  3T1H E;  1YYO A;  3T1Y E;  2L2K B;  4GEQ B;  3OML A;  1XMQ E;  4R8O A;  4DV0 E;  1N32 E;  3LML A;  4YY3 E;  1YZ9 A;  2NUG A;  3KWR A;  1XNQ E;  2B7V A;  2V88 A;  2NUF A;  2FTX B;  4OOG C;  3IWD A;  2H36 X;  2NUE A;  2IHR 1;  3IWC A;  4M30 A;  4LFB E;  4M0V A;  4R03 A;  5AAS A;  3FIG A;  5AE2 A;  2JR1 A;  2B7T A;  4DR4 E;  2V86 A;  3ADG A;  4DV4 E;  1IBK E;  3J80 C;  3ADI A;  4X8W A;  1J26 A;  4M2Z A;  4JV5 E;  4DR6 E;  3ZOQ B;  4DV7 E;  1PKP A;  4P7D A;  4DV5 E;  4F9A B;  1EKZ A;  1STU A;  2ZM6 E;  4GKK E;  1WHQ A;  3OTO E;  2FGG A;  3F6H A;  4LF4 E;  3VK6 A;  5AE3 A;  4B3S E;  4LF8 E;  2KHX A;  2JVA A;  2LTS A;  1X47 A;  5A2Q C;  2JWO A;  5ADZ A;  1SR9 A;  2KON A;  1WHN A;  5LL6 R;  4BS9 A;  1DQ3 A;  4LTY A;  4LF6 E;  2L3J A;  2RTX A;  4WPY A;  4DUZ E;  4DR7 E;  2LBS B;  2MC5 A;  4DKK A;  2RS6 A;  1IBM E;  4LF9 E;  2V8Q B;  5AE1 A;  4KHP E;  3J7Y p;  2JOB A;  3IWB A;  2HHH E;  2V87 A;  2B9D A;  2RS7 A;  2KOU A;  3C4B A;  2N3H A;  4JI0 E;  1QU6 A;  5F3W A;  1UHZ A;  4AQY E;  1N36 E;  4JYA E;  1DI2 A;  4NXM E;  2M4I A;  2VF1 A;  4JI4 E;  4BC9 A;  2LRS A;  5BR8 E;  4TUG A;  4BBY A;  2E5L E;  2ODR D;  2DIX A;  1T4L B;  3K6Q A;  5LMN E;  4F9B B;  2F4V E;  2UUC E;  2CPN A;  1N34 E;  2UU9 E;  4JI3 E;  2UXC E;  4NXN E;  4DR3 E;  3HQ1 A;  4WYQ B;  3LLH A;  1ZBT A;  4Q28 A;  4JI7 E;  5CFF E;  4K0K E;  4F9C B;  4L5N C;  2V89 A;  2JY9 A;  4DR1 E;  3HTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...