2V85A

Crystal structure of rag2-phd finger in complex with h3r2me1k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
b'GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 13
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v85A01
2JWOA 2V87A 2V85A 2V89A 2V83A 2V86A 2V88A
chains in the Genus database with same CATH superfamily
2L2KB 2GLIA 1Z1BA 4NZVA 4BHBA 4AQYE 2EOQA 2D9HA 2LV2A 2RQLA 1PDAA 1ZBQA 3C4BA 5T6JA 1FKAE 5CFFE 1YSAC 5IWAE 1GZ6A 3OTOE 4F9AB 2E5LE 4JI0E 2VE7C 2EMLA 2EMHA 2EM3A 2RS7A 4F9CB 2HHHE 2UXCE 1TN9A 1WXRA 4DKKA 2EPLX 2FV4B 3UK3C 2NUFA 2L2MA 2V85A 2JOBA 4OOGC 2YWQA 1EH7A 2L6MA 2UXDE 4JI8E 4R2DA 4LTYA 4F2JC 1A1GA 2EN8A 2DRPA 2I13A 2B3TB 2CSHA 2MDGA 2GPIA 1N34E 2L33A 3J81C 2EMKA 2DLQA 3IWDA 4DR1E 2RTXA 4DV6E 2FGGA 1UN6B 2YU8A 4LFCE 2EMYA 1X6EA 4N4RB 2NA2A 2N8XA 4LFBE 2LT7A 1N32E 3MSWA 2EMWA 2H36X 4Q28A 2EM7A 4RH8A 4R2AA 2ODRC 2JY9A 1HNXE 3C6KA 1B69A 4GKJE 2F8BA 1X3CA 4HTGA 2DMIA 4F6MA 1HNWE 4L8NA 4JI7E 2FTXB 1RMDA 4K0KE 4M0VA 1T4LB 2JXPA 2MKNA 2L2NA 4WPYA 2VRDA 4RHBB 1JK1A 4R2EA 2EM4A 1DQ3A 2LCEA 2EQ0A 4JI4E 2LE2A 1J5EE 2EM5A 1MGTA 4DR2E 1A1KA 3VYXA 3JU0A 3AUZA 2YRHA 2R1FA 4TUIA 2MKDA 2ELZA 4J8ZA 1T4NA 5KL4A 1RC7A 2EOIA 2DB2A 2JVAA 2EOFA 1O0WA 1SR9A 2KHXA 2EPMX 4MLVA 4DV7E 5F3WA 1RQ0A 4DR5E 1X5WA 2YTJA 4IS1C 1HNZE 2EM6A 3HQ1A 4DUZE 2YTDA 1A1JA 2RSMA 3J7AG 3M99B 2M1SA 4F54A 1NCSA 4X65E 5AC4A 4JI6E 1N33E 2DLKA 2B7TA 3THOB 2EOHA 2VQEE 1GQEA 4M2ZA 2UUAE 2DIXA 2CTDA 2E72A 2EPAA 2L3CA 2I9IA 5A6BD 1DGCA 2YTGA 2LUQA 2YTNA 4DR3E 2EOMA 5BR8E 4ZYGA 3F6GA 4GEQB 5IXMB 2ODRD 4WYQB 2EOEA 4X8WA 4HEIA 4ZYDA 4NXNE 3P1XA 1GTKA 2YTQA 4F9BB 4R8OA 4WX9A 3LMLA 2LJHA 4R2PA 1YYOA 3ECRA 1IMUA 2EPRA 2EQ1A 1F2IG 1LLMC 1UBDC 5ADZA 1P47A 2B7VA 2BBGA 2HC5A 5KL5A 1HR0E 3BF2A 2LUPB 2JR1A 1PJTA 4BC7A 1IQOA 2EMCA 3EPLA 2RS6A 2VQFE 4M9VC 4JV5E 2NABA 1X49A 3EQ1A 4M30A 2EPNA 2YPNA 2V89A 5AE2A 1IBME 2E1MA 2EPZA 1A1HA 4GKKE 2EPCA 4X9JA 4JI3E 1N3GA 2LTSA 2V83A 1NEIA 2KOUA 3HPSA 1YYKA 1YUIA 2ENAA 4DV4E 4JI2E 2EM2A 5KL6A 2EMXA 3ADJA 2YTOA 2EN2A 3ADLA 1A1LA 2V86A 2ENHA 4F6NA 2MC5A 1T38A 2V8QB 3RMPA 3ZOQB 2EMZA 4DV1E 4NHRA 3T1YE 2KONA 1IQSA 2EPUA 2NUEA 4DV3E 4DUYE 3DJWA 3DF6A 2EM8A 2EQ3A 2M7QA 4KWYA 3EPKA 2EOSA 1UILA 4I8OA 2PRTA 2EN3A 2LRSA 1YPNA 3VK6A 2EWLA 1AH5A 2L8TA 5KL7A 3HPZA 3MHSC 2EN6A 4DR7E 2F4VE 4R03A 4B3SE 3VHTB 3J80C 2BB8A 2UUCE 2EMIA 2LO3A 3K6QA 4GZNC 2EL5A 5A6JA 2JWOA 4Q35B 2WBTA 5A6KA 2YRKA 4R2CA 2WBUA 1XNQE 3AV0A 2L3JA 2YT4A 2EPOA 2G7HA 2LTRA 5AC5A 3L00A 5FLXC 3MHHC 1YYWA 2M9AA 4LF9E 2EPXA 2IHR1 2EMFA 1L4SA 1YZ9A 4WFTA 4LF4E 5AASA 5A6BA 2EOXA 1ZU1A 2V87A 4WXDA 1EH8A 4FK5C 2L92A 1QU6A 2RSIA 2VF1A 4X64E 1YUJA 2K7IA 4ZYHA 2ZM6E 3EPJA 2WZOA 1EKZA 3THNA 5LLQA 3KZYA 4LU9A 2YZTA 1G2FC 3HTXA 2EL6A 4KZSA 4B3TE 4L5NC 5IT9C 1FJGE 1T39A 1DI2A 2HGHA 5IV8B 2JYAA 3IWBA 4BHCA 4IJDA 4LF7E 4YY3E 4NXME 2GHFA 1QNTA 2YSPA 4P78A 2MC6A 2YTPA 3KZZA 2DMYA 4DV0E 1SFEA 4LF8E 4JI5E 4DV5E 4KHPE 2R76A 2A25A 2LJUA 2RPCA 5A2QC 5DNYA 2LVHA 3H09A 2EZ6A 2Q8UA 2DGCA 4DMIA 2EJ4A 2EPKX 3HXLA 2DSYA 2YTEA 1PKPA 2UUBE 4WSGA 1XMQE 4B3ME 3C6MA 2EL4A 5AE1A 3T1HE 2EPPA 2M4IA 4X66E 4WSPA 3OMLA 2EN1A 1PJSA 2HJJA 2EN4A 2EM9A 1WHNA 2N3GA 1UHZA 1ZBTA 1BBGA 2N3HA 3JTZA 1STUA 2K4VA 5KL2A 1EH6A 1IBLE 1KJKA 2YU5A 1X6HA 2JOXA 4TUGA 1X48A 4BMJA 4MLQA 2ENCA 4BCAA 4LF5E 1ZAAC 1A1IA 3EPHA 5AE3A 3ADIA 1XMOE 4B3RE 2UXBE 3IWCA 5A69A 2B9DA 3BBGA 3JAMC 2CT1A 1WHQA 2V88A 1X47A 2CPNA 3FIGA 3J7Yp 3QG5C 1JK2A 3VYYA 5TSEA 1J26A 4JYAE 1XNRE 3C4TA 4P7DA 1X6FA 3ADGA 3BGHA 4O5GA 2LMZA 4OX9E 1YFHA 1I94E 4YHHE 2WCC3 1MEYC 1IBKE 2YTIA 1BB8A 4JI1E 2NUGA 1TF3A 1WJPA 2MDRA 1N36E 4R2RA 4LF6E 5LL6R 2LBSB 2J7JA 1PJQA 1AAYA 2ELYA 3KWRA 2WBSA 2YSOA 3TQMA 3F6HA 2EOYA 4R2QA 2EMAA 2EP3A 5LMNE 2EOOA 4ZYEA 3LLHA 2EM0A 2EN7A 4DR4E 2EOZA 2YTFA 4DV2E 2JP9A 1KYQA 4O43A 4X62E 4O24A 4BC9A 3BIDA 2EMBA 5A6AA 1T4OA 5LMUE 2ADRA 4BBYA 2YRMA 4O4KA 1ZR9A 1A1FA 2EOJA 2EORA 4LFAE 1G2DC 1BBOA 2EMGA 1TF6A 1WRJA 2UU9E 2EE8A 4R2SA 5KL3A 4BS9A 2JPAA 4DR6E 4WXCA
chains in the Genus database with same CATH topology
3T1YE 3HXLA 2KONA 2L2KB 2DSYA 2DB2A 2JVAA 1RC7A 1PKPA 1O0WA 2UUBE 4AQYE 1SR9A 2KHXA 1XMQE 4B3ME 2NUEA 4DV3E 4DUYE 3DJWA 3DF6A 4DV7E 5AE1A 5F3WA 1RQ0A 2M7QA 4DR5E 4X66E 2M4IA 3T1HE 4WSPA 3OMLA 1UILA 4I8OA 2LRSA 1ZBQA 3VK6A 1WHNA 1HNZE 2EWLA 2N3GA 1UHZA 1ZBTA 2N3HA 3C4BA 3HQ1A 5T6JA 3JTZA 4DUZE 1FKAE 2RSMA 5CFFE 4DV1E 3J7AG 2L8TA 2M1SA 1STUA 3HPZA 4F54A 2K4VA 4DR6E 1IBLE 4X65E 4TUGA 2JOXA 4JI6E 4DR7E 1N33E 1X48A 4BMJA 2F4VE 4R03A 1GZ6A 2B7TA 5IWAE 4B3SE 3OTOE 4F9AB 2E5LE 3J80C 2VQEE 4JI0E 2VE7C 4BCAA 2UUCE 1GQEA 4M2ZA 4LF5E 2RS7A 4F9CB 2HHHE 2UXCE 2UUAE 5AE3A 3K6QA 3ADIA 1WXRA 4DKKA 1XMOE 2DIXA 4B3RE 2UXBE 3IWCA 2FV4B 2L3CA 2NUFA 2JWOA 2L2MA 2V85A 2B9DA 2JOBA 4OOGC 3JAMC 1WHQA 2L6MA 2LUQA 2UXDE 4JI8E 2V88A 4LTYA 1XNQE 3AV0A 2L3JA 2YT4A 4DR3E 5BR8E 2G7HA 1X47A 2B3TB 2CPNA 3F6GA 4GEQB 2ODRD 4WYQB 1N34E 2L33A 3FIGA 3J81C 4X8WA 2LTRA 3J7Yp 5FLXC 1YYWA 3IWDA 3VYYA 2RTXA 3P1XA 4DV6E 4F9BB 2IHR1 4DR1E 4LF9E 4NXNE 2FGGA 4R8OA 3LMLA 2LJHA 1YYOA 4LFCE 4JYAE 1J26A 1YZ9A 4WFTA 4LF4E 1XNRE 3C4TA 5ADZA 5AASA 2B7VA 2NA2A 4LFBE 1N32E 3MSWA 4P7DA 3ADGA 2V87A 2H36X 4Q28A 1HR0E 2LUPB 2JR1A 2LMZA 2L92A 2ODRC 4OX9E 1QU6A 2JY9A 4BC7A 4YHHE 1I94E 1HNXE 1IBKE 2VF1A 4JI1E 2NUGA 4GKJE 2F8BA 2RS6A 4X64E 2VQFE 2MDRA 2ZM6E 1N36E 4LF6E 4JV5E 2WZOA 1X49A 5LL6R 2LBSB 1EKZA 4L8NA 1HNWE 4M30A 4LU9A 4JI7E 2YZTA 3KWRA 2V89A 2FTXB 5AE2A 1IBME 3HTXA 3F6HA 4K0KE 4KZSA 5LMNE 2E1MA 4M0VA 1T4LB 4GKKE 4B3TE 2L2NA 4WPYA 4L5NC 5IT9C 1FJGE 1DI2A 4JI3E 3LLHA 2LTSA 2V83A 1DQ3A 3IWBA 4DR4E 2KOUA 3HPSA 4DV2E 1YYKA 4JI4E 4LF7E 4YY3E 2LE2A 4X62E 4NXME 1J5EE 4BC9A 4P78A 2MC6A 4DV4E 4JI2E 1T4OA 4DR2E 2DMYA 3ADJA 5LMUE 4DV0E 3VYXA 4LF8E 4JI5E 4BBYA 4DV5E 3ADLA 3JU0A 2V86A 3AUZA 4LFAE 4KHPE 5A2QC 4TUIA 2UU9E 2MC5A 5DNYA 2V8QB 3H09A 3ZOQB 3RMPA 4BS9A 2EZ6A 4J8ZA 4DMIA 1T4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWO A;  2V87 A;  2V85 A;  2V89 A;  2V83 A;  2V86 A;  2V88 A; 
#chains in the Genus database with same CATH topology
 2L2K B;  2GLI A;  1Z1B A;  4NZV A;  4BHB A;  4AQY E;  2EOQ A;  2D9H A;  2LV2 A;  2RQL A;  1PDA A;  1ZBQ A;  3C4B A;  5T6J A;  1FKA E;  5CFF E;  1YSA C;  5IWA E;  1GZ6 A;  3OTO E;  4F9A B;  2E5L E;  4JI0 E;  2VE7 C;  2EML A;  2EMH A;  2EM3 A;  2RS7 A;  4F9C B;  2HHH E;  2UXC E;  1TN9 A;  1WXR A;  4DKK A;  2EPL X;  2FV4 B;  3UK3 C;  2NUF A;  2L2M A;  2V85 A;  2JOB A;  4OOG C;  2YWQ A;  1EH7 A;  2L6M A;  2UXD E;  4JI8 E;  4R2D A;  4LTY A;  4F2J C;  1A1G A;  2EN8 A;  2DRP A;  2I13 A;  2B3T B;  2CSH A;  2MDG A;  2GPI A;  1N34 E;  2L33 A;  3J81 C;  2EMK A;  2DLQ A;  3IWD A;  4DR1 E;  2RTX A;  4DV6 E;  2FGG A;  1UN6 B;  2YU8 A;  4LFC E;  2EMY A;  1X6E A;  4N4R B;  2NA2 A;  2N8X A;  4LFB E;  2LT7 A;  1N32 E;  3MSW A;  2EMW A;  2H36 X;  4Q28 A;  2EM7 A;  4RH8 A;  4R2A A;  2ODR C;  2JY9 A;  1HNX E;  3C6K A;  1B69 A;  4GKJ E;  2F8B A;  1X3C A;  4HTG A;  2DMI A;  4F6M A;  1HNW E;  4L8N A;  4JI7 E;  2FTX B;  1RMD A;  4K0K E;  4M0V A;  1T4L B;  2JXP A;  2MKN A;  2L2N A;  4WPY A;  2VRD A;  4RHB B;  1JK1 A;  4R2E A;  2EM4 A;  1DQ3 A;  2LCE A;  2EQ0 A;  4JI4 E;  2LE2 A;  1J5E E;  2EM5 A;  1MGT A;  4DR2 E;  1A1K A;  3VYX A;  3JU0 A;  3AUZ A;  2YRH A;  2R1F A;  4TUI A;  2MKD A;  2ELZ A;  4J8Z A;  1T4N A;  5KL4 A;  1RC7 A;  2EOI A;  2DB2 A;  2JVA A;  2EOF A;  1O0W A;  1SR9 A;  2KHX A;  2EPM X;  4MLV A;  4DV7 E;  5F3W A;  1RQ0 A;  4DR5 E;  1X5W A;  2YTJ A;  4IS1 C;  1HNZ E;  2EM6 A;  3HQ1 A;  4DUZ E;  2YTD A;  1A1J A;  2RSM A;  3J7A G;  3M99 B;  2M1S A;  4F54 A;  1NCS A;  4X65 E;  5AC4 A;  4JI6 E;  1N33 E;  2DLK A;  2B7T A;  3THO B;  2EOH A;  2VQE E;  1GQE A;  4M2Z A;  2UUA E;  2DIX A;  2CTD A;  2E72 A;  2EPA A;  2L3C A;  2I9I A;  5A6B D;  1DGC A;  2YTG A;  2LUQ A;  2YTN A;  4DR3 E;  2EOM A;  5BR8 E;  4ZYG A;  3F6G A;  4GEQ B;  5IXM B;  2ODR D;  4WYQ B;  2EOE A;  4X8W A;  4HEI A;  4ZYD A;  4NXN E;  3P1X A;  1GTK A;  2YTQ A;  4F9B B;  4R8O A;  4WX9 A;  3LML A;  2LJH A;  4R2P A;  1YYO A;  3ECR A;  1IMU A;  2EPR A;  2EQ1 A;  1F2I G;  1LLM C;  1UBD C;  5ADZ A;  1P47 A;  2B7V A;  2BBG A;  2HC5 A;  5KL5 A;  1HR0 E;  3BF2 A;  2LUP B;  2JR1 A;  1PJT A;  4BC7 A;  1IQO A;  2EMC A;  3EPL A;  2RS6 A;  2VQF E;  4M9V C;  4JV5 E;  2NAB A;  1X49 A;  3EQ1 A;  4M30 A;  2EPN A;  2YPN A;  2V89 A;  5AE2 A;  1IBM E;  2E1M A;  2EPZ A;  1A1H A;  4GKK E;  2EPC A;  4X9J A;  4JI3 E;  1N3G A;  2LTS A;  2V83 A;  1NEI A;  2KOU A;  3HPS A;  1YYK A;  1YUI A;  2ENA A;  4DV4 E;  4JI2 E;  2EM2 A;  5KL6 A;  2EMX A;  3ADJ A;  2YTO A;  2EN2 A;  3ADL A;  1A1L A;  2V86 A;  2ENH A;  4F6N A;  2MC5 A;  1T38 A;  2V8Q B;  3RMP A;  3ZOQ B;  2EMZ A;  4DV1 E;  4NHR A;  3T1Y E;  2KON A;  1IQS A;  2EPU A;  2NUE A;  4DV3 E;  4DUY E;  3DJW A;  3DF6 A;  2EM8 A;  2EQ3 A;  2M7Q A;  4KWY A;  3EPK A;  2EOS A;  1UIL A;  4I8O A;  2PRT A;  2EN3 A;  2LRS A;  1YPN A;  3VK6 A;  2EWL A;  1AH5 A;  2L8T A;  5KL7 A;  3HPZ A;  3MHS C;  2EN6 A;  4DR7 E;  2F4V E;  4R03 A;  4B3S E;  3VHT B;  3J80 C;  2BB8 A;  2UUC E;  2EMI A;  2LO3 A;  3K6Q A;  4GZN C;  2EL5 A;  5A6J A;  2JWO A;  4Q35 B;  2WBT A;  5A6K A;  2YRK A;  4R2C A;  2WBU A;  1XNQ E;  3AV0 A;  2L3J A;  2YT4 A;  2EPO A;  2G7H A;  2LTR A;  5AC5 A;  3L00 A;  5FLX C;  3MHH C;  1YYW A;  2M9A A;  4LF9 E;  2EPX A;  2IHR 1;  2EMF A;  1L4S A;  1YZ9 A;  4WFT A;  4LF4 E;  5AAS A;  5A6B A;  2EOX A;  1ZU1 A;  2V87 A;  4WXD A;  1EH8 A;  4FK5 C;  2L92 A;  1QU6 A;  2RSI A;  2VF1 A;  4X64 E;  1YUJ A;  2K7I A;  4ZYH A;  2ZM6 E;  3EPJ A;  2WZO A;  1EKZ A;  3THN A;  5LLQ A;  3KZY A;  4LU9 A;  2YZT A;  1G2F C;  3HTX A;  2EL6 A;  4KZS A;  4B3T E;  4L5N C;  5IT9 C;  1FJG E;  1T39 A;  1DI2 A;  2HGH A;  5IV8 B;  2JYA A;  3IWB A;  4BHC A;  4IJD A;  4LF7 E;  4YY3 E;  4NXM E;  2GHF A;  1QNT A;  2YSP A;  4P78 A;  2MC6 A;  2YTP A;  3KZZ A;  2DMY A;  4DV0 E;  1SFE A;  4LF8 E;  4JI5 E;  4DV5 E;  4KHP E;  2R76 A;  2A25 A;  2LJU A;  2RPC A;  5A2Q C;  5DNY A;  2LVH A;  3H09 A;  2EZ6 A;  2Q8U A;  2DGC A;  4DMI A;  2EJ4 A;  2EPK X;  3HXL A;  2DSY A;  2YTE A;  1PKP A;  2UUB E;  4WSG A;  1XMQ E;  4B3M E;  3C6M A;  2EL4 A;  5AE1 A;  3T1H E;  2EPP A;  2M4I A;  4X66 E;  4WSP A;  3OML A;  2EN1 A;  1PJS A;  2HJJ A;  2EN4 A;  2EM9 A;  1WHN A;  2N3G A;  1UHZ A;  1ZBT A;  1BBG A;  2N3H A;  3JTZ A;  1STU A;  2K4V A;  5KL2 A;  1EH6 A;  1IBL E;  1KJK A;  2YU5 A;  1X6H A;  2JOX A;  4TUG A;  1X48 A;  4BMJ A;  4MLQ A;  2ENC A;  4BCA A;  4LF5 E;  1ZAA C;  1A1I A;  3EPH A;  5AE3 A;  3ADI A;  1XMO E;  4B3R E;  2UXB E;  3IWC A;  5A69 A;  2B9D A;  3BBG A;  3JAM C;  2CT1 A;  1WHQ A;  2V88 A;  1X47 A;  2CPN A;  3FIG A;  3J7Y p;  3QG5 C;  1JK2 A;  3VYY A;  5TSE A;  1J26 A;  4JYA E;  1XNR E;  3C4T A;  4P7D A;  1X6F A;  3ADG A;  3BGH A;  4O5G A;  2LMZ A;  4OX9 E;  1YFH A;  1I94 E;  4YHH E;  2WCC 3;  1MEY C;  1IBK E;  2YTI A;  1BB8 A;  4JI1 E;  2NUG A;  1TF3 A;  1WJP A;  2MDR A;  1N36 E;  4R2R A;  4LF6 E;  5LL6 R;  2LBS B;  2J7J A;  1PJQ A;  1AAY A;  2ELY A;  3KWR A;  2WBS A;  2YSO A;  3TQM A;  3F6H A;  2EOY A;  4R2Q A;  2EMA A;  2EP3 A;  5LMN E;  2EOO A;  4ZYE A;  3LLH A;  2EM0 A;  2EN7 A;  4DR4 E;  2EOZ A;  2YTF A;  4DV2 E;  2JP9 A;  1KYQ A;  4O43 A;  4X62 E;  4O24 A;  4BC9 A;  3BID A;  2EMB A;  5A6A A;  1T4O A;  5LMU E;  2ADR A;  4BBY A;  2YRM A;  4O4K A;  1ZR9 A;  1A1F A;  2EOJ A;  2EOR A;  4LFA E;  1G2D C;  1BBO A;  2EMG A;  1TF6 A;  1WRJ A;  2UU9 E;  2EE8 A;  4R2S A;  5KL3 A;  4BS9 A;  2JPA A;  4DR6 E;  4WXC A; 
#chains in the Genus database with same CATH homology
 3T1Y E;  3HXL A;  2KON A;  2L2K B;  2DSY A;  2DB2 A;  2JVA A;  1RC7 A;  1PKP A;  1O0W A;  2UUB E;  4AQY E;  1SR9 A;  2KHX A;  1XMQ E;  4B3M E;  2NUE A;  4DV3 E;  4DUY E;  3DJW A;  3DF6 A;  4DV7 E;  5AE1 A;  5F3W A;  1RQ0 A;  2M7Q A;  4DR5 E;  4X66 E;  2M4I A;  3T1H E;  4WSP A;  3OML A;  1UIL A;  4I8O A;  2LRS A;  1ZBQ A;  3VK6 A;  1WHN A;  1HNZ E;  2EWL A;  2N3G A;  1UHZ A;  1ZBT A;  2N3H A;  3C4B A;  3HQ1 A;  5T6J A;  3JTZ A;  4DUZ E;  1FKA E;  2RSM A;  5CFF E;  4DV1 E;  3J7A G;  2L8T A;  2M1S A;  1STU A;  3HPZ A;  4F54 A;  2K4V A;  4DR6 E;  1IBL E;  4X65 E;  4TUG A;  2JOX A;  4JI6 E;  4DR7 E;  1N33 E;  1X48 A;  4BMJ A;  2F4V E;  4R03 A;  1GZ6 A;  2B7T A;  5IWA E;  4B3S E;  3OTO E;  4F9A B;  2E5L E;  3J80 C;  2VQE E;  4JI0 E;  2VE7 C;  4BCA A;  2UUC E;  1GQE A;  4M2Z A;  4LF5 E;  2RS7 A;  4F9C B;  2HHH E;  2UXC E;  2UUA E;  5AE3 A;  3K6Q A;  3ADI A;  1WXR A;  4DKK A;  1XMO E;  2DIX A;  4B3R E;  2UXB E;  3IWC A;  2FV4 B;  2L3C A;  2NUF A;  2JWO A;  2L2M A;  2V85 A;  2B9D A;  2JOB A;  4OOG C;  3JAM C;  1WHQ A;  2L6M A;  2LUQ A;  2UXD E;  4JI8 E;  2V88 A;  4LTY A;  1XNQ E;  3AV0 A;  2L3J A;  2YT4 A;  4DR3 E;  5BR8 E;  2G7H A;  1X47 A;  2B3T B;  2CPN A;  3F6G A;  4GEQ B;  2ODR D;  4WYQ B;  1N34 E;  2L33 A;  3FIG A;  3J81 C;  4X8W A;  2LTR A;  3J7Y p;  5FLX C;  1YYW A;  3IWD A;  3VYY A;  2RTX A;  3P1X A;  4DV6 E;  4F9B B;  2IHR 1;  4DR1 E;  4LF9 E;  4NXN E;  2FGG A;  4R8O A;  3LML A;  2LJH A;  1YYO A;  4LFC E;  4JYA E;  1J26 A;  1YZ9 A;  4WFT A;  4LF4 E;  1XNR E;  3C4T A;  5ADZ A;  5AAS A;  2B7V A;  2NA2 A;  4LFB E;  1N32 E;  3MSW A;  4P7D A;  3ADG A;  2V87 A;  2H36 X;  4Q28 A;  1HR0 E;  2LUP B;  2JR1 A;  2LMZ A;  2L92 A;  2ODR C;  4OX9 E;  1QU6 A;  2JY9 A;  4BC7 A;  4YHH E;  1I94 E;  1HNX E;  1IBK E;  2VF1 A;  4JI1 E;  2NUG A;  4GKJ E;  2F8B A;  2RS6 A;  4X64 E;  2VQF E;  2MDR A;  2ZM6 E;  1N36 E;  4LF6 E;  4JV5 E;  2WZO A;  1X49 A;  5LL6 R;  2LBS B;  1EKZ A;  4L8N A;  1HNW E;  4M30 A;  4LU9 A;  4JI7 E;  2YZT A;  3KWR A;  2V89 A;  2FTX B;  5AE2 A;  1IBM E;  3HTX A;  3F6H A;  4K0K E;  4KZS A;  5LMN E;  2E1M A;  4M0V A;  1T4L B;  4GKK E;  4B3T E;  2L2N A;  4WPY A;  4L5N C;  5IT9 C;  1FJG E;  1DI2 A;  4JI3 E;  3LLH A;  2LTS A;  2V83 A;  1DQ3 A;  3IWB A;  4DR4 E;  2KOU A;  3HPS A;  4DV2 E;  1YYK A;  4JI4 E;  4LF7 E;  4YY3 E;  2LE2 A;  4X62 E;  4NXM E;  1J5E E;  4BC9 A;  4P78 A;  2MC6 A;  4DV4 E;  4JI2 E;  1T4O A;  4DR2 E;  2DMY A;  3ADJ A;  5LMU E;  4DV0 E;  3VYX A;  4LF8 E;  4JI5 E;  4BBY A;  4DV5 E;  3ADL A;  3JU0 A;  2V86 A;  3AUZ A;  4LFA E;  4KHP E;  5A2Q C;  4TUI A;  2UU9 E;  2MC5 A;  5DNY A;  2V8Q B;  3H09 A;  3ZOQ B;  3RMP A;  4BS9 A;  2EZ6 A;  4J8Z A;  4DMI A;  1T4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...