2V85A

Crystal structure of rag2-phd finger in complex with h3r2me1k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v85A01
2V85A 2V88A 2V87A 2V86A 2V89A 2V83A 2JWOA
chains in the Genus database with same CATH superfamily
2E1MA 1JK2A 1N3GA 4BC7A 1YUIA 2RTXA 2BB8A 1TF6A 2CTDA 5KL7A 1N32E 2EMZA 2CT1A 2VQEE 1NEIA 4O4KA 3ADIA 2ELZA 4WX9A 2EPOA 2EL4A 4BHCA 4NHRA 2YTOA 2GPIA 4RHBB 1WXRA 4WXDA 1I94E 3EPLA 5A6JA 1X48A 1X5WA 2K4VA 1YZ9A 4X9JA 4R03A 4R2DA 3J80C 1GTKA 1QNTA 2UXCE 4X8WA 2EPXA 3TQMA 4JI2E 3M99B 2JWOA 4OX9E 4TUIA 5A6KA 2L2NA 2B9DA 1N33E 2EM8A 5IXMB 2JXPA 2I9IA 1FJGE 2F4VE 3QG5C 3MHHC 4P78A 2YTQA 1PJTA 4J8ZA 2EOYA 4AQYE 2RS6A 3JU0A 4DR4E 3J7AG 4HEIA 1J26A 2V85A 2R76A 4O43A 2I13A 2UU9E 2EP3A 3RMPA 2JOBA 1WHNA 1T4OA 1QU6A 2EOEA 5DNYA 3OTOE 4ZYGA 1PKPA 2EMIA 4YHHE 1AAYA 2RQLA 4X65E 1WRJA 2B7TA 5IV8B 4GKJE 4IJDA 3EPHA 2KONA 4F9CB 2L3CA 4JI5E 1XMOE 4LF9E 3VYYA 2EM6A 3ZOQB 1DGCA 1RMDA 4OOGC 2EMGA 2EOXA 1ZAAC 2IHR1 2NUEA 2UXBE 1XNQE 3VHTB 1RQ0A 2M4IA 4ZYDA 2EOJA 2DLKA 5KL3A 4DV0E 2DGCA 4R2SA 4HTGA 4M2ZA 4DV5E 2V86A 2JY9A 4X62E 2RPCA 4IS1C 3H09A 3L00A 3HXLA 2DRPA 4X64E 5AE1A 5AASA 1UBDC 2EPRA 4DUZE 2LUPB 2CSHA 2ENHA 2ELYA 3BGHA 2M7QA 2EN7A 2EPKX 2DMIA 2MC5A 2LTSA 1A1IA 2LVHA 5AC5A 2UUAE 1BBGA 2ODRC 3VK6A 4RH8A 2EPCA 2YTIA 2YSOA 1STUA 5KL6A 1YSAC 1ZU1A 3EQ1A 4LU9A 4F2JC 4DR7E 5LL6R 4JYAE 2EMLA 2NUGA 2EOQA 1GQEA 1T4LB 2WBTA 2EM9A 2EM0A 2N8XA 3IWCA 1A1FA 1PJQA 2EMAA 4GEQB 2EMHA 4R8OA 2MKDA 2YWQA 1A1JA 2B3TB 4WSPA 1A1HA 4O5GA 3JAMC 5AE3A 2H36X 4JI7E 2ADRA 2EM5A 5A6BA 2EJ4A 1N34E 4JV5E 4GZNC 4F54A 2EMKA 2PRTA 2M1SA 1F2IG 4BHBA 1A1GA 2E5LE 4LFCE 3F6GA 3IWDA 2YTPA 5A6AA 5LLQA 2LRSA 5AC4A 2LE2A 4L8NA 5F3WA 3ADJA 2EORA 2EOMA 1YYWA 2EQ0A 4DR6E 1IBME 4LF7E 4NXNE 1X47A 4M0VA 1YYOA 1IQOA 4DR1E 3IWBA 2JPAA 4BCAA 2YTDA 4M30A 2L3JA 5IWAE 3ADLA 5IT9C 1YYKA 3HPSA 1KJKA 2RS7A 2L92A 1IBKE 2EPLX 2V83A 1FKAE 2EPNA 3C4BA 1G2FC 2EM4A 2MDGA 2M9AA 2UUBE 5BR8E 1HNWE 2NABA 2N3HA 2YU5A 1MGTA 2NUFA 4DMIA 4B3TE 4Q28A 4DKKA 2NA2A 2FV4B 2A25A 2YT4A 4LF6E 4LFAE 2EPMX 1A1LA 1YUJA 2EPZA 4N4RB 1ZR9A 2DLQA 2LT7A 4JI1E 4P7DA 1TF3A 4DV7E 2MDRA 2BBGA 2F8BA 3LLHA 4JI6E 2EOFA 2EQ3A 4F6NA 4GKKE 5ADZA 1T4NA 1O0WA 2HHHE 2EM7A 2EWLA 4R2CA 3OMLA 1P47A 1J5EE 4B3SE 1RC7A 2CPNA 3ECRA 5KL4A 1SR9A 1BB8A 2EPUA 2JR1A 4DUYE 2V88A 2V87A 1HNXE 2KHXA 2EMBA 4F6MA 4WYQB 5T6JA 5KL2A 1TN9A 2E72A 2EN3A 2YTGA 4R2AA 4DR3E 1UILA 4NZVA 5AE2A 4O24A 1G2DC 2EMYA 2ODRD 2V89A 1EH7A 2YTJA 2MKNA 2L6MA 2DSYA 4F9AB 1YFHA 3C4TA 2L8TA 2YU8A 4NXME 2ENAA 3J81C 1UHZA 4R2EA 4DR5E 2GHFA 2EOSA 2EN1A 2YPNA 2WCC3 2K7IA 1PDAA 2Q8UA 2EOZA 3T1HE 1UN6B 3C6KA 3LMLA 1N36E 2D9HA 3UK3C 4DV1E 3DF6A 1YPNA 4YY3E 2LMZA 5KL5A 2V8QB 1B69A 4MLVA 3FIGA 1X3CA 2LO3A 2LTRA 4DR2E 4ZYHA 2UUCE 3VYXA 2EN8A 2UXDE 4MLQA 2YRKA 2L2MA 4BS9A 5FLXC 2WZOA 2HGHA 1DQ3A 1X6HA 3BIDA 1ZBQA 3MSWA 4R2QA 1EKZA 4I8OA 5A2QC 2RSIA 4BMJA 4X66E 4WXCA 1AH5A 1IQSA 2EM2A 3F6HA 2G7HA 2LCEA 2EOHA 4BBYA 1IMUA 4Q35B 4KZSA 1IBLE 2EN2A 1LLMC 1HR0E 4M9VC 1WHQA 1BBOA 4JI0E 3MHSC 4LF8E 4DV4E 3K6QA 2EL6A 3BF2A 2DIXA 1T39A 2GLIA 2YRMA 1GZ6A 1SFEA 4DV2E 1A1KA 2WBSA 2N3GA 1X6EA 3AUZA 2ZM6E 1XMQE 3HTXA 4ZYEA 1DI2A 2EN4A 2EMWA 2YTEA 2FTXB 4B3ME 3ADGA 4TUGA 2EOIA 2HJJA 1EH8A 2DMYA 2DB2A 4LTYA 2YRHA 1NCSA 4LF4E 2JYAA 5LMUE 4BC9A 2EE8A 2VE7C 1XNRE 3KZYA 2HC5A 4WPYA 4KHPE 4KWYA 1PJSA 4DV6E 4JI4E 2VRDA 3BBGA 2WBUA 2J7JA 2EPAA 1L4SA 1HNZE 3HQ1A 2LUQA 4LFBE 3EPKA 3HPZA 2LJHA 1Z1BA 3AV0A 2L33A 3DJWA 4K0KE 2KOUA 2B7VA 2ENCA 2EM3A 3EPJA 1ZBTA 2EMCA 3P1XA 3T1YE 2EMXA 1KYQA 1JK1A 1MEYC 1X49A 2RSMA 4LF5E 4R2RA 2VF1A 2JVAA 3J7Yp 4FK5C 2LBSB 5LMNE 4F9BB 3KWRA 2EQ1A 4WFTA 4JI8E 5TSEA 4DV3E 2LJUA 1T38A 3THNA 2FGGA 4JI3E 2EZ6A 4B3RE 1WJPA 2YZTA 3JTZA 1EH6A 2YSPA 2EPPA 2LV2A 2EN6A 3C6MA 2YTNA 5A6BD 2VQFE 5CFFE 1X6FA 2JOXA 4WSGA 2R1FA 2EL5A 3KZZA 5A69A 2L2KB 2JP9A 3THOB 4R2PA 2MC6A 2YTFA 2EMFA 4L5NC 2EOOA
chains in the Genus database with same CATH topology
4P7DA 2E1MA 3H09A 4DV4E 4DV7E 2MDRA 3K6QA 3HXLA 2F8BA 2DIXA 4BC7A 3LLHA 4X64E 4JI6E 5AE1A 5AASA 4DUZE 2LUPB 2RTXA 1GZ6A 4GKKE 2M7QA 5ADZA 1T4NA 1N32E 4DV2E 1O0WA 2N3GA 3AUZA 1XMQE 2MC5A 2LTSA 2ZM6E 2VQEE 2EWLA 2HHHE 3OMLA 3HTXA 1J5EE 1DI2A 2UUAE 2FTXB 2ODRC 3ADGA 3VK6A 1RC7A 2CPNA 4B3SE 4TUGA 4B3ME 3ADIA 1SR9A 2JR1A 4DUYE 2V88A 2DMYA 1STUA 2DB2A 2V87A 4LTYA 1WXRA 1I94E 4LU9A 1HNXE 4DR7E 2KHXA 5LL6R 4LF4E 1X48A 2K4VA 4BC9A 5LMUE 1YZ9A 4JYAE 4WYQB 2NUGA 5T6JA 2VE7C 4R03A 1XNRE 1GQEA 3J80C 1T4LB 4WPYA 4KHPE 2UXCE 4X8WA 4DV6E 4JI2E 4JI4E 4DR3E 3IWCA 1HNZE 3HQ1A 1UILA 4GEQB 2JWOA 2LUQA 4LFBE 5AE2A 4R8OA 4OX9E 4TUIA 2L2NA 2B9DA 3HPZA 2B3TB 2ODRD 2V89A 4WSPA 1N33E 3JAMC 2LJHA 5AE3A 1FJGE 3AV0A 2H36X 2L33A 2L6MA 2DSYA 3DJWA 4JI7E 4F9AB 2F4VE 4K0KE 3C4TA 2KOUA 4P78A 4JV5E 1N34E 2B7VA 2L8TA 4J8ZA 4AQYE 4NXME 2RS6A 4F54A 3J81C 1UHZA 2M1SA 4DR5E 3JU0A 4DR4E 3J7AG 2E5LE 1ZBTA 4LFCE 3F6GA 3IWDA 3P1XA 3T1YE 2V85A 1J26A 2LRSA 2UU9E 2LE2A 4L8NA 5F3WA 1X49A 2RSMA 3ADJA 4LF5E 1YYWA 2VF1A 2JVAA 2JOBA 3J7Yp 3RMPA 1WHNA 3ADLA 1T4OA 1QU6A 4DR6E 3T1HE 2LBSB 1IBME 5DNYA 3LMLA 3OTOE 5LMNE 1N36E 4LF7E 4NXNE 1X47A 4F9BB 4M0VA 4DV1E 1YYOA 4DR1E 3IWBA 3KWRA 3DF6A 4BCAA 1PKPA 4WFTA 4M30A 2LMZA 4JI8E 2V8QB 4YY3E 5IWAE 3FIGA 4X65E 4YHHE 2L3JA 5IT9C 2LTRA 2B7TA 3HPSA 4DV3E 4DR2E 1YYKA 2UUCE 3VYXA 2UXDE 4GKJE 2RS7A 2L92A 1IBKE 4JI3E 2FGGA 2V83A 1FKAE 2L2MA 2EZ6A 4BS9A 4B3RE 2YZTA 3C4BA 2KONA 3JTZA 2WZOA 4F9CB 5FLXC 1DQ3A 2L3CA 4JI5E 1XMOE 4LF9E 3VYYA 1ZBQA 3ZOQB 3MSWA 1EKZA 4OOGC 2UUBE 4I8OA 5BR8E 4BMJA 5A2QC 2VQFE 1HNWE 4X66E 5CFFE 2N3HA 2JOXA 2IHR1 2NUFA 4DMIA 2NUEA 2UXBE 4B3TE 2L2KB 1XNQE 4Q28A 3F6HA 2G7HA 1RQ0A 2M4IA 4BBYA 4DKKA 2NA2A 2FV4B 2YT4A 4KZSA 4DV0E 1IBLE 4LF6E 4LF8E 4LFAE 2MC6A 1HR0E 1WHQA 4M2ZA 4DV5E 2V86A 4JI0E 2JY9A 4L5NC 4X62E 4JI1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V85 A;  2V88 A;  2V87 A;  2V86 A;  2V89 A;  2V83 A;  2JWO A; 
#chains in the Genus database with same CATH topology
 2E1M A;  1JK2 A;  1N3G A;  4BC7 A;  1YUI A;  2RTX A;  2BB8 A;  1TF6 A;  2CTD A;  5KL7 A;  1N32 E;  2EMZ A;  2CT1 A;  2VQE E;  1NEI A;  4O4K A;  3ADI A;  2ELZ A;  4WX9 A;  2EPO A;  2EL4 A;  4BHC A;  4NHR A;  2YTO A;  2GPI A;  4RHB B;  1WXR A;  4WXD A;  1I94 E;  3EPL A;  5A6J A;  1X48 A;  1X5W A;  2K4V A;  1YZ9 A;  4X9J A;  4R03 A;  4R2D A;  3J80 C;  1GTK A;  1QNT A;  2UXC E;  4X8W A;  2EPX A;  3TQM A;  4JI2 E;  3M99 B;  2JWO A;  4OX9 E;  4TUI A;  5A6K A;  2L2N A;  2B9D A;  1N33 E;  2EM8 A;  5IXM B;  2JXP A;  2I9I A;  1FJG E;  2F4V E;  3QG5 C;  3MHH C;  4P78 A;  2YTQ A;  1PJT A;  4J8Z A;  2EOY A;  4AQY E;  2RS6 A;  3JU0 A;  4DR4 E;  3J7A G;  4HEI A;  1J26 A;  2V85 A;  2R76 A;  4O43 A;  2I13 A;  2UU9 E;  2EP3 A;  3RMP A;  2JOB A;  1WHN A;  1T4O A;  1QU6 A;  2EOE A;  5DNY A;  3OTO E;  4ZYG A;  1PKP A;  2EMI A;  4YHH E;  1AAY A;  2RQL A;  4X65 E;  1WRJ A;  2B7T A;  5IV8 B;  4GKJ E;  4IJD A;  3EPH A;  2KON A;  4F9C B;  2L3C A;  4JI5 E;  1XMO E;  4LF9 E;  3VYY A;  2EM6 A;  3ZOQ B;  1DGC A;  1RMD A;  4OOG C;  2EMG A;  2EOX A;  1ZAA C;  2IHR 1;  2NUE A;  2UXB E;  1XNQ E;  3VHT B;  1RQ0 A;  2M4I A;  4ZYD A;  2EOJ A;  2DLK A;  5KL3 A;  4DV0 E;  2DGC A;  4R2S A;  4HTG A;  4M2Z A;  4DV5 E;  2V86 A;  2JY9 A;  4X62 E;  2RPC A;  4IS1 C;  3H09 A;  3L00 A;  3HXL A;  2DRP A;  4X64 E;  5AE1 A;  5AAS A;  1UBD C;  2EPR A;  4DUZ E;  2LUP B;  2CSH A;  2ENH A;  2ELY A;  3BGH A;  2M7Q A;  2EN7 A;  2EPK X;  2DMI A;  2MC5 A;  2LTS A;  1A1I A;  2LVH A;  5AC5 A;  2UUA E;  1BBG A;  2ODR C;  3VK6 A;  4RH8 A;  2EPC A;  2YTI A;  2YSO A;  1STU A;  5KL6 A;  1YSA C;  1ZU1 A;  3EQ1 A;  4LU9 A;  4F2J C;  4DR7 E;  5LL6 R;  4JYA E;  2EML A;  2NUG A;  2EOQ A;  1GQE A;  1T4L B;  2WBT A;  2EM9 A;  2EM0 A;  2N8X A;  3IWC A;  1A1F A;  1PJQ A;  2EMA A;  4GEQ B;  2EMH A;  4R8O A;  2MKD A;  2YWQ A;  1A1J A;  2B3T B;  4WSP A;  1A1H A;  4O5G A;  3JAM C;  5AE3 A;  2H36 X;  4JI7 E;  2ADR A;  2EM5 A;  5A6B A;  2EJ4 A;  1N34 E;  4JV5 E;  4GZN C;  4F54 A;  2EMK A;  2PRT A;  2M1S A;  1F2I G;  4BHB A;  1A1G A;  2E5L E;  4LFC E;  3F6G A;  3IWD A;  2YTP A;  5A6A A;  5LLQ A;  2LRS A;  5AC4 A;  2LE2 A;  4L8N A;  5F3W A;  3ADJ A;  2EOR A;  2EOM A;  1YYW A;  2EQ0 A;  4DR6 E;  1IBM E;  4LF7 E;  4NXN E;  1X47 A;  4M0V A;  1YYO A;  1IQO A;  4DR1 E;  3IWB A;  2JPA A;  4BCA A;  2YTD A;  4M30 A;  2L3J A;  5IWA E;  3ADL A;  5IT9 C;  1YYK A;  3HPS A;  1KJK A;  2RS7 A;  2L92 A;  1IBK E;  2EPL X;  2V83 A;  1FKA E;  2EPN A;  3C4B A;  1G2F C;  2EM4 A;  2MDG A;  2M9A A;  2UUB E;  5BR8 E;  1HNW E;  2NAB A;  2N3H A;  2YU5 A;  1MGT A;  2NUF A;  4DMI A;  4B3T E;  4Q28 A;  4DKK A;  2NA2 A;  2FV4 B;  2A25 A;  2YT4 A;  4LF6 E;  4LFA E;  2EPM X;  1A1L A;  1YUJ A;  2EPZ A;  4N4R B;  1ZR9 A;  2DLQ A;  2LT7 A;  4JI1 E;  4P7D A;  1TF3 A;  4DV7 E;  2MDR A;  2BBG A;  2F8B A;  3LLH A;  4JI6 E;  2EOF A;  2EQ3 A;  4F6N A;  4GKK E;  5ADZ A;  1T4N A;  1O0W A;  2HHH E;  2EM7 A;  2EWL A;  4R2C A;  3OML A;  1P47 A;  1J5E E;  4B3S E;  1RC7 A;  2CPN A;  3ECR A;  5KL4 A;  1SR9 A;  1BB8 A;  2EPU A;  2JR1 A;  4DUY E;  2V88 A;  2V87 A;  1HNX E;  2KHX A;  2EMB A;  4F6M A;  4WYQ B;  5T6J A;  5KL2 A;  1TN9 A;  2E72 A;  2EN3 A;  2YTG A;  4R2A A;  4DR3 E;  1UIL A;  4NZV A;  5AE2 A;  4O24 A;  1G2D C;  2EMY A;  2ODR D;  2V89 A;  1EH7 A;  2YTJ A;  2MKN A;  2L6M A;  2DSY A;  4F9A B;  1YFH A;  3C4T A;  2L8T A;  2YU8 A;  4NXM E;  2ENA A;  3J81 C;  1UHZ A;  4R2E A;  4DR5 E;  2GHF A;  2EOS A;  2EN1 A;  2YPN A;  2WCC 3;  2K7I A;  1PDA A;  2Q8U A;  2EOZ A;  3T1H E;  1UN6 B;  3C6K A;  3LML A;  1N36 E;  2D9H A;  3UK3 C;  4DV1 E;  3DF6 A;  1YPN A;  4YY3 E;  2LMZ A;  5KL5 A;  2V8Q B;  1B69 A;  4MLV A;  3FIG A;  1X3C A;  2LO3 A;  2LTR A;  4DR2 E;  4ZYH A;  2UUC E;  3VYX A;  2EN8 A;  2UXD E;  4MLQ A;  2YRK A;  2L2M A;  4BS9 A;  5FLX C;  2WZO A;  2HGH A;  1DQ3 A;  1X6H A;  3BID A;  1ZBQ A;  3MSW A;  4R2Q A;  1EKZ A;  4I8O A;  5A2Q C;  2RSI A;  4BMJ A;  4X66 E;  4WXC A;  1AH5 A;  1IQS A;  2EM2 A;  3F6H A;  2G7H A;  2LCE A;  2EOH A;  4BBY A;  1IMU A;  4Q35 B;  4KZS A;  1IBL E;  2EN2 A;  1LLM C;  1HR0 E;  4M9V C;  1WHQ A;  1BBO A;  4JI0 E;  3MHS C;  4LF8 E;  4DV4 E;  3K6Q A;  2EL6 A;  3BF2 A;  2DIX A;  1T39 A;  2GLI A;  2YRM A;  1GZ6 A;  1SFE A;  4DV2 E;  1A1K A;  2WBS A;  2N3G A;  1X6E A;  3AUZ A;  2ZM6 E;  1XMQ E;  3HTX A;  4ZYE A;  1DI2 A;  2EN4 A;  2EMW A;  2YTE A;  2FTX B;  4B3M E;  3ADG A;  4TUG A;  2EOI A;  2HJJ A;  1EH8 A;  2DMY A;  2DB2 A;  4LTY A;  2YRH A;  1NCS A;  4LF4 E;  2JYA A;  5LMU E;  4BC9 A;  2EE8 A;  2VE7 C;  1XNR E;  3KZY A;  2HC5 A;  4WPY A;  4KHP E;  4KWY A;  1PJS A;  4DV6 E;  4JI4 E;  2VRD A;  3BBG A;  2WBU A;  2J7J A;  2EPA A;  1L4S A;  1HNZ E;  3HQ1 A;  2LUQ A;  4LFB E;  3EPK A;  3HPZ A;  2LJH A;  1Z1B A;  3AV0 A;  2L33 A;  3DJW A;  4K0K E;  2KOU A;  2B7V A;  2ENC A;  2EM3 A;  3EPJ A;  1ZBT A;  2EMC A;  3P1X A;  3T1Y E;  2EMX A;  1KYQ A;  1JK1 A;  1MEY C;  1X49 A;  2RSM A;  4LF5 E;  4R2R A;  2VF1 A;  2JVA A;  3J7Y p;  4FK5 C;  2LBS B;  5LMN E;  4F9B B;  3KWR A;  2EQ1 A;  4WFT A;  4JI8 E;  5TSE A;  4DV3 E;  2LJU A;  1T38 A;  3THN A;  2FGG A;  4JI3 E;  2EZ6 A;  4B3R E;  1WJP A;  2YZT A;  3JTZ A;  1EH6 A;  2YSP A;  2EPP A;  2LV2 A;  2EN6 A;  3C6M A;  2YTN A;  5A6B D;  2VQF E;  5CFF E;  1X6F A;  2JOX A;  4WSG A;  2R1F A;  2EL5 A;  3KZZ A;  5A69 A;  2L2K B;  2JP9 A;  3THO B;  4R2P A;  2MC6 A;  2YTF A;  2EMF A;  4L5N C;  2EOO A; 
#chains in the Genus database with same CATH homology
 4P7D A;  2E1M A;  3H09 A;  4DV4 E;  4DV7 E;  2MDR A;  3K6Q A;  3HXL A;  2F8B A;  2DIX A;  4BC7 A;  3LLH A;  4X64 E;  4JI6 E;  5AE1 A;  5AAS A;  4DUZ E;  2LUP B;  2RTX A;  1GZ6 A;  4GKK E;  2M7Q A;  5ADZ A;  1T4N A;  1N32 E;  4DV2 E;  1O0W A;  2N3G A;  3AUZ A;  1XMQ E;  2MC5 A;  2LTS A;  2ZM6 E;  2VQE E;  2EWL A;  2HHH E;  3OML A;  3HTX A;  1J5E E;  1DI2 A;  2UUA E;  2FTX B;  2ODR C;  3ADG A;  3VK6 A;  1RC7 A;  2CPN A;  4B3S E;  4TUG A;  4B3M E;  3ADI A;  1SR9 A;  2JR1 A;  4DUY E;  2V88 A;  2DMY A;  1STU A;  2DB2 A;  2V87 A;  4LTY A;  1WXR A;  1I94 E;  4LU9 A;  1HNX E;  4DR7 E;  2KHX A;  5LL6 R;  4LF4 E;  1X48 A;  2K4V A;  4BC9 A;  5LMU E;  1YZ9 A;  4JYA E;  4WYQ B;  2NUG A;  5T6J A;  2VE7 C;  4R03 A;  1XNR E;  1GQE A;  3J80 C;  1T4L B;  4WPY A;  4KHP E;  2UXC E;  4X8W A;  4DV6 E;  4JI2 E;  4JI4 E;  4DR3 E;  3IWC A;  1HNZ E;  3HQ1 A;  1UIL A;  4GEQ B;  2JWO A;  2LUQ A;  4LFB E;  5AE2 A;  4R8O A;  4OX9 E;  4TUI A;  2L2N A;  2B9D A;  3HPZ A;  2B3T B;  2ODR D;  2V89 A;  4WSP A;  1N33 E;  3JAM C;  2LJH A;  5AE3 A;  1FJG E;  3AV0 A;  2H36 X;  2L33 A;  2L6M A;  2DSY A;  3DJW A;  4JI7 E;  4F9A B;  2F4V E;  4K0K E;  3C4T A;  2KOU A;  4P78 A;  4JV5 E;  1N34 E;  2B7V A;  2L8T A;  4J8Z A;  4AQY E;  4NXM E;  2RS6 A;  4F54 A;  3J81 C;  1UHZ A;  2M1S A;  4DR5 E;  3JU0 A;  4DR4 E;  3J7A G;  2E5L E;  1ZBT A;  4LFC E;  3F6G A;  3IWD A;  3P1X A;  3T1Y E;  2V85 A;  1J26 A;  2LRS A;  2UU9 E;  2LE2 A;  4L8N A;  5F3W A;  1X49 A;  2RSM A;  3ADJ A;  4LF5 E;  1YYW A;  2VF1 A;  2JVA A;  2JOB A;  3J7Y p;  3RMP A;  1WHN A;  3ADL A;  1T4O A;  1QU6 A;  4DR6 E;  3T1H E;  2LBS B;  1IBM E;  5DNY A;  3LML A;  3OTO E;  5LMN E;  1N36 E;  4LF7 E;  4NXN E;  1X47 A;  4F9B B;  4M0V A;  4DV1 E;  1YYO A;  4DR1 E;  3IWB A;  3KWR A;  3DF6 A;  4BCA A;  1PKP A;  4WFT A;  4M30 A;  2LMZ A;  4JI8 E;  2V8Q B;  4YY3 E;  5IWA E;  3FIG A;  4X65 E;  4YHH E;  2L3J A;  5IT9 C;  2LTR A;  2B7T A;  3HPS A;  4DV3 E;  4DR2 E;  1YYK A;  2UUC E;  3VYX A;  2UXD E;  4GKJ E;  2RS7 A;  2L92 A;  1IBK E;  4JI3 E;  2FGG A;  2V83 A;  1FKA E;  2L2M A;  2EZ6 A;  4BS9 A;  4B3R E;  2YZT A;  3C4B A;  2KON A;  3JTZ A;  2WZO A;  4F9C B;  5FLX C;  1DQ3 A;  2L3C A;  4JI5 E;  1XMO E;  4LF9 E;  3VYY A;  1ZBQ A;  3ZOQ B;  3MSW A;  1EKZ A;  4OOG C;  2UUB E;  4I8O A;  5BR8 E;  4BMJ A;  5A2Q C;  2VQF E;  1HNW E;  4X66 E;  5CFF E;  2N3H A;  2JOX A;  2IHR 1;  2NUF A;  4DMI A;  2NUE A;  2UXB E;  4B3T E;  2L2K B;  1XNQ E;  4Q28 A;  3F6H A;  2G7H A;  1RQ0 A;  2M4I A;  4BBY A;  4DKK A;  2NA2 A;  2FV4 B;  2YT4 A;  4KZS A;  4DV0 E;  1IBL E;  4LF6 E;  4LF8 E;  4LFA E;  2MC6 A;  1HR0 E;  1WHQ A;  4M2Z A;  4DV5 E;  2V86 A;  4JI0 E;  2JY9 A;  4L5N C;  4X62 E;  4JI1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...