2V85A

Crystal structure of rag2-phd finger in complex with h3r2me1k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
total genus 13
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v85A01
2V86A 2V83A 2V85A 2V89A 2V88A 2JWOA 2V87A
chains in the Genus database with same CATH superfamily
1T4OA 2ENHA 2YSPA 1PKPA 2EPLX 1A1IA 2EOXA 2JXPA 5DNYA 2LRSA 2YPNA 4R2DA 2ELYA 5KL2A 4NXNE 2MC5A 2M4IA 4RH8A 4HTGA 5LLQA 2VE7C 5ADZA 2K4VA 2EOOA 3IWBA 3EPHA 3MHSC 2N3GA 5AASA 2EPOA 2NUGA 2LJHA 2RTXA 4DUZE 5KL5A 4JI1E 1PDAA 2WBSA 4LF6E 4X62E 2EM9A 2MDGA 2GLIA 1QU6A 1A1HA 2ELZA 4R2QA 4ZYEA 2YWQA 1X6FA 2EPMX 4ZYDA 1LLMC 2CTDA 2UXCE 2CSHA 4MLVA 4WSGA 1DQ3A 1UN6B 3BIDA 1NCSA 2EMFA 3MHHC 5F3WA 3OTOE 2LUQA 4IS1C 3HTXA 2EMCA 2YU5A 2JOBA 4ZYGA 1WJPA 1ZBTA 1JK1A 1N32E 2FV4B 3ADLA 1O0WA 3H09A 2V89A 1IBME 4WXCA 2MKDA 2EMGA 4MLQA 4R8OA 3JTZA 5IT9C 1XMOE 3ECRA 3LMLA 2DMIA 1N3GA 2CT1A 1FJGE 3HPSA 2EL6A 2L3JA 3DF6A 1EH7A 1QNTA 2EOFA 4M0VA 5LL6R 1X47A 3ADGA 2DRPA 1ZR9A 3HPZA 3P1XA 2LE2A 2NA2A 2E1MA 4DV0E 2L2KB 4B3SE 1X48A 3AUZA 2JP9A 1A1FA 2DLKA 2YZTA 1T38A 2LBSB 2WZOA 2YRMA 2HC5A 2EM7A 2EQ0A 2E5LE 4LF4E 4DR7E 2V85A 2YT4A 4P7DA 1YYWA 4BS9A 1IMUA 5BR8E 2WBUA 2LO3A 4KHPE 2L8TA 1G2FC 2EPKX 1FKAE 4DUYE 2NUFA 4F9CB 1SR9A 1XNQE 4K0KE 2EL4A 3THOB 4J8ZA 2L6MA 3AV0A 1KJKA 1YPNA 1UBDC 4B3TE 1GQEA 2EJ4A 1RMDA 3VYYA 3J80C 2JYAA 2EM3A 2YRKA 2ZM6E 5KL4A 2RS6A 1WHNA 2R1FA 4WSPA 4BHCA 3JAMC 4AQYE 1A1KA 2YU8A 1NEIA 4F6NA 1WXRA 5AE1A 2KHXA 2L3CA 1HNZE 3J7AG 2N3HA 2FTXB 3FIGA 2UUBE 4L8NA 2EM2A 1ZU1A 2EQ1A 1IQOA 2M7QA 1P47A 4R2EA 4JI8E 4Q35B 3C4TA 4BMJA 5AC4A 4M30A 5AE3A 2LMZA 1IQSA 2V87A 5FLXC 1X3CA 2FGGA 2GHFA 4R03A 3C6KA 2RSIA 4F9AB 2NABA 1JK2A 2DGCA 2EN1A 4YHHE 1TF6A 3J7Yp 4LFBE 2MC6A 2EMYA 1EH8A 2EN4A 5A6KA 4DV3E 5CFFE 2EMXA 3KWRA 2EOQA 4WPYA 4JI3E 2CPNA 2BB8A 2EPAA 1PJQA 4R2PA 3ADIA 4DV5E 1F2IG 2JR1A 1STUA 2EM4A 1AAYA 2B7VA 2DSYA 4JI5E 2I9IA 4LFCE 4R2SA 2EN2A 2EN7A 1MGTA 2DLQA 2JY9A 2UUCE 2ADRA 2RSMA 3C4BA 1N33E 2LJUA 3QG5C 2EOIA 2B3TB 2VQFE 2RQLA 1YUJA 2YRHA 1T4LB 3EPLA 1GTKA 2EOYA 2EPCA 2VQEE 2YTOA 1G2DC 1IBLE 4DR6E 2EM0A 4OX9E 1PJTA 2UU9E 2R76A 3RMPA 3F6GA 3ZOQB 1YYKA 1DI2A 2EP3A 5IXMB 1TN9A 1BBGA 3M99B 2ENAA 2L33A 2EMLA 1HR0E 4O24A 3KZZA 2Q8UA 4DV1E 1T4NA 4LFAE 3HQ1A 2V83A 2EM5A 4HEIA 5A2QC 4BCAA 4BHBA 2WBTA 2EM8A 2LV2A 4JI6E 4Q28A 2VF1A 1YZ9A 4X9JA 1UHZA 1HNWE 2EMIA 2YTGA 4LTYA 5AC5A 2JOXA 1HNXE 2EMWA 1TF3A 2JVAA 4DMIA 4I8OA 4JYAE 2KONA 2YTIA 3F6HA 4JI2E 2J7JA 2EMKA 1KYQA 4IJDA 4KZSA 2EPNA 2PRTA 3K6QA 5IV8B 2YSOA 4X8WA 2ODRD 2K7IA 2EPZA 2N8XA 1A1JA 4FK5C 2EQ3A 2L92A 4OOGC 4M2ZA 2EN8A 5KL3A 1T39A 3IWCA 2L2MA 2EPPA 1WRJA 2EPUA 1X5WA 4DV4E 3TQMA 3T1HE 2B7TA 2D9HA 3BF2A 4B3RE 5A6BA 1WHQA 2VRDA 3EQ1A 2ODRC 2V88A 4DR2E 4R2AA 2L2NA 5A6BD 4X64E 4GZNC 2RPCA 2LCEA 1J26A 2BBGA 3C6MA 1RQ0A 1EKZA 1BB8A 2ENCA 4DR1E 2EN6A 2YTNA 2M9AA 2DB2A 2JPAA 1AH5A 3BBGA 2V86A 1B69A 3T1YE 4TUIA 2UUAE 4TUGA 2IHR1 4WX9A 4LF7E 4DR4E 2LTSA 2YTEA 4B3ME 3L00A 2YTDA 2MKNA 2LTRA 1RC7A 2EMBA 1UILA 1PJSA 2YTQA 4GKKE 4GKJE 3THNA 2WCC3 4DR5E 2DMYA 2LVHA 2F4VE 3VHTB 4O5GA 5A69A 1A1GA 1YUIA 2EMZA 1X6HA 2EOEA 3MSWA 5IWAE 3EPKA 2H36X 3ADJA 2YTPA 4DV7E 4KWYA 2JWOA 2E72A 4N4RB 1XMQE 2EMAA 5KL6A 5A6AA 3VYXA 5A6JA 2EZ6A 2EWLA 1L4SA 2EL5A 1N34E 3LLHA 4YY3E 4LF8E 4JV5E 5LMNE 2M1SA 2V8QB 2EM6A 2EOHA 2KOUA 4X66E 4DR3E 1SFEA 2LUPB 2A25A 1ZAAC 3UK3C 3KZYA 4DV2E 3DJWA 4LF5E 4LF9E 4NXME 2HJJA 2HHHE 5LMUE 4F54A 4WXDA 4LU9A 4M9VC 4F9BB 2F8BA 4F6MA 2HGHA 4DKKA 3VK6A 3BGHA 2MDRA 3J81C 5T6JA 1YFHA 1GZ6A 2EPRA 2RS7A 3HXLA 4R2RA 4BBYA 2NUEA 1XNRE 4R2CA 1A1LA 2GPIA 1IBKE 4BC7A 1YSAC 4JI0E 4JI7E 1DGCA 4NZVA 1YYOA 2LT7A 2EE8A 3JU0A 4L5NC 2EPXA 2EOMA 2YTJA 1EH6A 2UXDE 4JI4E 4O4KA 3OMLA 5TSEA 4ZYHA 4O43A 5AE2A 2EMHA 3EPJA 4RHBB 1J5EE 4DV6E 4NHRA 2EN3A 1BBOA 2B9DA 4P78A 3IWDA 2EOJA 4GEQB 2DIXA 4WYQB 2I13A 2EORA 1X49A 1MEYC 1X6EA 1ZBQA 4WFTA 1Z1BA 1I94E 4X65E 2YTFA 2G7HA 4BC9A 2EOSA 2UXBE 1N36E 4F2JC 5KL7A 2EOZA
chains in the Genus database with same CATH topology
2LTSA 4KHPE 3RMPA 4B3ME 2L8TA 1T4OA 1FKAE 2LTRA 1RC7A 3F6GA 4DUYE 2NUFA 1UILA 1SR9A 3ZOQB 4F9CB 1XNQE 1YYKA 4K0KE 1DI2A 1PKPA 4GKKE 4GKJE 4J8ZA 2L6MA 3AV0A 5DNYA 4DR5E 2LRSA 2L33A 2DMYA 2F4VE 4NXNE 1HR0E 4B3TE 1GQEA 2MC5A 3MSWA 5IWAE 3J80C 3VYYA 2M4IA 4DV1E 1T4NA 2H36X 3HQ1A 1N36E 2ZM6E 4LFAE 2V83A 2VE7C 3ADJA 2RS6A 5A2QC 4BCAA 1WHNA 4WSPA 3JAMC 5ADZA 2K4VA 4DV7E 4AQYE 2JWOA 3IWBA 4JI6E 4Q28A 5AASA 2N3GA 2VF1A 1WXRA 2NUGA 5AE1A 2KHXA 1XMQE 2L3CA 1HNZE 1YZ9A 3J7AG 3VYXA 2N3HA 2FTXB 2LJHA 2RTXA 3FIGA 4DUZE 2UUBE 4L8NA 2EZ6A 1UHZA 2EWLA 4JI1E 2M7QA 4LF6E 4X62E 4JI8E 1QU6A 3LLHA 4YY3E 1N34E 4LF8E 3C4TA 4BMJA 5LMNE 4JV5E 2M1SA 4M30A 5AE3A 4LTYA 2LMZA 2V8QB 2V87A 5FLXC 2JOXA 4X66E 2FGGA 2KOUA 4DR3E 1HNXE 2LUPB 2JVAA 4DMIA 4R03A 4I8OA 4F9AB 4JYAE 2KONA 3F6HA 4JI2E 2UXCE 4DV2E 3DJWA 4YHHE 4LF5E 3J7Yp 4LF9E 4LFBE 4NXME 2MC6A 4KZSA 1DQ3A 2HHHE 5LMUE 4F54A 5F3WA 4DV3E 5CFFE 4LU9A 3KWRA 3OTOE 2LUQA 2F8BA 4F9BB 3K6QA 3HTXA 4WPYA 4X8WA 4DKKA 3VK6A 2MDRA 2JOBA 2ODRD 5T6JA 1GZ6A 3J81C 4JI3E 2RS7A 2CPNA 3HXLA 4BBYA 2L92A 4OOGC 4M2ZA 1XNRE 2NUEA 3ADIA 1ZBTA 4DV5E 3IWCA 1N32E 2FV4B 3ADLA 1IBKE 4BC7A 2JR1A 1O0WA 2L2MA 1STUA 2V89A 3H09A 2B7VA 2DSYA 1IBME 4JI0E 4JI7E 4JI5E 4R8OA 4LFCE 3JTZA 5IT9C 4DV4E 1YYOA 3JU0A 3T1HE 1XMOE 2B7TA 4L5NC 4B3RE 3LMLA 1WHQA 1FJGE 2UXDE 3HPSA 4JI4E 2JY9A 2ODRC 2UUCE 2L3JA 2V88A 3DF6A 2RSMA 3C4BA 4DR2E 3OMLA 1HNWE 1N33E 5AE2A 4M0VA 5LL6R 1J5EE 1X47A 2L2NA 3ADGA 4DV6E 2B3TB 3HPZA 4X64E 3P1XA 2LE2A 2NA2A 2B9DA 2VQFE 2E1MA 4DV0E 2L2KB 4P78A 4B3SE 1X48A 1J26A 3IWDA 3AUZA 2DIXA 4GEQB 4WYQB 1T4LB 2YZTA 1X49A 1RQ0A 1ZBQA 4WFTA 2LBSB 2WZOA 1I94E 1EKZA 4DR1E 2DB2A 2VQEE 2E5LE 4X65E 2V86A 1IBLE 2G7HA 4LF4E 4OX9E 4DR6E 4DR7E 2V85A 4BC9A 2UU9E 2YT4A 4P7DA 4TUIA 3T1YE 1YYWA 4BS9A 2UUAE 2UXBE 5BR8E 4TUGA 2IHR1 4LF7E 4DR4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V86 A;  2V83 A;  2V85 A;  2V89 A;  2V88 A;  2JWO A;  2V87 A; 
#chains in the Genus database with same CATH topology
 1T4O A;  2ENH A;  2YSP A;  1PKP A;  2EPL X;  1A1I A;  2EOX A;  2JXP A;  5DNY A;  2LRS A;  2YPN A;  4R2D A;  2ELY A;  5KL2 A;  4NXN E;  2MC5 A;  2M4I A;  4RH8 A;  4HTG A;  5LLQ A;  2VE7 C;  5ADZ A;  2K4V A;  2EOO A;  3IWB A;  3EPH A;  3MHS C;  2N3G A;  5AAS A;  2EPO A;  2NUG A;  2LJH A;  2RTX A;  4DUZ E;  5KL5 A;  4JI1 E;  1PDA A;  2WBS A;  4LF6 E;  4X62 E;  2EM9 A;  2MDG A;  2GLI A;  1QU6 A;  1A1H A;  2ELZ A;  4R2Q A;  4ZYE A;  2YWQ A;  1X6F A;  2EPM X;  4ZYD A;  1LLM C;  2CTD A;  2UXC E;  2CSH A;  4MLV A;  4WSG A;  1DQ3 A;  1UN6 B;  3BID A;  1NCS A;  2EMF A;  3MHH C;  5F3W A;  3OTO E;  2LUQ A;  4IS1 C;  3HTX A;  2EMC A;  2YU5 A;  2JOB A;  4ZYG A;  1WJP A;  1ZBT A;  1JK1 A;  1N32 E;  2FV4 B;  3ADL A;  1O0W A;  3H09 A;  2V89 A;  1IBM E;  4WXC A;  2MKD A;  2EMG A;  4MLQ A;  4R8O A;  3JTZ A;  5IT9 C;  1XMO E;  3ECR A;  3LML A;  2DMI A;  1N3G A;  2CT1 A;  1FJG E;  3HPS A;  2EL6 A;  2L3J A;  3DF6 A;  1EH7 A;  1QNT A;  2EOF A;  4M0V A;  5LL6 R;  1X47 A;  3ADG A;  2DRP A;  1ZR9 A;  3HPZ A;  3P1X A;  2LE2 A;  2NA2 A;  2E1M A;  4DV0 E;  2L2K B;  4B3S E;  1X48 A;  3AUZ A;  2JP9 A;  1A1F A;  2DLK A;  2YZT A;  1T38 A;  2LBS B;  2WZO A;  2YRM A;  2HC5 A;  2EM7 A;  2EQ0 A;  2E5L E;  4LF4 E;  4DR7 E;  2V85 A;  2YT4 A;  4P7D A;  1YYW A;  4BS9 A;  1IMU A;  5BR8 E;  2WBU A;  2LO3 A;  4KHP E;  2L8T A;  1G2F C;  2EPK X;  1FKA E;  4DUY E;  2NUF A;  4F9C B;  1SR9 A;  1XNQ E;  4K0K E;  2EL4 A;  3THO B;  4J8Z A;  2L6M A;  3AV0 A;  1KJK A;  1YPN A;  1UBD C;  4B3T E;  1GQE A;  2EJ4 A;  1RMD A;  3VYY A;  3J80 C;  2JYA A;  2EM3 A;  2YRK A;  2ZM6 E;  5KL4 A;  2RS6 A;  1WHN A;  2R1F A;  4WSP A;  4BHC A;  3JAM C;  4AQY E;  1A1K A;  2YU8 A;  1NEI A;  4F6N A;  1WXR A;  5AE1 A;  2KHX A;  2L3C A;  1HNZ E;  3J7A G;  2N3H A;  2FTX B;  3FIG A;  2UUB E;  4L8N A;  2EM2 A;  1ZU1 A;  2EQ1 A;  1IQO A;  2M7Q A;  1P47 A;  4R2E A;  4JI8 E;  4Q35 B;  3C4T A;  4BMJ A;  5AC4 A;  4M30 A;  5AE3 A;  2LMZ A;  1IQS A;  2V87 A;  5FLX C;  1X3C A;  2FGG A;  2GHF A;  4R03 A;  3C6K A;  2RSI A;  4F9A B;  2NAB A;  1JK2 A;  2DGC A;  2EN1 A;  4YHH E;  1TF6 A;  3J7Y p;  4LFB E;  2MC6 A;  2EMY A;  1EH8 A;  2EN4 A;  5A6K A;  4DV3 E;  5CFF E;  2EMX A;  3KWR A;  2EOQ A;  4WPY A;  4JI3 E;  2CPN A;  2BB8 A;  2EPA A;  1PJQ A;  4R2P A;  3ADI A;  4DV5 E;  1F2I G;  2JR1 A;  1STU A;  2EM4 A;  1AAY A;  2B7V A;  2DSY A;  4JI5 E;  2I9I A;  4LFC E;  4R2S A;  2EN2 A;  2EN7 A;  1MGT A;  2DLQ A;  2JY9 A;  2UUC E;  2ADR A;  2RSM A;  3C4B A;  1N33 E;  2LJU A;  3QG5 C;  2EOI A;  2B3T B;  2VQF E;  2RQL A;  1YUJ A;  2YRH A;  1T4L B;  3EPL A;  1GTK A;  2EOY A;  2EPC A;  2VQE E;  2YTO A;  1G2D C;  1IBL E;  4DR6 E;  2EM0 A;  4OX9 E;  1PJT A;  2UU9 E;  2R76 A;  3RMP A;  3F6G A;  3ZOQ B;  1YYK A;  1DI2 A;  2EP3 A;  5IXM B;  1TN9 A;  1BBG A;  3M99 B;  2ENA A;  2L33 A;  2EML A;  1HR0 E;  4O24 A;  3KZZ A;  2Q8U A;  4DV1 E;  1T4N A;  4LFA E;  3HQ1 A;  2V83 A;  2EM5 A;  4HEI A;  5A2Q C;  4BCA A;  4BHB A;  2WBT A;  2EM8 A;  2LV2 A;  4JI6 E;  4Q28 A;  2VF1 A;  1YZ9 A;  4X9J A;  1UHZ A;  1HNW E;  2EMI A;  2YTG A;  4LTY A;  5AC5 A;  2JOX A;  1HNX E;  2EMW A;  1TF3 A;  2JVA A;  4DMI A;  4I8O A;  4JYA E;  2KON A;  2YTI A;  3F6H A;  4JI2 E;  2J7J A;  2EMK A;  1KYQ A;  4IJD A;  4KZS A;  2EPN A;  2PRT A;  3K6Q A;  5IV8 B;  2YSO A;  4X8W A;  2ODR D;  2K7I A;  2EPZ A;  2N8X A;  1A1J A;  4FK5 C;  2EQ3 A;  2L92 A;  4OOG C;  4M2Z A;  2EN8 A;  5KL3 A;  1T39 A;  3IWC A;  2L2M A;  2EPP A;  1WRJ A;  2EPU A;  1X5W A;  4DV4 E;  3TQM A;  3T1H E;  2B7T A;  2D9H A;  3BF2 A;  4B3R E;  5A6B A;  1WHQ A;  2VRD A;  3EQ1 A;  2ODR C;  2V88 A;  4DR2 E;  4R2A A;  2L2N A;  5A6B D;  4X64 E;  4GZN C;  2RPC A;  2LCE A;  1J26 A;  2BBG A;  3C6M A;  1RQ0 A;  1EKZ A;  1BB8 A;  2ENC A;  4DR1 E;  2EN6 A;  2YTN A;  2M9A A;  2DB2 A;  2JPA A;  1AH5 A;  3BBG A;  2V86 A;  1B69 A;  3T1Y E;  4TUI A;  2UUA E;  4TUG A;  2IHR 1;  4WX9 A;  4LF7 E;  4DR4 E;  2LTS A;  2YTE A;  4B3M E;  3L00 A;  2YTD A;  2MKN A;  2LTR A;  1RC7 A;  2EMB A;  1UIL A;  1PJS A;  2YTQ A;  4GKK E;  4GKJ E;  3THN A;  2WCC 3;  4DR5 E;  2DMY A;  2LVH A;  2F4V E;  3VHT B;  4O5G A;  5A69 A;  1A1G A;  1YUI A;  2EMZ A;  1X6H A;  2EOE A;  3MSW A;  5IWA E;  3EPK A;  2H36 X;  3ADJ A;  2YTP A;  4DV7 E;  4KWY A;  2JWO A;  2E72 A;  4N4R B;  1XMQ E;  2EMA A;  5KL6 A;  5A6A A;  3VYX A;  5A6J A;  2EZ6 A;  2EWL A;  1L4S A;  2EL5 A;  1N34 E;  3LLH A;  4YY3 E;  4LF8 E;  4JV5 E;  5LMN E;  2M1S A;  2V8Q B;  2EM6 A;  2EOH A;  2KOU A;  4X66 E;  4DR3 E;  1SFE A;  2LUP B;  2A25 A;  1ZAA C;  3UK3 C;  3KZY A;  4DV2 E;  3DJW A;  4LF5 E;  4LF9 E;  4NXM E;  2HJJ A;  2HHH E;  5LMU E;  4F54 A;  4WXD A;  4LU9 A;  4M9V C;  4F9B B;  2F8B A;  4F6M A;  2HGH A;  4DKK A;  3VK6 A;  3BGH A;  2MDR A;  3J81 C;  5T6J A;  1YFH A;  1GZ6 A;  2EPR A;  2RS7 A;  3HXL A;  4R2R A;  4BBY A;  2NUE A;  1XNR E;  4R2C A;  1A1L A;  2GPI A;  1IBK E;  4BC7 A;  1YSA C;  4JI0 E;  4JI7 E;  1DGC A;  4NZV A;  1YYO A;  2LT7 A;  2EE8 A;  3JU0 A;  4L5N C;  2EPX A;  2EOM A;  2YTJ A;  1EH6 A;  2UXD E;  4JI4 E;  4O4K A;  3OML A;  5TSE A;  4ZYH A;  4O43 A;  5AE2 A;  2EMH A;  3EPJ A;  4RHB B;  1J5E E;  4DV6 E;  4NHR A;  2EN3 A;  1BBO A;  2B9D A;  4P78 A;  3IWD A;  2EOJ A;  4GEQ B;  2DIX A;  4WYQ B;  2I13 A;  2EOR A;  1X49 A;  1MEY C;  1X6E A;  1ZBQ A;  4WFT A;  1Z1B A;  1I94 E;  4X65 E;  2YTF A;  2G7H A;  4BC9 A;  2EOS A;  2UXB E;  1N36 E;  4F2J C;  5KL7 A;  2EOZ A; 
#chains in the Genus database with same CATH homology
 2LTS A;  4KHP E;  3RMP A;  4B3M E;  2L8T A;  1T4O A;  1FKA E;  2LTR A;  1RC7 A;  3F6G A;  4DUY E;  2NUF A;  1UIL A;  1SR9 A;  3ZOQ B;  4F9C B;  1XNQ E;  1YYK A;  4K0K E;  1DI2 A;  1PKP A;  4GKK E;  4GKJ E;  4J8Z A;  2L6M A;  3AV0 A;  5DNY A;  4DR5 E;  2LRS A;  2L33 A;  2DMY A;  2F4V E;  4NXN E;  1HR0 E;  4B3T E;  1GQE A;  2MC5 A;  3MSW A;  5IWA E;  3J80 C;  3VYY A;  2M4I A;  4DV1 E;  1T4N A;  2H36 X;  3HQ1 A;  1N36 E;  2ZM6 E;  4LFA E;  2V83 A;  2VE7 C;  3ADJ A;  2RS6 A;  5A2Q C;  4BCA A;  1WHN A;  4WSP A;  3JAM C;  5ADZ A;  2K4V A;  4DV7 E;  4AQY E;  2JWO A;  3IWB A;  4JI6 E;  4Q28 A;  5AAS A;  2N3G A;  2VF1 A;  1WXR A;  2NUG A;  5AE1 A;  2KHX A;  1XMQ E;  2L3C A;  1HNZ E;  1YZ9 A;  3J7A G;  3VYX A;  2N3H A;  2FTX B;  2LJH A;  2RTX A;  3FIG A;  4DUZ E;  2UUB E;  4L8N A;  2EZ6 A;  1UHZ A;  2EWL A;  4JI1 E;  2M7Q A;  4LF6 E;  4X62 E;  4JI8 E;  1QU6 A;  3LLH A;  4YY3 E;  1N34 E;  4LF8 E;  3C4T A;  4BMJ A;  5LMN E;  4JV5 E;  2M1S A;  4M30 A;  5AE3 A;  4LTY A;  2LMZ A;  2V8Q B;  2V87 A;  5FLX C;  2JOX A;  4X66 E;  2FGG A;  2KOU A;  4DR3 E;  1HNX E;  2LUP B;  2JVA A;  4DMI A;  4R03 A;  4I8O A;  4F9A B;  4JYA E;  2KON A;  3F6H A;  4JI2 E;  2UXC E;  4DV2 E;  3DJW A;  4YHH E;  4LF5 E;  3J7Y p;  4LF9 E;  4LFB E;  4NXM E;  2MC6 A;  4KZS A;  1DQ3 A;  2HHH E;  5LMU E;  4F54 A;  5F3W A;  4DV3 E;  5CFF E;  4LU9 A;  3KWR A;  3OTO E;  2LUQ A;  2F8B A;  4F9B B;  3K6Q A;  3HTX A;  4WPY A;  4X8W A;  4DKK A;  3VK6 A;  2MDR A;  2JOB A;  2ODR D;  5T6J A;  1GZ6 A;  3J81 C;  4JI3 E;  2RS7 A;  2CPN A;  3HXL A;  4BBY A;  2L92 A;  4OOG C;  4M2Z A;  1XNR E;  2NUE A;  3ADI A;  1ZBT A;  4DV5 E;  3IWC A;  1N32 E;  2FV4 B;  3ADL A;  1IBK E;  4BC7 A;  2JR1 A;  1O0W A;  2L2M A;  1STU A;  2V89 A;  3H09 A;  2B7V A;  2DSY A;  1IBM E;  4JI0 E;  4JI7 E;  4JI5 E;  4R8O A;  4LFC E;  3JTZ A;  5IT9 C;  4DV4 E;  1YYO A;  3JU0 A;  3T1H E;  1XMO E;  2B7T A;  4L5N C;  4B3R E;  3LML A;  1WHQ A;  1FJG E;  2UXD E;  3HPS A;  4JI4 E;  2JY9 A;  2ODR C;  2UUC E;  2L3J A;  2V88 A;  3DF6 A;  2RSM A;  3C4B A;  4DR2 E;  3OML A;  1HNW E;  1N33 E;  5AE2 A;  4M0V A;  5LL6 R;  1J5E E;  1X47 A;  2L2N A;  3ADG A;  4DV6 E;  2B3T B;  3HPZ A;  4X64 E;  3P1X A;  2LE2 A;  2NA2 A;  2B9D A;  2VQF E;  2E1M A;  4DV0 E;  2L2K B;  4P78 A;  4B3S E;  1X48 A;  1J26 A;  3IWD A;  3AUZ A;  2DIX A;  4GEQ B;  4WYQ B;  1T4L B;  2YZT A;  1X49 A;  1RQ0 A;  1ZBQ A;  4WFT A;  2LBS B;  2WZO A;  1I94 E;  1EKZ A;  4DR1 E;  2DB2 A;  2VQE E;  2E5L E;  4X65 E;  2V86 A;  1IBL E;  2G7H A;  4LF4 E;  4OX9 E;  4DR6 E;  4DR7 E;  2V85 A;  4BC9 A;  2UU9 E;  2YT4 A;  4P7D A;  4TUI A;  3T1Y E;  1YYW A;  4BS9 A;  2UUA E;  2UXB E;  5BR8 E;  4TUG A;  2IHR 1;  4LF7 E;  4DR4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...