1ZU1A

Solution structure of the n-terminal zinc fingers of the xenopus laevis double stranded rna binding protein zfa
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
127
structure length
127
Chain Sequence
ADEFGNGDALDLPVGKDAVNSLIRENSHIFSDTQCKVCSAVLISESQKLAHYQSRKHANKVRRYMAINQGEDSVPAKKFKAAPAEISDGEDRSKCCPVCNMTFSSPVVAESHYIGKTHIKNLRLREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA binding protein ZFa
publication title Solution structure of the N-terminal zinc fingers of the Xenopus laevis double-stranded RNA-binding protein ZFa
pubmed doi rcsb
source organism Xenopus laevis
total genus 39
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12874 zf-met Zinc-finger of C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zu1A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zu1A01
2PRTA 1F2IG 2LT7A 2EOIA 2EMCA 1ZU1A 4R2DA 2YTPA 2EORA 2EMKA 4IS1C 2DLKA 2EM5A 2YTFA 2YTIA 2GLIA 1X3CA 1P47A 1JK2A 3UK3C 2DRPA 1B69A 2EOHA 2M9AA 2RPCA 2WBTA 2EPAA 4R2PA 2YTDA 2YTQA 1JK1A 2ELYA 2ENAA 1X5WA 2EOYA 2EQ3A 1ZR9A 2EL5A 2EMFA 4GZNC 2EOOA 2EOZA 2ELZA 1NCSA 2YRKA 5KL4A 2EOMA 3EPKA 2DGCA 2LCEA 2EJ4A 2YTNA 2ADRA 2VRDA 1RMDA 4R2QA 2EPPA 2EL6A 2HGHA 2EMBA 1BBOA 4F6NA 2EQ1A 1YUIA 3MHSC 1A1IA 3MHHC 2EOXA 2EMAA 4IJDA 1A1FA 2EN3A 1YUJA 2BB8A 2CT1A 2A25A 2LO3A 2MKDA 2WBUA 3EPHA 1DGCA 2EOJA 1A1HA 2CTDA 4FK5C 1MEYC 1LLMC 1A1KA 2EOQA 2RSIA 2YSOA 1BB8A 2E72A 2EOEA 1X6EA 2EE8A 2EOSA 2YTJA 4R2SA 2WCC3 2R1FA 4R2RA 2EMZA 2EPZA 2DMIA 2EPXA 4WSGA 2YTEA 2DLQA 1AAYA 2EQ0A 2YU8A 1UN6B 1KJKA 2D9HA 1UBDC 3EPJA 4R2AA 2EN8A 2MDGA 2EN6A 2EOFA 5KL3A 2YSPA 2ENHA 2EM7A 4R2EA 2EMWA 2EPRA 3M99B 2EN1A 2YTOA 1G2FC 1WJPA 2EL4A 1TN9A 2EPCA 1A1GA 5KL5A 2EP3A 2EM0A 2LV2A 4R2CA 2MKNA 2EM3A 4M9VC 2EMXA 2EM2A 2JPAA 2ENCA 1A1LA 1X6HA 2GHFA 2NABA 2YU5A 1ZAAC 1X6FA 1YSAC 2EN2A 2I13A 2YTGA 2YRMA 4F2JC 2EMHA 2EN4A 2EM6A 5KL7A 2CSHA 3VHTB 1G2DC 2EPUA 3EPLA 4X9JA 1TF3A 2JP9A 2EMYA 5KL2A 2EMIA 1A1JA 2EN7A 2YRHA 5KL6A 2EMGA 2EM8A 2EM4A 2LVHA 2EMLA 1Z1BA 2EM9A 2J7JA 2WBSA 4F6MA 1TF6A
chains in the Genus database with same CATH superfamily
2PRTA 4B3SE 4OX9E 2UXBE 2YTIA 2GLIA 1X3CA 1X47A 4X8WA 3H09A 2LE2A 2LBSB 1B69A 2LUQA 5IV8B 1HNZE 2YTDA 2YTQA 1JK1A 2EWLA 4WXCA 4DUZE 1PJQA 2EQ3A 1ZR9A 1PJTA 2L92A 4LFCE 2HJJA 2ELZA 2IHR1 3J80C 3HTXA 2JOBA 2LCEA 2EJ4A 2E5LE 4DR5E 4RH8A 2ODRC 2VRDA 2YT4A 2L3JA 2LJHA 4DMIA 5A6KA 4DV1E 2VE7C 4WX9A 3J7Yp 5AC4A 2EPPA 2JWOA 2HGHA 4JI1E 2L2MA 4ZYGA 4F6NA 3HPZA 1YZ9A 2N8XA 2EN3A 2LO3A 4YY3E 3L00A 3AUZA 1DGCA 2CTDA 2UUBE 1PDAA 1MEYC 5FLXC 1PKPA 5A6BA 4LF6E 2RSIA 4LF7E 2EMZA 2EPZA 3ADIA 2WBSA 3J7AG 4JI5E 1WRJA 4F54A 1XMQE 2EQ0A 2LRSA 2DB2A 2JR1A 2K7IA 2WZOA 4R2AA 5AASA 1KYQA 2YSPA 4X64E 2RQLA 1XMOE 4JI7E 3IWDA 2LTSA 4DV2E 3KWRA 2N3GA 5KL5A 4R2CA 2MDRA 4RHBB 4X65E 2YWQA 4F9CB 4M9VC 2L6MA 2ODRD 2JPAA 1A1LA 4KZSA 1WXRA 2YU5A 1EH6A 4F9AB 3P1XA 1GZ6A 2EPUA 3BF2A 2RTXA 2EMYA 3FIGA 4JI2E 2YRHA 2V85A 4O43A 2EMLA 4Q28A 4DR1E 1STUA 2JY9A 1N34E 4P7DA 2LT7A 3F6GA 2NUFA 4DV5E 5DNYA 4OOGC 1EKZA 1L4SA 2KHXA 5A6BD 2V88A 3C4TA 2UUCE 4NHRA 1P47A 1JK2A 3J81C 1T38A 2RPCA 4TUIA 3C6KA 4R2PA 2L8TA 4O5GA 2KONA 2ENAA 4YHHE 1T4LB 2EOYA 1IBKE 2EMFA 2NA2A 4GZNC 3LLHA 4JI0E 2EOZA 2YRKA 2R76A 3THNA 2VQFE 2DGCA 1NEIA 3OMLA 1HNXE 1WHNA 1RMDA 1EH7A 4M30A 4JI3E 1GQEA 2EMBA 5IXMB 4B3TE 2HHHE 2EQ1A 3IWCA 4X66E 3MHHC 2EMAA 1A1FA 2BB8A 1IBLE 2A25A 2B7VA 3LMLA 2FTXB 4O24A 5A2QC 1A1HA 4DV0E 2JXPA 3HPSA 4P78A 2RSMA 2HC5A 2LUPB 1ZBTA 2JVAA 4BHCA 4GKJE 1BB8A 4WFTA 1X6EA 2YTJA 4R03A 3OTOE 2WCC3 4B3ME 1HNWE 2R1FA 4R2RA 3T1HE 2EPXA 4JYAE 2F4VE 2N3HA 2H36X 2LTRA 4NZVA 3ADGA 2I9IA 1UBDC 3THOB 2EOFA 5KL3A 2B9DA 4ZYHA 2RS6A 4R2EA 2VQEE 4DR2E 2YTOA 3TQMA 1A1GA 1YYOA 4WPYA 2EP3A 2LV2A 3EQ1A 2EMXA 4M2ZA 2UXCE 1X6FA 4BHBA 4LF8E 2I13A 2YTGA 2NUEA 4F2JC 2VF1A 2EN4A 2CSHA 1G2DC 2FGGA 1N32E 3EPLA 1TF3A 1PJSA 4BCAA 4WSPA 1EH8A 4LTYA 4DR3E 2M1SA 3KZZA 2EM8A 2L3CA 4K0KE 1SFEA 4KHPE 4NXME 2YTPA 4DV3E 4JV5E 2EORA 2EMKA 4L8NA 1YFHA 4LF4E 2YTFA 4DR7E 3T1YE 4MLVA 1XNRE 3C4BA 1O0WA 5IT9C 2LMZA 2LJUA 3UK3C 2DRPA 2EOHA 4O4KA 3JAMC 5AE1A 2EPAA 1UHZA 5F3WA 2ELYA 1FJGE 4BBYA 1N36E 1X5WA 2EL5A 1X48A 2EOOA 2EOMA 3EPKA 2B7TA 1MGTA 3RMPA 4DV7E 2YTNA 2ADRA 4BC7A 1QU6A 1T4NA 2EL6A 3IWBA 4GEQB 1BBOA 1YPNA 4Q35B 3VYYA 4R8OA 1FKAE 3BIDA 1YUIA 4WXDA 5AE2A 2EOXA 4IJDA 2G7HA 2MC6A 1YUJA 2CT1A 3JU0A 2MKDA 2WBUA 2EOJA 4WYQB 5AC5A 2V86A 1N33E 4DR4E 1GTKA 2EOSA 4R2SA 2DMIA 4TUGA 2YTEA 2V83A 4DV4E 1AAYA 4MLQA 4F9BB 2B3TB 1UN6B 1KJKA 1ZBQA 2D9HA 3HQ1A 3DJWA 3EPJA 2CPNA 2K4VA 2MDGA 3HXLA 4HEIA 4NXNE 2EPLX 2EM7A 1N3GA 2L2KB 2EPRA 4BMJA 2L2NA 1G2FC 1WJPA 2EL4A 4BC9A 3ADJA 2BBGA 4BS9A 2MKNA 5ADZA 1SR9A 5LMNE 2EPMX 1X6HA 1YSAC 4LFAE 5LL6R 2YRMA 2EMHA 1IBME 3K6QA 3BBGA 2DIXA 3VHTB 5LMUE 4X9JA 1RQ0A 1AH5A 2JP9A 2V8QB 1A1JA 2E1MA 4ZYDA 2EMGA 3F6HA 2LVHA 1Z1BA 2J7JA 5TSEA 1TF6A 1F2IG 4LF9E 2EOIA 2EMCA 1ZU1A 4R2DA 4IS1C 2DLKA 2EPNA 2EM5A 2F8BA 4N4RB 1IQOA 2M9AA 1XNQE 5AE3A 2WBTA 2M4IA 4LFBE 1X49A 1QNTA 4DR6E 3BGHA 4ZYEA 1WHQA 5KL4A 1NCSA 3ECRA 3VK6A 5LLQA 4KWYA 3ZOQB 4R2QA 2MC5A 4HTGA 4LF5E 3MHSC 1A1IA 1J5EE 4AQYE 4B3RE 1IMUA 4DUYE 2GPIA 4JI4E 2NUGA 5A6AA 3EPHA 2DMYA 2ZM6E 4FK5C 2V89A 1RC7A 1LLMC 1I94E 1A1KA 2EOQA 1T39A 3QG5C 2YSOA 2E72A 2EOEA 3ADLA 2Q8UA 2EE8A 4JI6E 4I8OA 1HR0E 4WSGA 5A69A 2DLQA 4GKKE 4X62E 2UU9E 2FV4B 2YU8A 2UXDE 2EPOA 2EN8A 4LU9A 2EN6A 2RS7A 2JOXA 1DQ3A 2ENHA 2M7QA 2EZ6A 2EMWA 1YYKA 2EPKX 3M99B 2EN1A 5BR8E 3MSWA 1TN9A 2EPCA 5T6JA 2EM0A 2V87A 1T4OA 3KZYA 2EM3A 3DF6A 2UUAE 2L33A 4DKKA 2EM2A 5IWAE 1DI2A 2ENCA 4DV6E 3VYXA 2NABA 2GHFA 1BBGA 1UILA 1ZAAC 4JI8E 2KOUA 2EN2A 1IQSA 2YPNA 4M0VA 5A6JA 2EM6A 5CFFE 5KL7A 3C6MA 1YYWA 3JTZA 5KL2A 2YZTA 2JYAA 2EMIA 2EN7A 4L5NC 5KL6A 1J26A 2EM4A 4J8ZA 2EM9A 3AV0A 2DSYA 4F6MA
chains in the Genus database with same CATH topology
2PRTA 1F2IG 2LT7A 2EOIA 2EMCA 1ZU1A 4R2DA 2YTPA 2EORA 2EMKA 4IS1C 2DLKA 2EM5A 2YTFA 2YTIA 2GLIA 1X3CA 1P47A 1JK2A 3UK3C 2DRPA 1B69A 2EOHA 2M9AA 2RPCA 2WBTA 2EPAA 4R2PA 2YTDA 2YTQA 1JK1A 2ELYA 2ENAA 1X5WA 2EOYA 2EQ3A 1ZR9A 2EL5A 2EMFA 4GZNC 2EOOA 2EOZA 2ELZA 1NCSA 2YRKA 5KL4A 2EOMA 3EPKA 2DGCA 2LCEA 2EJ4A 2YTNA 2ADRA 2VRDA 1RMDA 4R2QA 2EPPA 2EL6A 2HGHA 2EMBA 1BBOA 4F6NA 2EQ1A 1YUIA 3MHSC 1A1IA 3MHHC 2EOXA 2EMAA 4IJDA 1A1FA 2EN3A 1YUJA 2BB8A 2CT1A 2A25A 2LO3A 2MKDA 2WBUA 3EPHA 1DGCA 2EOJA 1A1HA 2CTDA 4FK5C 1MEYC 1LLMC 1A1KA 2EOQA 2RSIA 2YSOA 1BB8A 2E72A 2EOEA 1X6EA 2EE8A 2EOSA 2YTJA 4R2SA 2WCC3 2R1FA 4R2RA 2EMZA 2EPZA 2DMIA 2EPXA 4WSGA 2YTEA 2DLQA 1AAYA 2EQ0A 2YU8A 1UN6B 1KJKA 2D9HA 1UBDC 3EPJA 4R2AA 2EN8A 2MDGA 2EN6A 2EOFA 5KL3A 2YSPA 2ENHA 2EM7A 4R2EA 2EMWA 2EPRA 3M99B 2EN1A 2YTOA 1G2FC 1WJPA 2EL4A 1TN9A 2EPCA 1A1GA 5KL5A 2EP3A 2EM0A 2LV2A 4R2CA 2MKNA 2EM3A 4M9VC 2EMXA 2EM2A 2JPAA 2ENCA 1A1LA 1X6HA 2GHFA 2NABA 2YU5A 1ZAAC 1X6FA 1YSAC 2EN2A 2I13A 2YTGA 2YRMA 4F2JC 2EMHA 2EN4A 2EM6A 5KL7A 2CSHA 3VHTB 1G2DC 2EPUA 3EPLA 4X9JA 1TF3A 2JP9A 2EMYA 5KL2A 2EMIA 1A1JA 2EN7A 2YRHA 5KL6A 2EMGA 2EM8A 2EM4A 2LVHA 2EMLA 1Z1BA 2EM9A 2J7JA 2WBSA 4F6MA 1TF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRT A;  1F2I G;  2LT7 A;  2EOI A;  2EMC A;  1ZU1 A;  4R2D A;  2YTP A;  2EOR A;  2EMK A;  4IS1 C;  2DLK A;  2EM5 A;  2YTF A;  2YTI A;  2GLI A;  1X3C A;  1P47 A;  1JK2 A;  3UK3 C;  2DRP A;  1B69 A;  2EOH A;  2M9A A;  2RPC A;  2WBT A;  2EPA A;  4R2P A;  2YTD A;  2YTQ A;  1JK1 A;  2ELY A;  2ENA A;  1X5W A;  2EOY A;  2EQ3 A;  1ZR9 A;  2EL5 A;  2EMF A;  4GZN C;  2EOO A;  2EOZ A;  2ELZ A;  1NCS A;  2YRK A;  5KL4 A;  2EOM A;  3EPK A;  2DGC A;  2LCE A;  2EJ4 A;  2YTN A;  2ADR A;  2VRD A;  1RMD A;  4R2Q A;  2EPP A;  2EL6 A;  2HGH A;  2EMB A;  1BBO A;  4F6N A;  2EQ1 A;  1YUI A;  3MHS C;  1A1I A;  3MHH C;  2EOX A;  2EMA A;  4IJD A;  1A1F A;  2EN3 A;  1YUJ A;  2BB8 A;  2CT1 A;  2A25 A;  2LO3 A;  2MKD A;  2WBU A;  3EPH A;  1DGC A;  2EOJ A;  1A1H A;  2CTD A;  4FK5 C;  1MEY C;  1LLM C;  1A1K A;  2EOQ A;  2RSI A;  2YSO A;  1BB8 A;  2E72 A;  2EOE A;  1X6E A;  2EE8 A;  2EOS A;  2YTJ A;  4R2S A;  2WCC 3;  2R1F A;  4R2R A;  2EMZ A;  2EPZ A;  2DMI A;  2EPX A;  4WSG A;  2YTE A;  2DLQ A;  1AAY A;  2EQ0 A;  2YU8 A;  1UN6 B;  1KJK A;  2D9H A;  1UBD C;  3EPJ A;  4R2A A;  2EN8 A;  2MDG A;  2EN6 A;  2EOF A;  5KL3 A;  2YSP A;  2ENH A;  2EM7 A;  4R2E A;  2EMW A;  2EPR A;  3M99 B;  2EN1 A;  2YTO A;  1G2F C;  1WJP A;  2EL4 A;  1TN9 A;  2EPC A;  1A1G A;  5KL5 A;  2EP3 A;  2EM0 A;  2LV2 A;  4R2C A;  2MKN A;  2EM3 A;  4M9V C;  2EMX A;  2EM2 A;  2JPA A;  2ENC A;  1A1L A;  1X6H A;  2GHF A;  2NAB A;  2YU5 A;  1ZAA C;  1X6F A;  1YSA C;  2EN2 A;  2I13 A;  2YTG A;  2YRM A;  4F2J C;  2EMH A;  2EN4 A;  2EM6 A;  5KL7 A;  2CSH A;  3VHT B;  1G2D C;  2EPU A;  3EPL A;  4X9J A;  1TF3 A;  2JP9 A;  2EMY A;  5KL2 A;  2EMI A;  1A1J A;  2EN7 A;  2YRH A;  5KL6 A;  2EMG A;  2EM8 A;  2EM4 A;  2LVH A;  2EML A;  1Z1B A;  2EM9 A;  2J7J A;  2WBS A;  4F6M A;  1TF6 A; 
#chains in the Genus database with same CATH topology
 2PRT A;  4B3S E;  4OX9 E;  2UXB E;  2YTI A;  2GLI A;  1X3C A;  1X47 A;  4X8W A;  3H09 A;  2LE2 A;  2LBS B;  1B69 A;  2LUQ A;  5IV8 B;  1HNZ E;  2YTD A;  2YTQ A;  1JK1 A;  2EWL A;  4WXC A;  4DUZ E;  1PJQ A;  2EQ3 A;  1ZR9 A;  1PJT A;  2L92 A;  4LFC E;  2HJJ A;  2ELZ A;  2IHR 1;  3J80 C;  3HTX A;  2JOB A;  2LCE A;  2EJ4 A;  2E5L E;  4DR5 E;  4RH8 A;  2ODR C;  2VRD A;  2YT4 A;  2L3J A;  2LJH A;  4DMI A;  5A6K A;  4DV1 E;  2VE7 C;  4WX9 A;  3J7Y p;  5AC4 A;  2EPP A;  2JWO A;  2HGH A;  4JI1 E;  2L2M A;  4ZYG A;  4F6N A;  3HPZ A;  1YZ9 A;  2N8X A;  2EN3 A;  2LO3 A;  4YY3 E;  3L00 A;  3AUZ A;  1DGC A;  2CTD A;  2UUB E;  1PDA A;  1MEY C;  5FLX C;  1PKP A;  5A6B A;  4LF6 E;  2RSI A;  4LF7 E;  2EMZ A;  2EPZ A;  3ADI A;  2WBS A;  3J7A G;  4JI5 E;  1WRJ A;  4F54 A;  1XMQ E;  2EQ0 A;  2LRS A;  2DB2 A;  2JR1 A;  2K7I A;  2WZO A;  4R2A A;  5AAS A;  1KYQ A;  2YSP A;  4X64 E;  2RQL A;  1XMO E;  4JI7 E;  3IWD A;  2LTS A;  4DV2 E;  3KWR A;  2N3G A;  5KL5 A;  4R2C A;  2MDR A;  4RHB B;  4X65 E;  2YWQ A;  4F9C B;  4M9V C;  2L6M A;  2ODR D;  2JPA A;  1A1L A;  4KZS A;  1WXR A;  2YU5 A;  1EH6 A;  4F9A B;  3P1X A;  1GZ6 A;  2EPU A;  3BF2 A;  2RTX A;  2EMY A;  3FIG A;  4JI2 E;  2YRH A;  2V85 A;  4O43 A;  2EML A;  4Q28 A;  4DR1 E;  1STU A;  2JY9 A;  1N34 E;  4P7D A;  2LT7 A;  3F6G A;  2NUF A;  4DV5 E;  5DNY A;  4OOG C;  1EKZ A;  1L4S A;  2KHX A;  5A6B D;  2V88 A;  3C4T A;  2UUC E;  4NHR A;  1P47 A;  1JK2 A;  3J81 C;  1T38 A;  2RPC A;  4TUI A;  3C6K A;  4R2P A;  2L8T A;  4O5G A;  2KON A;  2ENA A;  4YHH E;  1T4L B;  2EOY A;  1IBK E;  2EMF A;  2NA2 A;  4GZN C;  3LLH A;  4JI0 E;  2EOZ A;  2YRK A;  2R76 A;  3THN A;  2VQF E;  2DGC A;  1NEI A;  3OML A;  1HNX E;  1WHN A;  1RMD A;  1EH7 A;  4M30 A;  4JI3 E;  1GQE A;  2EMB A;  5IXM B;  4B3T E;  2HHH E;  2EQ1 A;  3IWC A;  4X66 E;  3MHH C;  2EMA A;  1A1F A;  2BB8 A;  1IBL E;  2A25 A;  2B7V A;  3LML A;  2FTX B;  4O24 A;  5A2Q C;  1A1H A;  4DV0 E;  2JXP A;  3HPS A;  4P78 A;  2RSM A;  2HC5 A;  2LUP B;  1ZBT A;  2JVA A;  4BHC A;  4GKJ E;  1BB8 A;  4WFT A;  1X6E A;  2YTJ A;  4R03 A;  3OTO E;  2WCC 3;  4B3M E;  1HNW E;  2R1F A;  4R2R A;  3T1H E;  2EPX A;  4JYA E;  2F4V E;  2N3H A;  2H36 X;  2LTR A;  4NZV A;  3ADG A;  2I9I A;  1UBD C;  3THO B;  2EOF A;  5KL3 A;  2B9D A;  4ZYH A;  2RS6 A;  4R2E A;  2VQE E;  4DR2 E;  2YTO A;  3TQM A;  1A1G A;  1YYO A;  4WPY A;  2EP3 A;  2LV2 A;  3EQ1 A;  2EMX A;  4M2Z A;  2UXC E;  1X6F A;  4BHB A;  4LF8 E;  2I13 A;  2YTG A;  2NUE A;  4F2J C;  2VF1 A;  2EN4 A;  2CSH A;  1G2D C;  2FGG A;  1N32 E;  3EPL A;  1TF3 A;  1PJS A;  4BCA A;  4WSP A;  1EH8 A;  4LTY A;  4DR3 E;  2M1S A;  3KZZ A;  2EM8 A;  2L3C A;  4K0K E;  1SFE A;  4KHP E;  4NXM E;  2YTP A;  4DV3 E;  4JV5 E;  2EOR A;  2EMK A;  4L8N A;  1YFH A;  4LF4 E;  2YTF A;  4DR7 E;  3T1Y E;  4MLV A;  1XNR E;  3C4B A;  1O0W A;  5IT9 C;  2LMZ A;  2LJU A;  3UK3 C;  2DRP A;  2EOH A;  4O4K A;  3JAM C;  5AE1 A;  2EPA A;  1UHZ A;  5F3W A;  2ELY A;  1FJG E;  4BBY A;  1N36 E;  1X5W A;  2EL5 A;  1X48 A;  2EOO A;  2EOM A;  3EPK A;  2B7T A;  1MGT A;  3RMP A;  4DV7 E;  2YTN A;  2ADR A;  4BC7 A;  1QU6 A;  1T4N A;  2EL6 A;  3IWB A;  4GEQ B;  1BBO A;  1YPN A;  4Q35 B;  3VYY A;  4R8O A;  1FKA E;  3BID A;  1YUI A;  4WXD A;  5AE2 A;  2EOX A;  4IJD A;  2G7H A;  2MC6 A;  1YUJ A;  2CT1 A;  3JU0 A;  2MKD A;  2WBU A;  2EOJ A;  4WYQ B;  5AC5 A;  2V86 A;  1N33 E;  4DR4 E;  1GTK A;  2EOS A;  4R2S A;  2DMI A;  4TUG A;  2YTE A;  2V83 A;  4DV4 E;  1AAY A;  4MLQ A;  4F9B B;  2B3T B;  1UN6 B;  1KJK A;  1ZBQ A;  2D9H A;  3HQ1 A;  3DJW A;  3EPJ A;  2CPN A;  2K4V A;  2MDG A;  3HXL A;  4HEI A;  4NXN E;  2EPL X;  2EM7 A;  1N3G A;  2L2K B;  2EPR A;  4BMJ A;  2L2N A;  1G2F C;  1WJP A;  2EL4 A;  4BC9 A;  3ADJ A;  2BBG A;  4BS9 A;  2MKN A;  5ADZ A;  1SR9 A;  5LMN E;  2EPM X;  1X6H A;  1YSA C;  4LFA E;  5LL6 R;  2YRM A;  2EMH A;  1IBM E;  3K6Q A;  3BBG A;  2DIX A;  3VHT B;  5LMU E;  4X9J A;  1RQ0 A;  1AH5 A;  2JP9 A;  2V8Q B;  1A1J A;  2E1M A;  4ZYD A;  2EMG A;  3F6H A;  2LVH A;  1Z1B A;  2J7J A;  5TSE A;  1TF6 A;  1F2I G;  4LF9 E;  2EOI A;  2EMC A;  1ZU1 A;  4R2D A;  4IS1 C;  2DLK A;  2EPN A;  2EM5 A;  2F8B A;  4N4R B;  1IQO A;  2M9A A;  1XNQ E;  5AE3 A;  2WBT A;  2M4I A;  4LFB E;  1X49 A;  1QNT A;  4DR6 E;  3BGH A;  4ZYE A;  1WHQ A;  5KL4 A;  1NCS A;  3ECR A;  3VK6 A;  5LLQ A;  4KWY A;  3ZOQ B;  4R2Q A;  2MC5 A;  4HTG A;  4LF5 E;  3MHS C;  1A1I A;  1J5E E;  4AQY E;  4B3R E;  1IMU A;  4DUY E;  2GPI A;  4JI4 E;  2NUG A;  5A6A A;  3EPH A;  2DMY A;  2ZM6 E;  4FK5 C;  2V89 A;  1RC7 A;  1LLM C;  1I94 E;  1A1K A;  2EOQ A;  1T39 A;  3QG5 C;  2YSO A;  2E72 A;  2EOE A;  3ADL A;  2Q8U A;  2EE8 A;  4JI6 E;  4I8O A;  1HR0 E;  4WSG A;  5A69 A;  2DLQ A;  4GKK E;  4X62 E;  2UU9 E;  2FV4 B;  2YU8 A;  2UXD E;  2EPO A;  2EN8 A;  4LU9 A;  2EN6 A;  2RS7 A;  2JOX A;  1DQ3 A;  2ENH A;  2M7Q A;  2EZ6 A;  2EMW A;  1YYK A;  2EPK X;  3M99 B;  2EN1 A;  5BR8 E;  3MSW A;  1TN9 A;  2EPC A;  5T6J A;  2EM0 A;  2V87 A;  1T4O A;  3KZY A;  2EM3 A;  3DF6 A;  2UUA E;  2L33 A;  4DKK A;  2EM2 A;  5IWA E;  1DI2 A;  2ENC A;  4DV6 E;  3VYX A;  2NAB A;  2GHF A;  1BBG A;  1UIL A;  1ZAA C;  4JI8 E;  2KOU A;  2EN2 A;  1IQS A;  2YPN A;  4M0V A;  5A6J A;  2EM6 A;  5CFF E;  5KL7 A;  3C6M A;  1YYW A;  3JTZ A;  5KL2 A;  2YZT A;  2JYA A;  2EMI A;  2EN7 A;  4L5N C;  5KL6 A;  1J26 A;  2EM4 A;  4J8Z A;  2EM9 A;  3AV0 A;  2DSY A;  4F6M A; 
#chains in the Genus database with same CATH homology
 2PRT A;  1F2I G;  2LT7 A;  2EOI A;  2EMC A;  1ZU1 A;  4R2D A;  2YTP A;  2EOR A;  2EMK A;  4IS1 C;  2DLK A;  2EM5 A;  2YTF A;  2YTI A;  2GLI A;  1X3C A;  1P47 A;  1JK2 A;  3UK3 C;  2DRP A;  1B69 A;  2EOH A;  2M9A A;  2RPC A;  2WBT A;  2EPA A;  4R2P A;  2YTD A;  2YTQ A;  1JK1 A;  2ELY A;  2ENA A;  1X5W A;  2EOY A;  2EQ3 A;  1ZR9 A;  2EL5 A;  2EMF A;  4GZN C;  2EOO A;  2EOZ A;  2ELZ A;  1NCS A;  2YRK A;  5KL4 A;  2EOM A;  3EPK A;  2DGC A;  2LCE A;  2EJ4 A;  2YTN A;  2ADR A;  2VRD A;  1RMD A;  4R2Q A;  2EPP A;  2EL6 A;  2HGH A;  2EMB A;  1BBO A;  4F6N A;  2EQ1 A;  1YUI A;  3MHS C;  1A1I A;  3MHH C;  2EOX A;  2EMA A;  4IJD A;  1A1F A;  2EN3 A;  1YUJ A;  2BB8 A;  2CT1 A;  2A25 A;  2LO3 A;  2MKD A;  2WBU A;  3EPH A;  1DGC A;  2EOJ A;  1A1H A;  2CTD A;  4FK5 C;  1MEY C;  1LLM C;  1A1K A;  2EOQ A;  2RSI A;  2YSO A;  1BB8 A;  2E72 A;  2EOE A;  1X6E A;  2EE8 A;  2EOS A;  2YTJ A;  4R2S A;  2WCC 3;  2R1F A;  4R2R A;  2EMZ A;  2EPZ A;  2DMI A;  2EPX A;  4WSG A;  2YTE A;  2DLQ A;  1AAY A;  2EQ0 A;  2YU8 A;  1UN6 B;  1KJK A;  2D9H A;  1UBD C;  3EPJ A;  4R2A A;  2EN8 A;  2MDG A;  2EN6 A;  2EOF A;  5KL3 A;  2YSP A;  2ENH A;  2EM7 A;  4R2E A;  2EMW A;  2EPR A;  3M99 B;  2EN1 A;  2YTO A;  1G2F C;  1WJP A;  2EL4 A;  1TN9 A;  2EPC A;  1A1G A;  5KL5 A;  2EP3 A;  2EM0 A;  2LV2 A;  4R2C A;  2MKN A;  2EM3 A;  4M9V C;  2EMX A;  2EM2 A;  2JPA A;  2ENC A;  1A1L A;  1X6H A;  2GHF A;  2NAB A;  2YU5 A;  1ZAA C;  1X6F A;  1YSA C;  2EN2 A;  2I13 A;  2YTG A;  2YRM A;  4F2J C;  2EMH A;  2EN4 A;  2EM6 A;  5KL7 A;  2CSH A;  3VHT B;  1G2D C;  2EPU A;  3EPL A;  4X9J A;  1TF3 A;  2JP9 A;  2EMY A;  5KL2 A;  2EMI A;  1A1J A;  2EN7 A;  2YRH A;  5KL6 A;  2EMG A;  2EM8 A;  2EM4 A;  2LVH A;  2EML A;  1Z1B A;  2EM9 A;  2J7J A;  2WBS A;  4F6M A;  1TF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...