1ZU1A

Solution structure of the n-terminal zinc fingers of the xenopus laevis double stranded rna binding protein zfa
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
127
structure length
127
Chain Sequence
ADEFGNGDALDLPVGKDAVNSLIRENSHIFSDTQCKVCSAVLISESQKLAHYQSRKHANKVRRYMAINQGEDSVPAKKFKAAPAEISDGEDRSKCCPVCNMTFSSPVVAESHYIGKTHIKNLRLREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA binding protein ZFa
publication title Solution structure of the N-terminal zinc fingers of the Xenopus laevis double-stranded RNA-binding protein ZFa
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna binding protein
total genus 39
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12874 zf-met Zinc-finger of C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zu1A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zu1A01
2ENCA 2EPPA 2D9HA 2EN3A 1Z1BA 2EMYA 4X9JA 2EMBA 2GLIA 1A1HA 2YU5A 2R1FA 2CTDA 2EL5A 2EQ1A 3MHSC 4F6MA 4R2SA 2RSIA 2EOZA 2YRMA 1A1IA 2MKNA 2YSOA 2BB8A 2EMCA 1BBOA 2EOEA 2YTQA 3UK3C 2CSHA 1KJKA 1NCSA 2DLKA 2EMGA 2LT7A 2JP9A 1TN9A 2RPCA 2DRPA 2EMHA 2WBUA 2YTDA 1JK2A 2PRTA 5KL3A 2LO3A 2EPAA 2EMAA 1ZU1A 4R2PA 2EE8A 2EOXA 2EM4A 2EM5A 1A1LA 1ZAAC 2E72A 1X6FA 2EMKA 2YU8A 5KL6A 2YRHA 2EPRA 2EORA 4R2DA 2VRDA 5KL2A 1AAYA 2EMLA 2EM7A 2DGCA 5KL4A 2YSPA 4R2AA 2EOHA 3M99B 1A1GA 2EN2A 1A1FA 1TF3A 2DLQA 3VHTB 2LVHA 2EN1A 2EOMA 2EP3A 4IS1C 2YTOA 4M9VC 1BB8A 1RMDA 2EM9A 2NABA 2ADRA 2MKDA 2EOOA 1ZR9A 4IJDA 2ENAA 2YTEA 2EM6A 2JPAA 2YTGA 3EPHA 2YTNA 1X5WA 2MDGA 3EPKA 1X6EA 2EN6A 2EPUA 2EM3A 2LCEA 1X6HA 1WJPA 2EOIA 4R2CA 2LV2A 3MHHC 4FK5C 1G2FC 1LLMC 2EOJA 2EN8A 2EMIA 2EQ0A 2WCC3 2CT1A 2A25A 2YRKA 1F2IG 1YUJA 2EMFA 2YTFA 5KL7A 1UN6B 2EOSA 2ELZA 4F6NA 2M9AA 2EN7A 2EM0A 2ENHA 4R2QA 3EPLA 4GZNC 2EJ4A 2HGHA 2EL6A 1G2DC 4F2JC 2EPXA 4R2EA 2EM8A 2EPCA 2EOQA 2J7JA 1UBDC 2GHFA 2EPZA 2YTJA 4WSGA 2WBSA 2EMZA 2EQ3A 2DMIA 1X3CA 2ELYA 2EOFA 4R2RA 1A1JA 1MEYC 2YTPA 5KL5A 2EOYA 1P47A 1YUIA 2EN4A 2EM2A 1JK1A 3EPJA 2WBTA 1A1KA 1YSAC 2EL4A 2YTIA 1TF6A 2I13A 1DGCA 2EMWA 1B69A 2EMXA
chains in the Genus database with same CATH superfamily
4JI2E 3LMLA 1YPNA 5IXMB 2VF1A 2EMBA 2M4IA 4LF6E 2R1FA 2CTDA 2EQ1A 4F6MA 4R2SA 4BC7A 2RSIA 2YRMA 5LMNE 1IBME 2YSOA 3IWDA 2BB8A 2FTXB 2NUEA 1KJKA 4LFCE 1NCSA 2JP9A 3HQ1A 1EKZA 2RPCA 4BC9A 3F6HA 4NZVA 2V8QB 3TQMA 3BGHA 5KL3A 2LO3A 4R2PA 2V85A 1ZAAC 1A1LA 1QNTA 2BBGA 5KL6A 2EMKA 2YRHA 2RTXA 2V88A 4DR2E 1T39A 2V86A 3BBGA 2VRDA 1AAYA 2DGCA 4DV3E 3EQ1A 4BS9A 1TF3A 2EN2A 4Q35B 2DLQA 4O4KA 2CPNA 2JVAA 2LVHA 1UILA 4NHRA 2YTOA 5FLXC 2UU9E 1HNWE 4LF7E 4K0KE 2N8XA 2JY9A 2YTEA 2LUQA 4ZYHA 5DNYA 2YTGA 3EPHA 1T4LB 2EN6A 5F3WA 4O43A 2E5LE 2L33A 1UHZA 4R2CA 2LV2A 3MHHC 1G2FC 5IV8B 4LF9E 3ZOQB 1IBLE 1HR0E 2YTFA 2LJUA 4B3SE 1UN6B 5TSEA 4GKKE 2M9AA 3JTZA 2KOUA 4R2QA 2EJ4A 1KYQA 2EPXA 1T4NA 3RMPA 2EOQA 4DMIA 2GHFA 4WSPA 2YTJA 2LTRA 2EPNA 5LL6R 1X3CA 4R2RA 1T38A 3C6KA 3J81C 4LU9A 1YUIA 4LTYA 1JK1A 3VYXA 3EPJA 5A6BA 3KWRA 1SFEA 3OTOE 1YSAC 2YTIA 4DR7E 1J26A 2B7TA 2ENCA 2LE2A 3VYYA 2D9HA 4I8OA 2RQLA 3K6QA 3ADLA 2YWQA 2DSYA 3QG5C 1GZ6A 1YYKA 2YU5A 3MHSC 1WXRA 5T6JA 4HTGA 1A1IA 2F4VE 3JAMC 1BBOA 2EOEA 3UK3C 1O0WA 2CSHA 2EWLA 5A69A 2VE7C 4DV2E 4BHBA 2VQEE 4JI8E 2DRPA 2YTDA 5ADZA 4DV4E 2EPAA 4TUIA 2YZTA 2EE8A 2EOXA 2EM4A 2E72A 1PKPA 1X47A 1RC7A 1SR9A 2V83A 4MLVA 4LF4E 3VK6A 2E1MA 2FV4B 4BCAA 2YSPA 5A6AA 4R2AA 3HPSA 5AC5A 1A1FA 1XNQE 2UUCE 4N4RB 4OX9E 2EN1A 2EOMA 2EPLX 3ADIA 1BB8A 4M9VC 4LF8E 3LLHA 2NABA 2ADRA 1X48A 2MDRA 4IJDA 2EM6A 4LF5E 4F54A 1X5WA 1XNRE 1PJSA 3ADJA 3THNA 4O5GA 1X6EA 1HNXE 5IWAE 1WJPA 2EOIA 5AASA 4JV5E 2G7HA 2YPNA 2JYAA 4FK5C 2EOJA 4P78A 2EMIA 4HEIA 4WFTA 2WCC3 1F2IG 2EPMX 3P1XA 3L00A 5KL7A 2L2NA 4GEQB 1EH6A 2EN7A 3C4TA 2L2KB 2K7IA 1XMOE 2YT4A 4J8ZA 2UUAE 1YYOA 2LJHA 2V87A 1N33E 2ZM6E 2VQFE 1UBDC 4X62E 2EPZA 4WSGA 2L8TA 2RS6A 2LRSA 4X65E 2DMIA 2ELYA 5AE1A 4LFAE 1A1JA 2RSMA 5KL5A 2EOYA 1PJQA 1EH7A 4WX9A 2I13A 1IQOA 3IWCA 2JWOA 5AE2A 4F2JC 1B69A 2I9IA 2EPPA 5BR8E 3HPZA 4YY3E 3F6GA 1N3GA 1X49A 3OMLA 2EMYA 4X9JA 2LBSB 2GLIA 1A1HA 1N34E 5A6KA 1NEIA 4NXME 4BBYA 1FKAE 2MKNA 2UXCE 1IBKE 2EMCA 2LUPB 1XMQE 2YTQA 3MSWA 2EMGA 2DLKA 2DMYA 2GPIA 1TN9A 2EMHA 1N32E 1BBGA 1J5EE 4AQYE 4KWYA 2K4VA 4MLQA 2EMAA 1GQEA 1ZU1A 1X6FA 2YU8A 2ODRD 1IMUA 3FIGA 1GTKA 3BIDA 2EPRA 4R2DA 2RS7A 2LMZA 4B3TE 3KZZA 2UUBE 5A6JA 1A1GA 3VHTB 4DKKA 4L8NA 2ODRC 3BF2A 2M7QA 5A6BD 4JYAE 1RMDA 4ZYDA 2EM9A 1ZR9A 3H09A 2ENAA 4YHHE 2NA2A 2JPAA 2YTNA 4F9CB 3J80C 3DJWA 2EPUA 1DI2A 2EM3A 4NXNE 3IWBA 4BHCA 2M1SA 5IT9C 2L92A 2EQ0A 2L2MA 2CT1A 2EPKX 2H36X 2YRKA 4JI0E 2UXDE 2L3CA 1N36E 1YUJA 2EMFA 2EZ6A 2EOSA 4F6NA 1I94E 2ENHA 2HGHA 2EL6A 4KZSA 3AV0A 4R2EA 2LTSA 3JU0A 4P7DA 4LFBE 3ADGA 5LMUE 2HHHE 2WBSA 4OOGC 2EMZA 4R8OA 4F9BB 2EOFA 4JI7E 1MEYC 4JI4E 2YTPA 4B3ME 4DV0E 1STUA 4TUGA 4X8WA 1P47A 2MC6A 2EPOA 1FJGE 2EM2A 3T1HE 2JXPA 1A1KA 3J7AG 2FGGA 4DR6E 4DR4E 1DGCA 2V89A 2EMWA 1AH5A 1HNZE 4KHPE 2EN3A 1Z1BA 5AE3A 1MGTA 5A2QC 2EL5A 4DV7E 2EOZA 1PDAA 4WXDA 4L5NC 5LLQA 4WYQB 4X64E 2KHXA 2LT7A 1QU6A 4R03A 4DR5E 4DV6E 2WBUA 1JK2A 2JOBA 2PRTA 2L6MA 4Q28A 4JI3E 3C6MA 1T4OA 2EM5A 1WHNA 1DQ3A 2B3TB 2EORA 4RHBB 3THOB 5KL2A 5CFFE 2EMLA 2EM7A 5KL4A 2L3JA 4RH8A 4DUYE 2MC5A 2EOHA 3M99B 2HC5A 4DV1E 2NUFA 4DR3E 1IQSA 2EP3A 4IS1C 4JI6E 2HJJA 2MKDA 2EOOA 1WHQA 3T1YE 4M2ZA 2UXBE 2KONA 2MDGA 1L4SA 2Q8UA 3EPKA 1YZ9A 2LCEA 4DUZE 1X6HA 3AUZA 1LLMC 2N3HA 2F8BA 2EN8A 2A25A 2JR1A 4BMJA 2DB2A 1EH8A 1YYWA 2IHR1 4M30A 4JI1E 1ZBTA 4ZYEA 3J7Yp 3C4BA 2ELZA 1WRJA 2EM0A 1PJTA 4WPYA 3EPLA 4GZNC 2B7VA 1G2DC 2JOXA 4GKJE 1ZBQA 2EM8A 1YFHA 3HTXA 2WZOA 2EPCA 4X66E 2J7JA 1RQ0A 2NUGA 3KZYA 2EQ3A 4O24A 3ECRA 4F9AB 4DR1E 2R76A 3DF6A 4JI5E 2DIXA 2EN4A 2B9DA 2WBTA 4WXCA 4M0VA 4ZYGA 4DV5E 3HXLA 4B3RE 2EL4A 1TF6A 2N3GA 5AC4A 2EMXA
chains in the Genus database with same CATH topology
2ENCA 2EPPA 2D9HA 2EN3A 1Z1BA 2EMYA 4X9JA 2EMBA 2GLIA 1A1HA 2YU5A 2R1FA 2CTDA 2EL5A 2EQ1A 3MHSC 4F6MA 4R2SA 2RSIA 2EOZA 2YRMA 1A1IA 2MKNA 2YSOA 2BB8A 2EMCA 1BBOA 2EOEA 2YTQA 3UK3C 2CSHA 1KJKA 1NCSA 2DLKA 2EMGA 2LT7A 2JP9A 1TN9A 2RPCA 2DRPA 2EMHA 2WBUA 2YTDA 1JK2A 2PRTA 5KL3A 2LO3A 2EPAA 2EMAA 1ZU1A 4R2PA 2EE8A 2EOXA 2EM4A 2EM5A 1A1LA 1ZAAC 2E72A 1X6FA 2EMKA 2YU8A 5KL6A 2YRHA 2EPRA 2EORA 4R2DA 2VRDA 5KL2A 1AAYA 2EMLA 2EM7A 2DGCA 5KL4A 2YSPA 4R2AA 2EOHA 3M99B 1A1GA 2EN2A 1A1FA 1TF3A 2DLQA 3VHTB 2LVHA 2EN1A 2EOMA 2EP3A 4IS1C 2YTOA 4M9VC 1BB8A 1RMDA 2EM9A 2NABA 2ADRA 2MKDA 2EOOA 1ZR9A 4IJDA 2ENAA 2YTEA 2EM6A 2JPAA 2YTGA 3EPHA 2YTNA 1X5WA 2MDGA 3EPKA 1X6EA 2EN6A 2EPUA 2EM3A 2LCEA 1X6HA 1WJPA 2EOIA 4R2CA 2LV2A 3MHHC 4FK5C 1G2FC 1LLMC 2EOJA 2EN8A 2EMIA 2EQ0A 2WCC3 2CT1A 2A25A 2YRKA 1F2IG 1YUJA 2EMFA 2YTFA 5KL7A 1UN6B 2EOSA 2ELZA 4F6NA 2M9AA 2EN7A 2EM0A 2ENHA 4R2QA 3EPLA 4GZNC 2EJ4A 2HGHA 2EL6A 1G2DC 4F2JC 2EPXA 4R2EA 2EM8A 2EPCA 2EOQA 2J7JA 1UBDC 2GHFA 2EPZA 2YTJA 4WSGA 2WBSA 2EMZA 2EQ3A 2DMIA 1X3CA 2ELYA 2EOFA 4R2RA 1A1JA 1MEYC 2YTPA 5KL5A 2EOYA 1P47A 1YUIA 2EN4A 2EM2A 1JK1A 3EPJA 2WBTA 1A1KA 1YSAC 2EL4A 2YTIA 1TF6A 2I13A 1DGCA 2EMWA 1B69A 2EMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENC A;  2EPP A;  2D9H A;  2EN3 A;  1Z1B A;  2EMY A;  4X9J A;  2EMB A;  2GLI A;  1A1H A;  2YU5 A;  2R1F A;  2CTD A;  2EL5 A;  2EQ1 A;  3MHS C;  4F6M A;  4R2S A;  2RSI A;  2EOZ A;  2YRM A;  1A1I A;  2MKN A;  2YSO A;  2BB8 A;  2EMC A;  1BBO A;  2EOE A;  2YTQ A;  3UK3 C;  2CSH A;  1KJK A;  1NCS A;  2DLK A;  2EMG A;  2LT7 A;  2JP9 A;  1TN9 A;  2RPC A;  2DRP A;  2EMH A;  2WBU A;  2YTD A;  1JK2 A;  2PRT A;  5KL3 A;  2LO3 A;  2EPA A;  2EMA A;  1ZU1 A;  4R2P A;  2EE8 A;  2EOX A;  2EM4 A;  2EM5 A;  1A1L A;  1ZAA C;  2E72 A;  1X6F A;  2EMK A;  2YU8 A;  5KL6 A;  2YRH A;  2EPR A;  2EOR A;  4R2D A;  2VRD A;  5KL2 A;  1AAY A;  2EML A;  2EM7 A;  2DGC A;  5KL4 A;  2YSP A;  4R2A A;  2EOH A;  3M99 B;  1A1G A;  2EN2 A;  1A1F A;  1TF3 A;  2DLQ A;  3VHT B;  2LVH A;  2EN1 A;  2EOM A;  2EP3 A;  4IS1 C;  2YTO A;  4M9V C;  1BB8 A;  1RMD A;  2EM9 A;  2NAB A;  2ADR A;  2MKD A;  2EOO A;  1ZR9 A;  4IJD A;  2ENA A;  2YTE A;  2EM6 A;  2JPA A;  2YTG A;  3EPH A;  2YTN A;  1X5W A;  2MDG A;  3EPK A;  1X6E A;  2EN6 A;  2EPU A;  2EM3 A;  2LCE A;  1X6H A;  1WJP A;  2EOI A;  4R2C A;  2LV2 A;  3MHH C;  4FK5 C;  1G2F C;  1LLM C;  2EOJ A;  2EN8 A;  2EMI A;  2EQ0 A;  2WCC 3;  2CT1 A;  2A25 A;  2YRK A;  1F2I G;  1YUJ A;  2EMF A;  2YTF A;  5KL7 A;  1UN6 B;  2EOS A;  2ELZ A;  4F6N A;  2M9A A;  2EN7 A;  2EM0 A;  2ENH A;  4R2Q A;  3EPL A;  4GZN C;  2EJ4 A;  2HGH A;  2EL6 A;  1G2D C;  4F2J C;  2EPX A;  4R2E A;  2EM8 A;  2EPC A;  2EOQ A;  2J7J A;  1UBD C;  2GHF A;  2EPZ A;  2YTJ A;  4WSG A;  2WBS A;  2EMZ A;  2EQ3 A;  2DMI A;  1X3C A;  2ELY A;  2EOF A;  4R2R A;  1A1J A;  1MEY C;  2YTP A;  5KL5 A;  2EOY A;  1P47 A;  1YUI A;  2EN4 A;  2EM2 A;  1JK1 A;  3EPJ A;  2WBT A;  1A1K A;  1YSA C;  2EL4 A;  2YTI A;  1TF6 A;  2I13 A;  1DGC A;  2EMW A;  1B69 A;  2EMX A; 
#chains in the Genus database with same CATH topology
 4JI2 E;  3LML A;  1YPN A;  5IXM B;  2VF1 A;  2EMB A;  2M4I A;  4LF6 E;  2R1F A;  2CTD A;  2EQ1 A;  4F6M A;  4R2S A;  4BC7 A;  2RSI A;  2YRM A;  5LMN E;  1IBM E;  2YSO A;  3IWD A;  2BB8 A;  2FTX B;  2NUE A;  1KJK A;  4LFC E;  1NCS A;  2JP9 A;  3HQ1 A;  1EKZ A;  2RPC A;  4BC9 A;  3F6H A;  4NZV A;  2V8Q B;  3TQM A;  3BGH A;  5KL3 A;  2LO3 A;  4R2P A;  2V85 A;  1ZAA C;  1A1L A;  1QNT A;  2BBG A;  5KL6 A;  2EMK A;  2YRH A;  2RTX A;  2V88 A;  4DR2 E;  1T39 A;  2V86 A;  3BBG A;  2VRD A;  1AAY A;  2DGC A;  4DV3 E;  3EQ1 A;  4BS9 A;  1TF3 A;  2EN2 A;  4Q35 B;  2DLQ A;  4O4K A;  2CPN A;  2JVA A;  2LVH A;  1UIL A;  4NHR A;  2YTO A;  5FLX C;  2UU9 E;  1HNW E;  4LF7 E;  4K0K E;  2N8X A;  2JY9 A;  2YTE A;  2LUQ A;  4ZYH A;  5DNY A;  2YTG A;  3EPH A;  1T4L B;  2EN6 A;  5F3W A;  4O43 A;  2E5L E;  2L33 A;  1UHZ A;  4R2C A;  2LV2 A;  3MHH C;  1G2F C;  5IV8 B;  4LF9 E;  3ZOQ B;  1IBL E;  1HR0 E;  2YTF A;  2LJU A;  4B3S E;  1UN6 B;  5TSE A;  4GKK E;  2M9A A;  3JTZ A;  2KOU A;  4R2Q A;  2EJ4 A;  1KYQ A;  2EPX A;  1T4N A;  3RMP A;  2EOQ A;  4DMI A;  2GHF A;  4WSP A;  2YTJ A;  2LTR A;  2EPN A;  5LL6 R;  1X3C A;  4R2R A;  1T38 A;  3C6K A;  3J81 C;  4LU9 A;  1YUI A;  4LTY A;  1JK1 A;  3VYX A;  3EPJ A;  5A6B A;  3KWR A;  1SFE A;  3OTO E;  1YSA C;  2YTI A;  4DR7 E;  1J26 A;  2B7T A;  2ENC A;  2LE2 A;  3VYY A;  2D9H A;  4I8O A;  2RQL A;  3K6Q A;  3ADL A;  2YWQ A;  2DSY A;  3QG5 C;  1GZ6 A;  1YYK A;  2YU5 A;  3MHS C;  1WXR A;  5T6J A;  4HTG A;  1A1I A;  2F4V E;  3JAM C;  1BBO A;  2EOE A;  3UK3 C;  1O0W A;  2CSH A;  2EWL A;  5A69 A;  2VE7 C;  4DV2 E;  4BHB A;  2VQE E;  4JI8 E;  2DRP A;  2YTD A;  5ADZ A;  4DV4 E;  2EPA A;  4TUI A;  2YZT A;  2EE8 A;  2EOX A;  2EM4 A;  2E72 A;  1PKP A;  1X47 A;  1RC7 A;  1SR9 A;  2V83 A;  4MLV A;  4LF4 E;  3VK6 A;  2E1M A;  2FV4 B;  4BCA A;  2YSP A;  5A6A A;  4R2A A;  3HPS A;  5AC5 A;  1A1F A;  1XNQ E;  2UUC E;  4N4R B;  4OX9 E;  2EN1 A;  2EOM A;  2EPL X;  3ADI A;  1BB8 A;  4M9V C;  4LF8 E;  3LLH A;  2NAB A;  2ADR A;  1X48 A;  2MDR A;  4IJD A;  2EM6 A;  4LF5 E;  4F54 A;  1X5W A;  1XNR E;  1PJS A;  3ADJ A;  3THN A;  4O5G A;  1X6E A;  1HNX E;  5IWA E;  1WJP A;  2EOI A;  5AAS A;  4JV5 E;  2G7H A;  2YPN A;  2JYA A;  4FK5 C;  2EOJ A;  4P78 A;  2EMI A;  4HEI A;  4WFT A;  2WCC 3;  1F2I G;  2EPM X;  3P1X A;  3L00 A;  5KL7 A;  2L2N A;  4GEQ B;  1EH6 A;  2EN7 A;  3C4T A;  2L2K B;  2K7I A;  1XMO E;  2YT4 A;  4J8Z A;  2UUA E;  1YYO A;  2LJH A;  2V87 A;  1N33 E;  2ZM6 E;  2VQF E;  1UBD C;  4X62 E;  2EPZ A;  4WSG A;  2L8T A;  2RS6 A;  2LRS A;  4X65 E;  2DMI A;  2ELY A;  5AE1 A;  4LFA E;  1A1J A;  2RSM A;  5KL5 A;  2EOY A;  1PJQ A;  1EH7 A;  4WX9 A;  2I13 A;  1IQO A;  3IWC A;  2JWO A;  5AE2 A;  4F2J C;  1B69 A;  2I9I A;  2EPP A;  5BR8 E;  3HPZ A;  4YY3 E;  3F6G A;  1N3G A;  1X49 A;  3OML A;  2EMY A;  4X9J A;  2LBS B;  2GLI A;  1A1H A;  1N34 E;  5A6K A;  1NEI A;  4NXM E;  4BBY A;  1FKA E;  2MKN A;  2UXC E;  1IBK E;  2EMC A;  2LUP B;  1XMQ E;  2YTQ A;  3MSW A;  2EMG A;  2DLK A;  2DMY A;  2GPI A;  1TN9 A;  2EMH A;  1N32 E;  1BBG A;  1J5E E;  4AQY E;  4KWY A;  2K4V A;  4MLQ A;  2EMA A;  1GQE A;  1ZU1 A;  1X6F A;  2YU8 A;  2ODR D;  1IMU A;  3FIG A;  1GTK A;  3BID A;  2EPR A;  4R2D A;  2RS7 A;  2LMZ A;  4B3T E;  3KZZ A;  2UUB E;  5A6J A;  1A1G A;  3VHT B;  4DKK A;  4L8N A;  2ODR C;  3BF2 A;  2M7Q A;  5A6B D;  4JYA E;  1RMD A;  4ZYD A;  2EM9 A;  1ZR9 A;  3H09 A;  2ENA A;  4YHH E;  2NA2 A;  2JPA A;  2YTN A;  4F9C B;  3J80 C;  3DJW A;  2EPU A;  1DI2 A;  2EM3 A;  4NXN E;  3IWB A;  4BHC A;  2M1S A;  5IT9 C;  2L92 A;  2EQ0 A;  2L2M A;  2CT1 A;  2EPK X;  2H36 X;  2YRK A;  4JI0 E;  2UXD E;  2L3C A;  1N36 E;  1YUJ A;  2EMF A;  2EZ6 A;  2EOS A;  4F6N A;  1I94 E;  2ENH A;  2HGH A;  2EL6 A;  4KZS A;  3AV0 A;  4R2E A;  2LTS A;  3JU0 A;  4P7D A;  4LFB E;  3ADG A;  5LMU E;  2HHH E;  2WBS A;  4OOG C;  2EMZ A;  4R8O A;  4F9B B;  2EOF A;  4JI7 E;  1MEY C;  4JI4 E;  2YTP A;  4B3M E;  4DV0 E;  1STU A;  4TUG A;  4X8W A;  1P47 A;  2MC6 A;  2EPO A;  1FJG E;  2EM2 A;  3T1H E;  2JXP A;  1A1K A;  3J7A G;  2FGG A;  4DR6 E;  4DR4 E;  1DGC A;  2V89 A;  2EMW A;  1AH5 A;  1HNZ E;  4KHP E;  2EN3 A;  1Z1B A;  5AE3 A;  1MGT A;  5A2Q C;  2EL5 A;  4DV7 E;  2EOZ A;  1PDA A;  4WXD A;  4L5N C;  5LLQ A;  4WYQ B;  4X64 E;  2KHX A;  2LT7 A;  1QU6 A;  4R03 A;  4DR5 E;  4DV6 E;  2WBU A;  1JK2 A;  2JOB A;  2PRT A;  2L6M A;  4Q28 A;  4JI3 E;  3C6M A;  1T4O A;  2EM5 A;  1WHN A;  1DQ3 A;  2B3T B;  2EOR A;  4RHB B;  3THO B;  5KL2 A;  5CFF E;  2EML A;  2EM7 A;  5KL4 A;  2L3J A;  4RH8 A;  4DUY E;  2MC5 A;  2EOH A;  3M99 B;  2HC5 A;  4DV1 E;  2NUF A;  4DR3 E;  1IQS A;  2EP3 A;  4IS1 C;  4JI6 E;  2HJJ A;  2MKD A;  2EOO A;  1WHQ A;  3T1Y E;  4M2Z A;  2UXB E;  2KON A;  2MDG A;  1L4S A;  2Q8U A;  3EPK A;  1YZ9 A;  2LCE A;  4DUZ E;  1X6H A;  3AUZ A;  1LLM C;  2N3H A;  2F8B A;  2EN8 A;  2A25 A;  2JR1 A;  4BMJ A;  2DB2 A;  1EH8 A;  1YYW A;  2IHR 1;  4M30 A;  4JI1 E;  1ZBT A;  4ZYE A;  3J7Y p;  3C4B A;  2ELZ A;  1WRJ A;  2EM0 A;  1PJT A;  4WPY A;  3EPL A;  4GZN C;  2B7V A;  1G2D C;  2JOX A;  4GKJ E;  1ZBQ A;  2EM8 A;  1YFH A;  3HTX A;  2WZO A;  2EPC A;  4X66 E;  2J7J A;  1RQ0 A;  2NUG A;  3KZY A;  2EQ3 A;  4O24 A;  3ECR A;  4F9A B;  4DR1 E;  2R76 A;  3DF6 A;  4JI5 E;  2DIX A;  2EN4 A;  2B9D A;  2WBT A;  4WXC A;  4M0V A;  4ZYG A;  4DV5 E;  3HXL A;  4B3R E;  2EL4 A;  1TF6 A;  2N3G A;  5AC4 A;  2EMX A; 
#chains in the Genus database with same CATH homology
 2ENC A;  2EPP A;  2D9H A;  2EN3 A;  1Z1B A;  2EMY A;  4X9J A;  2EMB A;  2GLI A;  1A1H A;  2YU5 A;  2R1F A;  2CTD A;  2EL5 A;  2EQ1 A;  3MHS C;  4F6M A;  4R2S A;  2RSI A;  2EOZ A;  2YRM A;  1A1I A;  2MKN A;  2YSO A;  2BB8 A;  2EMC A;  1BBO A;  2EOE A;  2YTQ A;  3UK3 C;  2CSH A;  1KJK A;  1NCS A;  2DLK A;  2EMG A;  2LT7 A;  2JP9 A;  1TN9 A;  2RPC A;  2DRP A;  2EMH A;  2WBU A;  2YTD A;  1JK2 A;  2PRT A;  5KL3 A;  2LO3 A;  2EPA A;  2EMA A;  1ZU1 A;  4R2P A;  2EE8 A;  2EOX A;  2EM4 A;  2EM5 A;  1A1L A;  1ZAA C;  2E72 A;  1X6F A;  2EMK A;  2YU8 A;  5KL6 A;  2YRH A;  2EPR A;  2EOR A;  4R2D A;  2VRD A;  5KL2 A;  1AAY A;  2EML A;  2EM7 A;  2DGC A;  5KL4 A;  2YSP A;  4R2A A;  2EOH A;  3M99 B;  1A1G A;  2EN2 A;  1A1F A;  1TF3 A;  2DLQ A;  3VHT B;  2LVH A;  2EN1 A;  2EOM A;  2EP3 A;  4IS1 C;  2YTO A;  4M9V C;  1BB8 A;  1RMD A;  2EM9 A;  2NAB A;  2ADR A;  2MKD A;  2EOO A;  1ZR9 A;  4IJD A;  2ENA A;  2YTE A;  2EM6 A;  2JPA A;  2YTG A;  3EPH A;  2YTN A;  1X5W A;  2MDG A;  3EPK A;  1X6E A;  2EN6 A;  2EPU A;  2EM3 A;  2LCE A;  1X6H A;  1WJP A;  2EOI A;  4R2C A;  2LV2 A;  3MHH C;  4FK5 C;  1G2F C;  1LLM C;  2EOJ A;  2EN8 A;  2EMI A;  2EQ0 A;  2WCC 3;  2CT1 A;  2A25 A;  2YRK A;  1F2I G;  1YUJ A;  2EMF A;  2YTF A;  5KL7 A;  1UN6 B;  2EOS A;  2ELZ A;  4F6N A;  2M9A A;  2EN7 A;  2EM0 A;  2ENH A;  4R2Q A;  3EPL A;  4GZN C;  2EJ4 A;  2HGH A;  2EL6 A;  1G2D C;  4F2J C;  2EPX A;  4R2E A;  2EM8 A;  2EPC A;  2EOQ A;  2J7J A;  1UBD C;  2GHF A;  2EPZ A;  2YTJ A;  4WSG A;  2WBS A;  2EMZ A;  2EQ3 A;  2DMI A;  1X3C A;  2ELY A;  2EOF A;  4R2R A;  1A1J A;  1MEY C;  2YTP A;  5KL5 A;  2EOY A;  1P47 A;  1YUI A;  2EN4 A;  2EM2 A;  1JK1 A;  3EPJ A;  2WBT A;  1A1K A;  1YSA C;  2EL4 A;  2YTI A;  1TF6 A;  2I13 A;  1DGC A;  2EMW A;  1B69 A;  2EMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...