3LLHA

Crystal structure of the first dsrbd of tar rna-binding protein 2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
64
Chain Sequence
GKTPISLLQEYGTRIGKTPVYDLLKAEPNFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RISC-loading complex subunit TARBP2
publication title The structures of dsRBDs of human TRBP
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 15
structure length 64
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3llhA00
2UU9E 4DKKA 1PKPA 4LFBE 5IWAE 4DV5E 4OX9E 1RC7A 4JI3E 4JI7E 3VYYA 4DUZE 2KHXA 4B3TE 4LF6E 1T4OA 1ZBTA 1N32E 3HTXA 2B3TB 2L3CA 3T1YE 2UUCE 2DIXA 1DI2A 1IBKE 1HNXE 2L2NA 2CPNA 2UUBE 2RSMA 2DMYA 4X66E 1IBLE 2DB2A 4B3SE 4JI5E 1STUA 1XMOE 3ADIA 4LFCE 4DV1E 4LF4E 2LJHA 3LLHA 1QU6A 4LF7E 4JI6E 2UXBE 2UUAE 4WYQB 1WHNA 1GQEA 2ZM6E 1YYKA 4YY3E 2L3JA 1XMQE 2LRSA 2L2MA 1YZ9A 4DR5E 3T1HE 4OOGC 4DR4E 2YT4A 1WHQA 2JY9A 1IBME 4LF5E 4B3RE 5LMNE 4M30A 1J26A 1UHZA 4DV6E 1J5EE 1N34E 4DR1E 2IHR1 1FJGE 1XNQE 5LMUE 4NXME 2F4VE 3C4TA 3OTOE 4GKKE 2L2KB 1I94E 1HR0E 2HHHE 3C4BA 4JI0E 1T4NA 1N36E 2N3HA 2NA2A 4DV0E 2UXDE 1HNZE 4DR7E 4B3ME 2L33A 5BR8E 3VYXA 1N33E 2RS6A 1YYOA 2EZ6A 4WFTA 4JYAE 4DV3E 2UXCE 1O0WA 2RTXA 2LUPB 1EKZA 1UILA 1XNRE 4DR6E 4LF8E 1X49A 2N3GA 4GKJE 4JV5E 4KHPE 4AQYE 2B7VA 3J7Yp 4LF9E 4X64E 2NUGA 1YYWA 4DV7E 4JI2E 1T4LB 4JI8E 4X8WA 2LTRA 4DR2E 2RS7A 4DV4E 4JI4E 4NXNE 4DUYE 2MDRA 4JI1E 2LTSA 1RQ0A 2VQFE 4DV2E 2NUFA 4X62E 4K0KE 5CFFE 1HNWE 4M2ZA 2JVAA 1X48A 1X47A 4YHHE 3ADLA 1FKAE 3P1XA 2VQEE 2B7TA 4X65E 4LFAE 2LBSB 2E5LE 3ADJA 2NUEA 3ADGA 4DR3E 2LUQA
chains in the Genus database with same CATH superfamily
2EQ0A 1BBGA 4LFBE 2LE2A 1N3GA 4DV5E 1RC7A 5LLQA 2E72A 2V86A 1X6FA 4IS1C 3VYYA 4LF6E 5A6KA 1T4OA 2EN7A 2G7HA 1EH7A 2V88A 4BHCA 3MHSC 2EPKX 2ELYA 1HNXE 2EMFA 2L2NA 2YZTA 4Q28A 2Q8UA 2JPAA 4B3SE 4JI5E 3QG5C 4R2CA 1XMOE 4F9AB 4GZNC 5TSEA 3EPKA 2EMBA 5A6AA 3THOB 3HXLA 2EM5A 1DGCA 3LLHA 1QU6A 2WZOA 2EM4A 1WHNA 5KL5A 3HQ1A 4N4RB 1YZ9A 3T1HE 4DR4E 1IBME 2JR1A 2JOBA 2LVHA 4M9VC 4M30A 2E1MA 3KZYA 4DV6E 2JYAA 1NEIA 2EMHA 2ENAA 4R2PA 2EPZA 2EOXA 3F6GA 4BS9A 1WXRA 4DR1E 2L2KB 2HHHE 4HTGA 5KL4A 4JI0E 2YTQA 2MC5A 1JK1A 2UXDE 2JOXA 4DR7E 2YSOA 1Z1BA 4O5GA 4B3ME 2L33A 5LL6R 2VRDA 2YTFA 4F9CB 2EPAA 2FV4B 4DV3E 2EOQA 4R2AA 1TF3A 2EPCA 1UILA 2EPUA 4DR6E 2LJUA 4F54A 2LO3A 1X6EA 2EN3A 1EH6A 2B7VA 2EQ3A 2EPPA 2EPOA 4LF9E 5AE3A 1BBOA 2V83A 4JI2E 2EOZA 2RS7A 4JI4E 2A25A 4L8NA 4DUYE 2MDRA 1X3CA 3FIGA 5CFFE 1HNWE 4KWYA 2JVAA 1X48A 1PJSA 5IT9C 4R2RA 2EM2A 2EN1A 1FKAE 4TUGA 1JK2A 4X65E 1YFHA 2L6MA 2E5LE 4ZYHA 2EMKA 1YUIA 2MKNA 2LUQA 4OX9E 5T6JA 2EL5A 4HEIA 4JI7E 4DUZE 2EMGA 4WPYA 2N8XA 2EOOA 1N32E 2YTPA 2YTNA 4J8ZA 2DIXA 2NABA 1IBKE 3OMLA 2WBTA 2R1FA 4L5NC 2RQLA 4M0VA 2CPNA 4WSPA 2DMYA 3C6MA 1DQ3A 1A1HA 1QNTA 2EMAA 2FGGA 1ZBQA 2EOFA 4DV1E 4R2DA 5AASA 4LF4E 3J7AG 5IXMB 5F3WA 2EPLX 2UUAE 2YTIA 5A2QC 1G2DC 2L92A 2JP9A 1YYKA 4YY3E 2YRHA 3C6KA 2LRSA 2L2MA 1PJTA 2M7QA 5A6JA 4B3RE 2ADRA 1J26A 1UHZA 4WXCA 2EOJA 4Q35B 1XNQE 2EOIA 2YTJA 2ENCA 4TUIA 2EPMX 3IWCA 1I94E 2EM3A 4O24A 1KJKA 1F2IG 2N3HA 3L00A 2EORA 2RPCA 2EM8A 3DF6A 4FK5C 3BGHA 3VYXA 1N33E 2YTDA 4JYAE 1IQSA 2ELZA 5IV8B 2UXCE 2WCC3 2RTXA 1A1FA 2EPXA 3JTZA 4LF8E 1XNRE 2DRPA 1X49A 1IQOA 2N3GA 4JV5E 2EL4A 4DV7E 1L4SA 3K6QA 4X8WA 4DR2E 2EMYA 3TQMA 4JI1E 1RQ0A 4R8OA 4MLQA 4X62E 5KL3A 2I13A 4BC9A 1TN9A 2B7TA 4LFAE 3RMPA 2LBSB 2VE7C 2NUEA 3ADGA 4R2SA 2MDGA 4DKKA 3BIDA 4F6NA 4WX9A 3AUZA 3THNA 2EOMA 2EP3A 2EN2A 2HGHA 3BBGA 2RSIA 2YU8A 1WJPA 2EMCA 2YPNA 2EMLA 2EQ1A 5AE1A 2B3TB 5A69A 2LV2A 1MEYC 2CTDA 2YTEA 2UUCE 3T1YE 1DI2A 2K7IA 1WRJA 1MGTA 3JAMC 2EOHA 4LTYA 3IWBA 2RSMA 3ZOQB 4BBYA 2EOEA 3LMLA 3ADIA 2EMWA 2R76A 2EOSA 2WBUA 2EOYA 2GHFA 1KYQA 2LJHA 3MSWA 3J80C 4LF7E 4JI6E 4ZYGA 2UXBE 2EM0A 1GQEA 5A6BD 1B69A 1AAYA 3HPZA 1PJQA 4R2QA 1TF6A 2YSPA 1ZAAC 2YT4A 2JY9A 1X5WA 2JWOA 4BMJA 2PRTA 2BBGA 1N34E 5A6BA 2EN8A 2IHR1 1A1JA 1FJGE 4WXDA 5LMUE 1ZU1A 4NXME 2F4VE 1X6HA 3C4TA 2DLKA 2LCEA 3C4BA 2V89A 1T4NA 2DMIA 3AV0A 4DV0E 1HNZE 1NCSA 2YTGA 3M99B 2EMZA 1P47A 2BB8A 4RH8A 2RS6A 3BF2A 1YYOA 2EZ6A 4NZVA 2MKDA 2YWQA 5KL6A 3VHTB 2GPIA 2V8QB 4GKJE 2HJJA 4KHPE 4AQYE 5AC4A 2LMZA 2NUGA 4F6MA 1YYWA 3EQ1A 2DGCA 2YTOA 3MHHC 2LTRA 4DV4E 4NXNE 2V87A 2VQFE 4DV2E 2KONA 4K0KE 5KL7A 2M9AA 4M2ZA 1X47A 2DSYA 5FLXC 4YHHE 4IJDA 3ADLA 5KL2A 3P1XA 4MLVA 2VQEE 2M1SA 2YRKA 1ZR9A 2D9HA 3KZZA 4DR3E 2EE8A 2YU5A 4WSGA 4RHBB 2UU9E 2HC5A 1PKPA 5AE2A 5IWAE 2CT1A 4DMIA 4ZYEA 4JI3E 5DNYA 4B3TE 2KHXA 3UK3C 1GZ6A 1ZBTA 1A1KA 3HTXA 4NHRA 1A1IA 2EJ4A 2L8TA 2L3CA 4X9JA 2EPNA 4BC7A 3KWRA 2UUBE 4P7DA 2I9IA 1A1LA 4X66E 1IBLE 2DB2A 1STUA 4LFCE 2DLQA 4LU9A 2EPRA 1YUJA 1YPNA 1PDAA 4R03A 4ZYDA 4O43A 2EM6A 4O4KA 2H36X 4WYQB 1G2FC 3EPLA 1T39A 2ZM6E 2L3JA 1XMQE 4I8OA 4DR5E 4OOGC 1WHQA 4LF5E 2EN4A 5LMNE 2YRMA 1J5EE 2GLIA 2LT7A 1A1GA 3IWDA 3OTOE 4GKKE 1HR0E 5ADZA 1AH5A 4F2JC 3DJWA 3JU0A 1N36E 2NA2A 1EH8A 3EPJA 2CSHA 1GTKA 3F6HA 2EM7A 5BR8E 2ODRC 1BB8A 4WFTA 1UBDC 2K4VA 3HPSA 1O0WA 3EPHA 2LUPB 1EKZA 1RMDA 4P78A 2EM9A 2EMXA 2ODRD 4R2EA 2FTXB 4KZSA 2JXPA 3J7Yp 2EN6A 4X64E 1LLMC 2M4IA 2J7JA 4BCAA 4JI8E 1T4LB 3H09A 3J81C 4BHBA 2EMIA 4GEQB 2LTSA 2NUFA 2MC6A 2EWLA 2F8BA 2WBSA 1YSAC 3ECRA 1T38A 2B9DA 2ENHA 2VF1A 1IMUA 1SFEA 2EL6A 1UN6B 3VK6A 2V85A 5AC5A 3ADJA 2KOUA 1SR9A 4F9BB
chains in the Genus database with same CATH topology
2UU9E 4DKKA 1PKPA 2LE2A 4LFBE 5AE2A 5IWAE 3AUZA 4DV5E 1RC7A 4OX9E 5T6JA 2V86A 4DMIA 4JI3E 5DNYA 4JI7E 3VYYA 4DUZE 2KHXA 4B3TE 4LF6E 4WPYA 1GZ6A 1T4OA 1ZBTA 1N32E 3HTXA 4WSPA 5AE1A 2B3TB 2L8TA 2G7HA 2V88A 4J8ZA 2L3CA 3T1YE 2DIXA 2UUCE 1IBKE 3OMLA 1DI2A 1HNXE 4L5NC 4BC7A 3JAMC 2L2NA 2CPNA 3KWRA 3IWBA 4LTYA 2YZTA 4M0VA 2RSMA 4P7DA 4Q28A 2UUBE 2DMYA 3ZOQB 4X66E 1IBLE 2DB2A 4BBYA 4B3SE 1DQ3A 4JI5E 1STUA 3LMLA 4F9AB 1XMOE 4LFCE 3ADIA 4LU9A 2FGGA 3HXLA 1ZBQA 4DV1E 5AASA 4LF4E 3J7AG 2LJHA 3MSWA 3LLHA 4R03A 1QU6A 2WZOA 3J80C 5F3WA 4LF7E 4JI6E 2H36X 2UXBE 2UUAE 4WYQB 1WHNA 1GQEA 3HQ1A 5A2QC 2ZM6E 2L92A 1YYKA 4YY3E 3HPZA 2L3JA 1XMQE 2LRSA 2L2MA 4I8OA 4DR5E 3T1HE 4OOGC 1YZ9A 2M7QA 4DR4E 2YT4A 1WHQA 2JR1A 2JY9A 1IBME 4LF5E 4B3RE 2JOBA 5LMNE 2JWOA 4M30A 4BMJA 2E1MA 1J26A 1UHZA 4DV6E 1J5EE 1N34E 4DR1E 3F6GA 2IHR1 4BS9A 1WXRA 1FJGE 5LMUE 4NXME 1XNQE 2F4VE 3C4TA 3IWDA 4TUIA 3IWCA 3OTOE 4GKKE 2L2KB 1I94E 1HR0E 2HHHE 5ADZA 3C4BA 4JI0E 2V89A 3DJWA 1T4NA 2MC5A 3JU0A 1N36E 2N3HA 2NA2A 3AV0A 4DV0E 2UXDE 2JOXA 1HNZE 4DR7E 4B3ME 2L33A 3DF6A 3F6HA 5LL6R 5BR8E 2ODRC 3VYXA 1N33E 2RS6A 4F9CB 1YYOA 2EZ6A 4WFTA 4JYAE 2FV4B 4DV3E 2K4VA 2UXCE 3HPSA 1O0WA 2RTXA 2LUPB 1EKZA 4P78A 1UILA 1XNRE 4DR6E 3JTZA 4LF8E 2ODRD 1X49A 4F54A 2FTXB 2N3GA 2V8QB 4GKJE 4JV5E 4KHPE 4KZSA 4AQYE 2B7VA 3J7Yp 2LMZA 4LF9E 4X64E 2NUGA 2M4IA 1YYWA 5AE3A 4DV7E 2V83A 4JI2E 4BCAA 3K6QA 4JI8E 3H09A 1T4LB 3J81C 4X8WA 2LTRA 4DR2E 2RS7A 4DV4E 4JI4E 4NXNE 2V87A 4L8NA 4DUYE 2MDRA 4JI1E 4GEQB 2LTSA 1RQ0A 2VQFE 4DV2E 2NUFA 3FIGA 2KONA 2MC6A 2EWLA 2F8BA 4R8OA 5CFFE 4X62E 4K0KE 1HNWE 4M2ZA 2JVAA 1X48A 1X47A 2DSYA 2B9DA 4BC9A 5FLXC 2VF1A 4YHHE 5IT9C 3ADLA 1FKAE 3P1XA 3VK6A 4TUGA 2M1SA 2B7TA 4X65E 2V85A 2VQEE 3RMPA 2L6MA 2LBSB 2E5LE 4LFAE 2VE7C 3ADJA 2NUEA 2KOUA 1SR9A 3ADGA 4DR3E 4F9BB 2LUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 E;  4DKK A;  1PKP A;  4LFB E;  5IWA E;  4DV5 E;  4OX9 E;  1RC7 A;  4JI3 E;  4JI7 E;  3VYY A;  4DUZ E;  2KHX A;  4B3T E;  4LF6 E;  1T4O A;  1ZBT A;  1N32 E;  3HTX A;  2B3T B;  2L3C A;  3T1Y E;  2UUC E;  2DIX A;  1DI2 A;  1IBK E;  1HNX E;  2L2N A;  2CPN A;  2UUB E;  2RSM A;  2DMY A;  4X66 E;  1IBL E;  2DB2 A;  4B3S E;  4JI5 E;  1STU A;  1XMO E;  3ADI A;  4LFC E;  4DV1 E;  4LF4 E;  2LJH A;  3LLH A;  1QU6 A;  4LF7 E;  4JI6 E;  2UXB E;  2UUA E;  4WYQ B;  1WHN A;  1GQE A;  2ZM6 E;  1YYK A;  4YY3 E;  2L3J A;  1XMQ E;  2LRS A;  2L2M A;  1YZ9 A;  4DR5 E;  3T1H E;  4OOG C;  4DR4 E;  2YT4 A;  1WHQ A;  2JY9 A;  1IBM E;  4LF5 E;  4B3R E;  5LMN E;  4M30 A;  1J26 A;  1UHZ A;  4DV6 E;  1J5E E;  1N34 E;  4DR1 E;  2IHR 1;  1FJG E;  1XNQ E;  5LMU E;  4NXM E;  2F4V E;  3C4T A;  3OTO E;  4GKK E;  2L2K B;  1I94 E;  1HR0 E;  2HHH E;  3C4B A;  4JI0 E;  1T4N A;  1N36 E;  2N3H A;  2NA2 A;  4DV0 E;  2UXD E;  1HNZ E;  4DR7 E;  4B3M E;  2L33 A;  5BR8 E;  3VYX A;  1N33 E;  2RS6 A;  1YYO A;  2EZ6 A;  4WFT A;  4JYA E;  4DV3 E;  2UXC E;  1O0W A;  2RTX A;  2LUP B;  1EKZ A;  1UIL A;  1XNR E;  4DR6 E;  4LF8 E;  1X49 A;  2N3G A;  4GKJ E;  4JV5 E;  4KHP E;  4AQY E;  2B7V A;  3J7Y p;  4LF9 E;  4X64 E;  2NUG A;  1YYW A;  4DV7 E;  4JI2 E;  1T4L B;  4JI8 E;  4X8W A;  2LTR A;  4DR2 E;  2RS7 A;  4DV4 E;  4JI4 E;  4NXN E;  4DUY E;  2MDR A;  4JI1 E;  2LTS A;  1RQ0 A;  2VQF E;  4DV2 E;  2NUF A;  4X62 E;  4K0K E;  5CFF E;  1HNW E;  4M2Z A;  2JVA A;  1X48 A;  1X47 A;  4YHH E;  3ADL A;  1FKA E;  3P1X A;  2VQE E;  2B7T A;  4X65 E;  4LFA E;  2LBS B;  2E5L E;  3ADJ A;  2NUE A;  3ADG A;  4DR3 E;  2LUQ A; 
#chains in the Genus database with same CATH topology
 2EQ0 A;  1BBG A;  4LFB E;  2LE2 A;  1N3G A;  4DV5 E;  1RC7 A;  5LLQ A;  2E72 A;  2V86 A;  1X6F A;  4IS1 C;  3VYY A;  4LF6 E;  5A6K A;  1T4O A;  2EN7 A;  2G7H A;  1EH7 A;  2V88 A;  4BHC A;  3MHS C;  2EPK X;  2ELY A;  1HNX E;  2EMF A;  2L2N A;  2YZT A;  4Q28 A;  2Q8U A;  2JPA A;  4B3S E;  4JI5 E;  3QG5 C;  4R2C A;  1XMO E;  4F9A B;  4GZN C;  5TSE A;  3EPK A;  2EMB A;  5A6A A;  3THO B;  3HXL A;  2EM5 A;  1DGC A;  3LLH A;  1QU6 A;  2WZO A;  2EM4 A;  1WHN A;  5KL5 A;  3HQ1 A;  4N4R B;  1YZ9 A;  3T1H E;  4DR4 E;  1IBM E;  2JR1 A;  2JOB A;  2LVH A;  4M9V C;  4M30 A;  2E1M A;  3KZY A;  4DV6 E;  2JYA A;  1NEI A;  2EMH A;  2ENA A;  4R2P A;  2EPZ A;  2EOX A;  3F6G A;  4BS9 A;  1WXR A;  4DR1 E;  2L2K B;  2HHH E;  4HTG A;  5KL4 A;  4JI0 E;  2YTQ A;  2MC5 A;  1JK1 A;  2UXD E;  2JOX A;  4DR7 E;  2YSO A;  1Z1B A;  4O5G A;  4B3M E;  2L33 A;  5LL6 R;  2VRD A;  2YTF A;  4F9C B;  2EPA A;  2FV4 B;  4DV3 E;  2EOQ A;  4R2A A;  1TF3 A;  2EPC A;  1UIL A;  2EPU A;  4DR6 E;  2LJU A;  4F54 A;  2LO3 A;  1X6E A;  2EN3 A;  1EH6 A;  2B7V A;  2EQ3 A;  2EPP A;  2EPO A;  4LF9 E;  5AE3 A;  1BBO A;  2V83 A;  4JI2 E;  2EOZ A;  2RS7 A;  4JI4 E;  2A25 A;  4L8N A;  4DUY E;  2MDR A;  1X3C A;  3FIG A;  5CFF E;  1HNW E;  4KWY A;  2JVA A;  1X48 A;  1PJS A;  5IT9 C;  4R2R A;  2EM2 A;  2EN1 A;  1FKA E;  4TUG A;  1JK2 A;  4X65 E;  1YFH A;  2L6M A;  2E5L E;  4ZYH A;  2EMK A;  1YUI A;  2MKN A;  2LUQ A;  4OX9 E;  5T6J A;  2EL5 A;  4HEI A;  4JI7 E;  4DUZ E;  2EMG A;  4WPY A;  2N8X A;  2EOO A;  1N32 E;  2YTP A;  2YTN A;  4J8Z A;  2DIX A;  2NAB A;  1IBK E;  3OML A;  2WBT A;  2R1F A;  4L5N C;  2RQL A;  4M0V A;  2CPN A;  4WSP A;  2DMY A;  3C6M A;  1DQ3 A;  1A1H A;  1QNT A;  2EMA A;  2FGG A;  1ZBQ A;  2EOF A;  4DV1 E;  4R2D A;  5AAS A;  4LF4 E;  3J7A G;  5IXM B;  5F3W A;  2EPL X;  2UUA E;  2YTI A;  5A2Q C;  1G2D C;  2L92 A;  2JP9 A;  1YYK A;  4YY3 E;  2YRH A;  3C6K A;  2LRS A;  2L2M A;  1PJT A;  2M7Q A;  5A6J A;  4B3R E;  2ADR A;  1J26 A;  1UHZ A;  4WXC A;  2EOJ A;  4Q35 B;  1XNQ E;  2EOI A;  2YTJ A;  2ENC A;  4TUI A;  2EPM X;  3IWC A;  1I94 E;  2EM3 A;  4O24 A;  1KJK A;  1F2I G;  2N3H A;  3L00 A;  2EOR A;  2RPC A;  2EM8 A;  3DF6 A;  4FK5 C;  3BGH A;  3VYX A;  1N33 E;  2YTD A;  4JYA E;  1IQS A;  2ELZ A;  5IV8 B;  2UXC E;  2WCC 3;  2RTX A;  1A1F A;  2EPX A;  3JTZ A;  4LF8 E;  1XNR E;  2DRP A;  1X49 A;  1IQO A;  2N3G A;  4JV5 E;  2EL4 A;  4DV7 E;  1L4S A;  3K6Q A;  4X8W A;  4DR2 E;  2EMY A;  3TQM A;  4JI1 E;  1RQ0 A;  4R8O A;  4MLQ A;  4X62 E;  5KL3 A;  2I13 A;  4BC9 A;  1TN9 A;  2B7T A;  4LFA E;  3RMP A;  2LBS B;  2VE7 C;  2NUE A;  3ADG A;  4R2S A;  2MDG A;  4DKK A;  3BID A;  4F6N A;  4WX9 A;  3AUZ A;  3THN A;  2EOM A;  2EP3 A;  2EN2 A;  2HGH A;  3BBG A;  2RSI A;  2YU8 A;  1WJP A;  2EMC A;  2YPN A;  2EML A;  2EQ1 A;  5AE1 A;  2B3T B;  5A69 A;  2LV2 A;  1MEY C;  2CTD A;  2YTE A;  2UUC E;  3T1Y E;  1DI2 A;  2K7I A;  1WRJ A;  1MGT A;  3JAM C;  2EOH A;  4LTY A;  3IWB A;  2RSM A;  3ZOQ B;  4BBY A;  2EOE A;  3LML A;  3ADI A;  2EMW A;  2R76 A;  2EOS A;  2WBU A;  2EOY A;  2GHF A;  1KYQ A;  2LJH A;  3MSW A;  3J80 C;  4LF7 E;  4JI6 E;  4ZYG A;  2UXB E;  2EM0 A;  1GQE A;  5A6B D;  1B69 A;  1AAY A;  3HPZ A;  1PJQ A;  4R2Q A;  1TF6 A;  2YSP A;  1ZAA C;  2YT4 A;  2JY9 A;  1X5W A;  2JWO A;  4BMJ A;  2PRT A;  2BBG A;  1N34 E;  5A6B A;  2EN8 A;  2IHR 1;  1A1J A;  1FJG E;  4WXD A;  5LMU E;  1ZU1 A;  4NXM E;  2F4V E;  1X6H A;  3C4T A;  2DLK A;  2LCE A;  3C4B A;  2V89 A;  1T4N A;  2DMI A;  3AV0 A;  4DV0 E;  1HNZ E;  1NCS A;  2YTG A;  3M99 B;  2EMZ A;  1P47 A;  2BB8 A;  4RH8 A;  2RS6 A;  3BF2 A;  1YYO A;  2EZ6 A;  4NZV A;  2MKD A;  2YWQ A;  5KL6 A;  3VHT B;  2GPI A;  2V8Q B;  4GKJ E;  2HJJ A;  4KHP E;  4AQY E;  5AC4 A;  2LMZ A;  2NUG A;  4F6M A;  1YYW A;  3EQ1 A;  2DGC A;  2YTO A;  3MHH C;  2LTR A;  4DV4 E;  4NXN E;  2V87 A;  2VQF E;  4DV2 E;  2KON A;  4K0K E;  5KL7 A;  2M9A A;  4M2Z A;  1X47 A;  2DSY A;  5FLX C;  4YHH E;  4IJD A;  3ADL A;  5KL2 A;  3P1X A;  4MLV A;  2VQE E;  2M1S A;  2YRK A;  1ZR9 A;  2D9H A;  3KZZ A;  4DR3 E;  2EE8 A;  2YU5 A;  4WSG A;  4RHB B;  2UU9 E;  2HC5 A;  1PKP A;  5AE2 A;  5IWA E;  2CT1 A;  4DMI A;  4ZYE A;  4JI3 E;  5DNY A;  4B3T E;  2KHX A;  3UK3 C;  1GZ6 A;  1ZBT A;  1A1K A;  3HTX A;  4NHR A;  1A1I A;  2EJ4 A;  2L8T A;  2L3C A;  4X9J A;  2EPN A;  4BC7 A;  3KWR A;  2UUB E;  4P7D A;  2I9I A;  1A1L A;  4X66 E;  1IBL E;  2DB2 A;  1STU A;  4LFC E;  2DLQ A;  4LU9 A;  2EPR A;  1YUJ A;  1YPN A;  1PDA A;  4R03 A;  4ZYD A;  4O43 A;  2EM6 A;  4O4K A;  2H36 X;  4WYQ B;  1G2F C;  3EPL A;  1T39 A;  2ZM6 E;  2L3J A;  1XMQ E;  4I8O A;  4DR5 E;  4OOG C;  1WHQ A;  4LF5 E;  2EN4 A;  5LMN E;  2YRM A;  1J5E E;  2GLI A;  2LT7 A;  1A1G A;  3IWD A;  3OTO E;  4GKK E;  1HR0 E;  5ADZ A;  1AH5 A;  4F2J C;  3DJW A;  3JU0 A;  1N36 E;  2NA2 A;  1EH8 A;  3EPJ A;  2CSH A;  1GTK A;  3F6H A;  2EM7 A;  5BR8 E;  2ODR C;  1BB8 A;  4WFT A;  1UBD C;  2K4V A;  3HPS A;  1O0W A;  3EPH A;  2LUP B;  1EKZ A;  1RMD A;  4P78 A;  2EM9 A;  2EMX A;  2ODR D;  4R2E A;  2FTX B;  4KZS A;  2JXP A;  3J7Y p;  2EN6 A;  4X64 E;  1LLM C;  2M4I A;  2J7J A;  4BCA A;  4JI8 E;  1T4L B;  3H09 A;  3J81 C;  4BHB A;  2EMI A;  4GEQ B;  2LTS A;  2NUF A;  2MC6 A;  2EWL A;  2F8B A;  2WBS A;  1YSA C;  3ECR A;  1T38 A;  2B9D A;  2ENH A;  2VF1 A;  1IMU A;  1SFE A;  2EL6 A;  1UN6 B;  3VK6 A;  2V85 A;  5AC5 A;  3ADJ A;  2KOU A;  1SR9 A;  4F9B B; 
#chains in the Genus database with same CATH homology
 2UU9 E;  4DKK A;  1PKP A;  2LE2 A;  4LFB E;  5AE2 A;  5IWA E;  3AUZ A;  4DV5 E;  1RC7 A;  4OX9 E;  5T6J A;  2V86 A;  4DMI A;  4JI3 E;  5DNY A;  4JI7 E;  3VYY A;  4DUZ E;  2KHX A;  4B3T E;  4LF6 E;  4WPY A;  1GZ6 A;  1T4O A;  1ZBT A;  1N32 E;  3HTX A;  4WSP A;  5AE1 A;  2B3T B;  2L8T A;  2G7H A;  2V88 A;  4J8Z A;  2L3C A;  3T1Y E;  2DIX A;  2UUC E;  1IBK E;  3OML A;  1DI2 A;  1HNX E;  4L5N C;  4BC7 A;  3JAM C;  2L2N A;  2CPN A;  3KWR A;  3IWB A;  4LTY A;  2YZT A;  4M0V A;  2RSM A;  4P7D A;  4Q28 A;  2UUB E;  2DMY A;  3ZOQ B;  4X66 E;  1IBL E;  2DB2 A;  4BBY A;  4B3S E;  1DQ3 A;  4JI5 E;  1STU A;  3LML A;  4F9A B;  1XMO E;  4LFC E;  3ADI A;  4LU9 A;  2FGG A;  3HXL A;  1ZBQ A;  4DV1 E;  5AAS A;  4LF4 E;  3J7A G;  2LJH A;  3MSW A;  3LLH A;  4R03 A;  1QU6 A;  2WZO A;  3J80 C;  5F3W A;  4LF7 E;  4JI6 E;  2H36 X;  2UXB E;  2UUA E;  4WYQ B;  1WHN A;  1GQE A;  3HQ1 A;  5A2Q C;  2ZM6 E;  2L92 A;  1YYK A;  4YY3 E;  3HPZ A;  2L3J A;  1XMQ E;  2LRS A;  2L2M A;  4I8O A;  4DR5 E;  3T1H E;  4OOG C;  1YZ9 A;  2M7Q A;  4DR4 E;  2YT4 A;  1WHQ A;  2JR1 A;  2JY9 A;  1IBM E;  4LF5 E;  4B3R E;  2JOB A;  5LMN E;  2JWO A;  4M30 A;  4BMJ A;  2E1M A;  1J26 A;  1UHZ A;  4DV6 E;  1J5E E;  1N34 E;  4DR1 E;  3F6G A;  2IHR 1;  4BS9 A;  1WXR A;  1FJG E;  5LMU E;  4NXM E;  1XNQ E;  2F4V E;  3C4T A;  3IWD A;  4TUI A;  3IWC A;  3OTO E;  4GKK E;  2L2K B;  1I94 E;  1HR0 E;  2HHH E;  5ADZ A;  3C4B A;  4JI0 E;  2V89 A;  3DJW A;  1T4N A;  2MC5 A;  3JU0 A;  1N36 E;  2N3H A;  2NA2 A;  3AV0 A;  4DV0 E;  2UXD E;  2JOX A;  1HNZ E;  4DR7 E;  4B3M E;  2L33 A;  3DF6 A;  3F6H A;  5LL6 R;  5BR8 E;  2ODR C;  3VYX A;  1N33 E;  2RS6 A;  4F9C B;  1YYO A;  2EZ6 A;  4WFT A;  4JYA E;  2FV4 B;  4DV3 E;  2K4V A;  2UXC E;  3HPS A;  1O0W A;  2RTX A;  2LUP B;  1EKZ A;  4P78 A;  1UIL A;  1XNR E;  4DR6 E;  3JTZ A;  4LF8 E;  2ODR D;  1X49 A;  4F54 A;  2FTX B;  2N3G A;  2V8Q B;  4GKJ E;  4JV5 E;  4KHP E;  4KZS A;  4AQY E;  2B7V A;  3J7Y p;  2LMZ A;  4LF9 E;  4X64 E;  2NUG A;  2M4I A;  1YYW A;  5AE3 A;  4DV7 E;  2V83 A;  4JI2 E;  4BCA A;  3K6Q A;  4JI8 E;  3H09 A;  1T4L B;  3J81 C;  4X8W A;  2LTR A;  4DR2 E;  2RS7 A;  4DV4 E;  4JI4 E;  4NXN E;  2V87 A;  4L8N A;  4DUY E;  2MDR A;  4JI1 E;  4GEQ B;  2LTS A;  1RQ0 A;  2VQF E;  4DV2 E;  2NUF A;  3FIG A;  2KON A;  2MC6 A;  2EWL A;  2F8B A;  4R8O A;  5CFF E;  4X62 E;  4K0K E;  1HNW E;  4M2Z A;  2JVA A;  1X48 A;  1X47 A;  2DSY A;  2B9D A;  4BC9 A;  5FLX C;  2VF1 A;  4YHH E;  5IT9 C;  3ADL A;  1FKA E;  3P1X A;  3VK6 A;  4TUG A;  2M1S A;  2B7T A;  4X65 E;  2V85 A;  2VQE E;  3RMP A;  2L6M A;  2LBS B;  2E5L E;  4LFA E;  2VE7 C;  3ADJ A;  2NUE A;  2KOU A;  1SR9 A;  3ADG A;  4DR3 E;  4F9B B;  2LUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...