3LLHA

Crystal structure of the first dsrbd of tar rna-binding protein 2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
64
Chain Sequence
GKTPISLLQEYGTRIGKTPVYDLLKAEPNFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of dsRBDs of human TRBP
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords RISC-loading complex subunit TARBP2
total genus 15
structure length 64
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3llhA00
1UILA 5LMUE 4YY3E 1XNRE 1RQ0A 1XMOE 4DR6E 2LTRA 3T1YE 2VQEE 2NUGA 4DR3E 4X62E 3P1XA 2LTSA 4DV0E 4M2ZA 3J7Yp 4GKJE 4WYQB 1YYWA 4LFCE 1X49A 2RSMA 3ADJA 4DR5E 4LF8E 3C4BA 1YYKA 1X48A 1HNXE 2LUQA 1N32E 1HNWE 4JI2E 4JV5E 2RS7A 4X8WA 4M30A 4NXNE 2IHR1 2N3GA 2L2MA 2UXBE 4B3TE 4NXME 4WFTA 1IBME 2JY9A 1PKPA 1XMQE 2HHHE 4JI7E 2YT4A 1DI2A 4JI4E 4DR4E 4X65E 4B3ME 1EKZA 4DV3E 2L3JA 1T4OA 3HTXA 1WHQA 1HR0E 3T1HE 4JI8E 2JVAA 4LFAE 4OOGC 5CFFE 4DR1E 3ADGA 2F4VE 2NA2A 3C4TA 4DV1E 1ZBTA 4DKKA 4X64E 4AQYE 4DUZE 1UHZA 2B3TB 2LUPB 4JI3E 1IBKE 2ZM6E 2L2NA 4LF9E 2B7VA 2L33A 4DV7E 4LF6E 4X66E 4K0KE 4DUYE 2UUBE 2LBSB 2B7TA 4JYAE 3OTOE 1YYOA 1N34E 4LFBE 1QU6A 5IWAE 1IBLE 1X47A 1GQEA 1XNQE 4DR7E 2DIXA 2KHXA 2LJHA 1FKAE 1YZ9A 1J26A 1O0WA 2EZ6A 1T4LB 2L3CA 2RS6A 4DR2E 5LMNE 4LF5E 2CPNA 2DB2A 4DV6E 2LRSA 4GKKE 4KHPE 1STUA 2UU9E 2VQFE 2UXCE 1N33E 4B3SE 2NUFA 1I94E 1N36E 3VYXA 3ADIA 5BR8E 2L2KB 4DV5E 2UXDE 4DV2E 2MDRA 4JI6E 1HNZE 2RTXA 1RC7A 4B3RE 2NUEA 4YHHE 4DV4E 4LF4E 1FJGE 1T4NA 3ADLA 2N3HA 2UUCE 3VYYA 1J5EE 4JI1E 4LF7E 2DMYA 4JI0E 2E5LE 4JI5E 1WHNA 3LLHA 2UUAE 4OX9E
chains in the Genus database with same CATH superfamily
1YPNA 5AE2A 2MKDA 1PDAA 2VE7C 4BHBA 4DR3E 3P1XA 2JR1A 2L8TA 4DV0E 5A6KA 4LFCE 4I8OA 3ADJA 1MGTA 2EOMA 3C4BA 2EN7A 5ADZA 1HNXE 2LUQA 4BS9A 4NZVA 1T38A 1N32E 2ODRC 2H36X 2EPXA 2FV4B 4X8WA 2EQ1A 3L00A 2UXBE 2D9HA 4NXME 1IBME 1PKPA 2EMGA 4JI7E 2EP3A 2YTQA 2M1SA 2YTJA 2YTIA 4WSGA 2EPRA 1UN6B 2EM8A 4F54A 5AASA 1TN9A 2YTPA 2L3JA 1PJTA 1HR0E 2EOYA 1KJKA 4F9CB 4R03A 2YTGA 2JVAA 4LFAE 4DR1E 2NABA 3ADGA 1ZU1A 3J81C 4DKKA 5A6JA 4M0VA 2BB8A 2EPOA 2EMCA 2B3TB 5AC4A 2ENHA 2M7QA 1T39A 3J80C 4DV7E 3BGHA 2EMIA 4R2CA 5LL6R 5IXMB 4DUYE 2EM5A 2V85A 2LBSB 2B7TA 3K6QA 3IWDA 4X9JA 1N34E 1X6HA 5TSEA 2ENAA 2EWLA 3EQ1A 4NHRA 1T4LB 2EOEA 2L3CA 2JP9A 5A69A 4GKKE 3THNA 2ELZA 1WJPA 2EORA 1I94E 4Q28A 2MDRA 4MLVA 1X5WA 4YHHE 2EOSA 4LF4E 4BC9A 3AV0A 2JXPA 2EQ0A 2YPNA 2EN1A 4LF7E 2LE2A 1YSAC 1TF3A 1A1HA 1UILA 2LV2A 1XNRE 2EN2A 1RQ0A 5KL6A 1XMOE 3T1YE 4X62E 5AC5A 3J7Yp 4WYQB 4WXCA 2EN4A 2YRKA 4HEIA 1A1JA 3MSWA 2DRPA 2EMAA 2JOBA 4RH8A 1NEIA 1X48A 5IT9C 1HNWE 3KZZA 4JI2E 5A6AA 4WPYA 5F3WA 4JV5E 2DLQA 2IHR1 2L2MA 2EMLA 5KL5A 4R2AA 4B3TE 2EM0A 2EN6A 2EMYA 4GEQB 2M4IA 2N8XA 3HXLA 2HHHE 1JK2A 4R2PA 2YRHA 4F2JC 1P47A 3H09A 2MDGA 2YU5A 2YSPA 4DR4E 4P78A 5AE1A 4DV3E 1PJSA 2YTDA 1LLMC 5KL2A 1WXRA 1T4OA 1A1LA 1TF6A 3KZYA 2J7JA 2LCEA 2V88A 4LTYA 4MLQA 4JI8E 2LJUA 5T6JA 4OOGC 1A1KA 4O4KA 4DV1E 1WRJA 2JOXA 5IV8B 2EMWA 4Q35B 1G2FC 4ZYHA 2HC5A 4DUZE 1UHZA 2RPCA 2EPAA 1QNTA 3EPKA 2A25A 1BB8A 4JI3E 1B69A 2DMIA 2B7VA 2L33A 2EMFA 5A6BD 2JPAA 4LF6E 4K0KE 2EPCA 2EPNA 2V86A 2PRTA 1L4SA 2JYAA 3OTOE 4WXDA 1GQEA 2KHXA 2I13A 5AE3A 2EMBA 1F2IG 5A2QC 2GHFA 2EZ6A 2CSHA 2RS6A 1SFEA 2E72A 3THOB 2CPNA 2YTNA 4L5NC 2YTFA 4BCAA 5A6BA 4DV6E 1A1IA 4LF5E 1IMUA 2EM6A 4F9AB 1STUA 2KONA 4TUIA 2VQFE 2UXCE 2MKNA 4B3SE 2EOIA 3F6GA 2L2KB 4BC7A 3RMPA 1X6FA 3BBGA 1HNZE 2EN3A 2NUEA 3VHTB 2CTDA 2EOJA 2B9DA 4R2EA 3ADLA 2EMKA 3VYYA 2DLKA 4JI1E 1DGCA 4ZYDA 2MC6A 5LLQA 4JI0E 3JTZA 2E5LE 2EMHA 2GPIA 1ZBQA 3F6HA 1DQ3A 4OX9E 1BBGA 2EL5A 2YTOA 2GLIA 2M9AA 2ENCA 3MHSC 4DR6E 2WBUA 2VQEE 2EM9A 2F8BA 3HQ1A 2V8QB 3ECRA 2LTSA 4GKJE 3EPJA 3J7AG 1AH5A 1YYWA 4HTGA 1X49A 2RSMA 4DR5E 4LF8E 2E1MA 1YYKA 2EM2A 4F9BB 2EPLX 4P7DA 4DMIA 2FGGA 2RS7A 1UBDC 2CT1A 4WFTA 4WX9A 4JI4E 4KZSA 2EJ4A 1EKZA 2EPMX 4IS1C 1WHQA 3LMLA 4O24A 2EOZA 3JU0A 5CFFE 1ZBTA 2WZOA 2EL4A 2V87A 2ELYA 3MHHC 4L8NA 1BBOA 2EM7A 1IQSA 2RSIA 2VF1A 2JWOA 3DJWA 2ZM6E 3DF6A 2K4VA 4LF9E 2EE8A 4X66E 3AUZA 1YYOA 4LFBE 1QU6A 4J8ZA 5IWAE 2EN8A 1XNQE 4O5GA 4DR7E 2ADRA 2G7HA 1FKAE 3C6KA 4KWYA 1G2DC 2EQ3A 2LRSA 3M99B 4RHBB 1GTKA 2EMZA 3EPLA 2LO3A 3QG5C 2K7IA 2NUFA 2EOHA 3FIGA 3ADIA 4DV5E 2L92A 2WBTA 2EOXA 4JI6E 3IWCA 2RTXA 4R2SA 1RC7A 1SR9A 3ZOQB 2I9IA 1EH7A 2DSYA 2EM4A 3BF2A 4BHCA 3C6MA 4F6NA 3VK6A 2VRDA 3TQMA 1AAYA 3BIDA 2ODRD 2R1FA 1GZ6A 4JI5E 1WHNA 2UUAE 4WSPA 2LMZA 5KL4A 1IQOA 5LMUE 2YTEA 4YY3E 4BMJA 5KL3A 2LTRA 1RMDA 2NUGA 3HPZA 2R76A 1MEYC 4M2ZA 1PJQA 4M30A 4NXNE 2EOQA 2N3GA 2BBGA 2EMXA 4BBYA 1X6EA 4IJDA 2JY9A 1A1FA 2HGHA 1XMQE 2EM3A 2YT4A 2V83A 1DI2A 2KOUA 2EOOA 3EPHA 4X65E 1YUIA 4B3ME 3OMLA 2YZTA 2YSOA 2EPZA 3HTXA 3T1HE 4N4RB 2L6MA 1Z1BA 2F4VE 2NA2A 3C4TA 4X64E 4F6MA 2EPPA 4AQYE 4ZYEA 1YFHA 1A1GA 1KYQA 3HPSA 2LUPB 2YU8A 1IBKE 2L2NA 1NCSA 4O43A 1YUJA 2UUBE 2HJJA 2EL6A 4JYAE 2EPKX 2WCC3 1JK1A 5DNYA 2Q8UA 1X47A 1IBLE 2DIXA 1EH6A 2LJHA 4GZNC 4FK5C 1YZ9A 1J26A 1O0WA 4DR2E 2YWQA 5LMNE 3UK3C 4R2RA 2DB2A 1ZAAC 4KHPE 3IWBA 4R2QA 2UU9E 2WBSA 2EOFA 2LVHA 1N33E 1ZR9A 1N36E 3VYXA 2UXDE 5BR8E 2FTXB 2EPUA 4DV2E 1EH8A 2LT7A 1N3GA 4TUGA 2YRMA 2V89A 3JAMC 4B3RE 2RQLA 3KWRA 4DV4E 2MC5A 1FJGE 1T4NA 5FLXC 2N3HA 2UUCE 1J5EE 4R8OA 2DMYA 4LU9A 4ZYGA 1X3CA 4R2DA 3LLHA 4M9VC 5KL7A 2DGCA
chains in the Genus database with same CATH topology
5AE2A 4WSPA 1UILA 2LMZA 5LMUE 4YY3E 4BMJA 1XNRE 2VE7C 1RQ0A 1XMOE 4DR6E 2LTRA 3T1YE 2VQEE 2NUGA 2F8BA 3HPZA 3HQ1A 2V8QB 3P1XA 2LTSA 2JR1A 2L8TA 4X62E 3J7Yp 4DV0E 4WYQB 4M2ZA 3J7AG 4GKJE 1YYWA 4LFCE 1X49A 3MSWA 2JOBA 2RSMA 3ADJA 3F6HA 2E1MA 3C4BA 4I8OA 4DR5E 4LF8E 5ADZA 1X48A 1HNXE 1YYKA 2LUQA 4F9BB 5IT9C 4BS9A 4P7DA 1N32E 1HNWE 4JI2E 2ODRC 4WPYA 2FGGA 2RS7A 2H36X 4X8WA 2FV4B 4M30A 4DMIA 5F3WA 4JV5E 4NXNE 2IHR1 2N3GA 2L2MA 4BBYA 2UXBE 4B3TE 4NXME 4WFTA 1IBME 4GEQB 2JY9A 2M4IA 1PKPA 1XMQE 3HXLA 2HHHE 4JI7E 2YT4A 2M1SA 2V83A 3H09A 2KOUA 4JI4E 4DR4E 4X65E 4P78A 1DI2A 4KZSA 4B3ME 5AE1A 4DR3E 1EKZA 4DV3E 4F54A 5AASA 3OMLA 2YZTA 2L3JA 1WXRA 1T4OA 3HTXA 1WHQA 1HR0E 3LMLA 2V88A 4LTYA 4F9CB 3JU0A 4R03A 4JI8E 3T1HE 2JVAA 4LFAE 5T6JA 4OOGC 5CFFE 4DR1E 2L6MA 3ADGA 2F4VE 2NA2A 3C4TA 4DV1E 3J81C 1ZBTA 2JOXA 4DKKA 4M0VA 2WZOA 4X64E 2V87A 4AQYE 4DUZE 1UHZA 2B3TB 4L8NA 3HPSA 2LUPB 4JI3E 2VF1A 1IBKE 2JWOA 3DJWA 2ZM6E 2L2NA 3DF6A 2K4VA 2M7QA 4LF9E 2B7VA 2L33A 3J80C 4DV7E 4LF6E 4X66E 4K0KE 3AUZA 5LL6R 4DUYE 2UUBE 2V85A 2V86A 2LBSB 2B7TA 3K6QA 4JYAE 3IWDA 3OTOE 1YYOA 1N34E 4LFBE 1QU6A 4J8ZA 5DNYA 5IWAE 1IBLE 1X47A 1GQEA 1XNQE 4DR7E 2DIXA 2KHXA 2LJHA 2EWLA 2G7HA 1FKAE 5AE3A 1YZ9A 1J26A 5A2QC 1O0WA 2EZ6A 1T4LB 2L3CA 2RS6A 4DR2E 5LMNE 4LF5E 2CPNA 4L5NC 2DB2A 4BCAA 4DV6E 2LRSA 4GKKE 4F9AB 4KHPE 1STUA 2KONA 3IWBA 4TUIA 2VQFE 2UU9E 2UXCE 1N33E 4B3SE 2NUFA 1I94E 1N36E 3VYXA 3F6GA 3FIGA 5BR8E 2L2KB 4DV5E 3ADIA 2FTXB 4Q28A 4DV2E 2L92A 2UXDE 2MDRA 4BC7A 3RMPA 4TUGA 4JI6E 1HNZE 2V89A 2RTXA 3IWCA 3JAMC 1RC7A 2NUEA 1SR9A 3ZOQB 4YHHE 3KWRA 4DV4E 4B3RE 2MC5A 4LF4E 2B9DA 4BC9A 3AV0A 1FJGE 1T4NA 2DSYA 5FLXC 3ADLA 2N3HA 2UUAE 2UUCE 3VYYA 1J5EE 4R8OA 3VK6A 4JI1E 4LF7E 2MC6A 2DMYA 4JI0E 3JTZA 2ODRD 4LU9A 2E5LE 1GZ6A 4JI5E 2LE2A 1WHNA 1ZBQA 3LLHA 1DQ3A 4OX9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UIL A;  5LMU E;  4YY3 E;  1XNR E;  1RQ0 A;  1XMO E;  4DR6 E;  2LTR A;  3T1Y E;  2VQE E;  2NUG A;  4DR3 E;  4X62 E;  3P1X A;  2LTS A;  4DV0 E;  4M2Z A;  3J7Y p;  4GKJ E;  4WYQ B;  1YYW A;  4LFC E;  1X49 A;  2RSM A;  3ADJ A;  4DR5 E;  4LF8 E;  3C4B A;  1YYK A;  1X48 A;  1HNX E;  2LUQ A;  1N32 E;  1HNW E;  4JI2 E;  4JV5 E;  2RS7 A;  4X8W A;  4M30 A;  4NXN E;  2IHR 1;  2N3G A;  2L2M A;  2UXB E;  4B3T E;  4NXM E;  4WFT A;  1IBM E;  2JY9 A;  1PKP A;  1XMQ E;  2HHH E;  4JI7 E;  2YT4 A;  1DI2 A;  4JI4 E;  4DR4 E;  4X65 E;  4B3M E;  1EKZ A;  4DV3 E;  2L3J A;  1T4O A;  3HTX A;  1WHQ A;  1HR0 E;  3T1H E;  4JI8 E;  2JVA A;  4LFA E;  4OOG C;  5CFF E;  4DR1 E;  3ADG A;  2F4V E;  2NA2 A;  3C4T A;  4DV1 E;  1ZBT A;  4DKK A;  4X64 E;  4AQY E;  4DUZ E;  1UHZ A;  2B3T B;  2LUP B;  4JI3 E;  1IBK E;  2ZM6 E;  2L2N A;  4LF9 E;  2B7V A;  2L33 A;  4DV7 E;  4LF6 E;  4X66 E;  4K0K E;  4DUY E;  2UUB E;  2LBS B;  2B7T A;  4JYA E;  3OTO E;  1YYO A;  1N34 E;  4LFB E;  1QU6 A;  5IWA E;  1IBL E;  1X47 A;  1GQE A;  1XNQ E;  4DR7 E;  2DIX A;  2KHX A;  2LJH A;  1FKA E;  1YZ9 A;  1J26 A;  1O0W A;  2EZ6 A;  1T4L B;  2L3C A;  2RS6 A;  4DR2 E;  5LMN E;  4LF5 E;  2CPN A;  2DB2 A;  4DV6 E;  2LRS A;  4GKK E;  4KHP E;  1STU A;  2UU9 E;  2VQF E;  2UXC E;  1N33 E;  4B3S E;  2NUF A;  1I94 E;  1N36 E;  3VYX A;  3ADI A;  5BR8 E;  2L2K B;  4DV5 E;  2UXD E;  4DV2 E;  2MDR A;  4JI6 E;  1HNZ E;  2RTX A;  1RC7 A;  4B3R E;  2NUE A;  4YHH E;  4DV4 E;  4LF4 E;  1FJG E;  1T4N A;  3ADL A;  2N3H A;  2UUC E;  3VYY A;  1J5E E;  4JI1 E;  4LF7 E;  2DMY A;  4JI0 E;  2E5L E;  4JI5 E;  1WHN A;  3LLH A;  2UUA E;  4OX9 E; 
#chains in the Genus database with same CATH topology
 1YPN A;  5AE2 A;  2MKD A;  1PDA A;  2VE7 C;  4BHB A;  4DR3 E;  3P1X A;  2JR1 A;  2L8T A;  4DV0 E;  5A6K A;  4LFC E;  4I8O A;  3ADJ A;  1MGT A;  2EOM A;  3C4B A;  2EN7 A;  5ADZ A;  1HNX E;  2LUQ A;  4BS9 A;  4NZV A;  1T38 A;  1N32 E;  2ODR C;  2H36 X;  2EPX A;  2FV4 B;  4X8W A;  2EQ1 A;  3L00 A;  2UXB E;  2D9H A;  4NXM E;  1IBM E;  1PKP A;  2EMG A;  4JI7 E;  2EP3 A;  2YTQ A;  2M1S A;  2YTJ A;  2YTI A;  4WSG A;  2EPR A;  1UN6 B;  2EM8 A;  4F54 A;  5AAS A;  1TN9 A;  2YTP A;  2L3J A;  1PJT A;  1HR0 E;  2EOY A;  1KJK A;  4F9C B;  4R03 A;  2YTG A;  2JVA A;  4LFA E;  4DR1 E;  2NAB A;  3ADG A;  1ZU1 A;  3J81 C;  4DKK A;  5A6J A;  4M0V A;  2BB8 A;  2EPO A;  2EMC A;  2B3T B;  5AC4 A;  2ENH A;  2M7Q A;  1T39 A;  3J80 C;  4DV7 E;  3BGH A;  2EMI A;  4R2C A;  5LL6 R;  5IXM B;  4DUY E;  2EM5 A;  2V85 A;  2LBS B;  2B7T A;  3K6Q A;  3IWD A;  4X9J A;  1N34 E;  1X6H A;  5TSE A;  2ENA A;  2EWL A;  3EQ1 A;  4NHR A;  1T4L B;  2EOE A;  2L3C A;  2JP9 A;  5A69 A;  4GKK E;  3THN A;  2ELZ A;  1WJP A;  2EOR A;  1I94 E;  4Q28 A;  2MDR A;  4MLV A;  1X5W A;  4YHH E;  2EOS A;  4LF4 E;  4BC9 A;  3AV0 A;  2JXP A;  2EQ0 A;  2YPN A;  2EN1 A;  4LF7 E;  2LE2 A;  1YSA C;  1TF3 A;  1A1H A;  1UIL A;  2LV2 A;  1XNR E;  2EN2 A;  1RQ0 A;  5KL6 A;  1XMO E;  3T1Y E;  4X62 E;  5AC5 A;  3J7Y p;  4WYQ B;  4WXC A;  2EN4 A;  2YRK A;  4HEI A;  1A1J A;  3MSW A;  2DRP A;  2EMA A;  2JOB A;  4RH8 A;  1NEI A;  1X48 A;  5IT9 C;  1HNW E;  3KZZ A;  4JI2 E;  5A6A A;  4WPY A;  5F3W A;  4JV5 E;  2DLQ A;  2IHR 1;  2L2M A;  2EML A;  5KL5 A;  4R2A A;  4B3T E;  2EM0 A;  2EN6 A;  2EMY A;  4GEQ B;  2M4I A;  2N8X A;  3HXL A;  2HHH E;  1JK2 A;  4R2P A;  2YRH A;  4F2J C;  1P47 A;  3H09 A;  2MDG A;  2YU5 A;  2YSP A;  4DR4 E;  4P78 A;  5AE1 A;  4DV3 E;  1PJS A;  2YTD A;  1LLM C;  5KL2 A;  1WXR A;  1T4O A;  1A1L A;  1TF6 A;  3KZY A;  2J7J A;  2LCE A;  2V88 A;  4LTY A;  4MLQ A;  4JI8 E;  2LJU A;  5T6J A;  4OOG C;  1A1K A;  4O4K A;  4DV1 E;  1WRJ A;  2JOX A;  5IV8 B;  2EMW A;  4Q35 B;  1G2F C;  4ZYH A;  2HC5 A;  4DUZ E;  1UHZ A;  2RPC A;  2EPA A;  1QNT A;  3EPK A;  2A25 A;  1BB8 A;  4JI3 E;  1B69 A;  2DMI A;  2B7V A;  2L33 A;  2EMF A;  5A6B D;  2JPA A;  4LF6 E;  4K0K E;  2EPC A;  2EPN A;  2V86 A;  2PRT A;  1L4S A;  2JYA A;  3OTO E;  4WXD A;  1GQE A;  2KHX A;  2I13 A;  5AE3 A;  2EMB A;  1F2I G;  5A2Q C;  2GHF A;  2EZ6 A;  2CSH A;  2RS6 A;  1SFE A;  2E72 A;  3THO B;  2CPN A;  2YTN A;  4L5N C;  2YTF A;  4BCA A;  5A6B A;  4DV6 E;  1A1I A;  4LF5 E;  1IMU A;  2EM6 A;  4F9A B;  1STU A;  2KON A;  4TUI A;  2VQF E;  2UXC E;  2MKN A;  4B3S E;  2EOI A;  3F6G A;  2L2K B;  4BC7 A;  3RMP A;  1X6F A;  3BBG A;  1HNZ E;  2EN3 A;  2NUE A;  3VHT B;  2CTD A;  2EOJ A;  2B9D A;  4R2E A;  3ADL A;  2EMK A;  3VYY A;  2DLK A;  4JI1 E;  1DGC A;  4ZYD A;  2MC6 A;  5LLQ A;  4JI0 E;  3JTZ A;  2E5L E;  2EMH A;  2GPI A;  1ZBQ A;  3F6H A;  1DQ3 A;  4OX9 E;  1BBG A;  2EL5 A;  2YTO A;  2GLI A;  2M9A A;  2ENC A;  3MHS C;  4DR6 E;  2WBU A;  2VQE E;  2EM9 A;  2F8B A;  3HQ1 A;  2V8Q B;  3ECR A;  2LTS A;  4GKJ E;  3EPJ A;  3J7A G;  1AH5 A;  1YYW A;  4HTG A;  1X49 A;  2RSM A;  4DR5 E;  4LF8 E;  2E1M A;  1YYK A;  2EM2 A;  4F9B B;  2EPL X;  4P7D A;  4DMI A;  2FGG A;  2RS7 A;  1UBD C;  2CT1 A;  4WFT A;  4WX9 A;  4JI4 E;  4KZS A;  2EJ4 A;  1EKZ A;  2EPM X;  4IS1 C;  1WHQ A;  3LML A;  4O24 A;  2EOZ A;  3JU0 A;  5CFF E;  1ZBT A;  2WZO A;  2EL4 A;  2V87 A;  2ELY A;  3MHH C;  4L8N A;  1BBO A;  2EM7 A;  1IQS A;  2RSI A;  2VF1 A;  2JWO A;  3DJW A;  2ZM6 E;  3DF6 A;  2K4V A;  4LF9 E;  2EE8 A;  4X66 E;  3AUZ A;  1YYO A;  4LFB E;  1QU6 A;  4J8Z A;  5IWA E;  2EN8 A;  1XNQ E;  4O5G A;  4DR7 E;  2ADR A;  2G7H A;  1FKA E;  3C6K A;  4KWY A;  1G2D C;  2EQ3 A;  2LRS A;  3M99 B;  4RHB B;  1GTK A;  2EMZ A;  3EPL A;  2LO3 A;  3QG5 C;  2K7I A;  2NUF A;  2EOH A;  3FIG A;  3ADI A;  4DV5 E;  2L92 A;  2WBT A;  2EOX A;  4JI6 E;  3IWC A;  2RTX A;  4R2S A;  1RC7 A;  1SR9 A;  3ZOQ B;  2I9I A;  1EH7 A;  2DSY A;  2EM4 A;  3BF2 A;  4BHC A;  3C6M A;  4F6N A;  3VK6 A;  2VRD A;  3TQM A;  1AAY A;  3BID A;  2ODR D;  2R1F A;  1GZ6 A;  4JI5 E;  1WHN A;  2UUA E;  4WSP A;  2LMZ A;  5KL4 A;  1IQO A;  5LMU E;  2YTE A;  4YY3 E;  4BMJ A;  5KL3 A;  2LTR A;  1RMD A;  2NUG A;  3HPZ A;  2R76 A;  1MEY C;  4M2Z A;  1PJQ A;  4M30 A;  4NXN E;  2EOQ A;  2N3G A;  2BBG A;  2EMX A;  4BBY A;  1X6E A;  4IJD A;  2JY9 A;  1A1F A;  2HGH A;  1XMQ E;  2EM3 A;  2YT4 A;  2V83 A;  1DI2 A;  2KOU A;  2EOO A;  3EPH A;  4X65 E;  1YUI A;  4B3M E;  3OML A;  2YZT A;  2YSO A;  2EPZ A;  3HTX A;  3T1H E;  4N4R B;  2L6M A;  1Z1B A;  2F4V E;  2NA2 A;  3C4T A;  4X64 E;  4F6M A;  2EPP A;  4AQY E;  4ZYE A;  1YFH A;  1A1G A;  1KYQ A;  3HPS A;  2LUP B;  2YU8 A;  1IBK E;  2L2N A;  1NCS A;  4O43 A;  1YUJ A;  2UUB E;  2HJJ A;  2EL6 A;  4JYA E;  2EPK X;  2WCC 3;  1JK1 A;  5DNY A;  2Q8U A;  1X47 A;  1IBL E;  2DIX A;  1EH6 A;  2LJH A;  4GZN C;  4FK5 C;  1YZ9 A;  1J26 A;  1O0W A;  4DR2 E;  2YWQ A;  5LMN E;  3UK3 C;  4R2R A;  2DB2 A;  1ZAA C;  4KHP E;  3IWB A;  4R2Q A;  2UU9 E;  2WBS A;  2EOF A;  2LVH A;  1N33 E;  1ZR9 A;  1N36 E;  3VYX A;  2UXD E;  5BR8 E;  2FTX B;  2EPU A;  4DV2 E;  1EH8 A;  2LT7 A;  1N3G A;  4TUG A;  2YRM A;  2V89 A;  3JAM C;  4B3R E;  2RQL A;  3KWR A;  4DV4 E;  2MC5 A;  1FJG E;  1T4N A;  5FLX C;  2N3H A;  2UUC E;  1J5E E;  4R8O A;  2DMY A;  4LU9 A;  4ZYG A;  1X3C A;  4R2D A;  3LLH A;  4M9V C;  5KL7 A;  2DGC A; 
#chains in the Genus database with same CATH homology
 5AE2 A;  4WSP A;  1UIL A;  2LMZ A;  5LMU E;  4YY3 E;  4BMJ A;  1XNR E;  2VE7 C;  1RQ0 A;  1XMO E;  4DR6 E;  2LTR A;  3T1Y E;  2VQE E;  2NUG A;  2F8B A;  3HPZ A;  3HQ1 A;  2V8Q B;  3P1X A;  2LTS A;  2JR1 A;  2L8T A;  4X62 E;  3J7Y p;  4DV0 E;  4WYQ B;  4M2Z A;  3J7A G;  4GKJ E;  1YYW A;  4LFC E;  1X49 A;  3MSW A;  2JOB A;  2RSM A;  3ADJ A;  3F6H A;  2E1M A;  3C4B A;  4I8O A;  4DR5 E;  4LF8 E;  5ADZ A;  1X48 A;  1HNX E;  1YYK A;  2LUQ A;  4F9B B;  5IT9 C;  4BS9 A;  4P7D A;  1N32 E;  1HNW E;  4JI2 E;  2ODR C;  4WPY A;  2FGG A;  2RS7 A;  2H36 X;  4X8W A;  2FV4 B;  4M30 A;  4DMI A;  5F3W A;  4JV5 E;  4NXN E;  2IHR 1;  2N3G A;  2L2M A;  4BBY A;  2UXB E;  4B3T E;  4NXM E;  4WFT A;  1IBM E;  4GEQ B;  2JY9 A;  2M4I A;  1PKP A;  1XMQ E;  3HXL A;  2HHH E;  4JI7 E;  2YT4 A;  2M1S A;  2V83 A;  3H09 A;  2KOU A;  4JI4 E;  4DR4 E;  4X65 E;  4P78 A;  1DI2 A;  4KZS A;  4B3M E;  5AE1 A;  4DR3 E;  1EKZ A;  4DV3 E;  4F54 A;  5AAS A;  3OML A;  2YZT A;  2L3J A;  1WXR A;  1T4O A;  3HTX A;  1WHQ A;  1HR0 E;  3LML A;  2V88 A;  4LTY A;  4F9C B;  3JU0 A;  4R03 A;  4JI8 E;  3T1H E;  2JVA A;  4LFA E;  5T6J A;  4OOG C;  5CFF E;  4DR1 E;  2L6M A;  3ADG A;  2F4V E;  2NA2 A;  3C4T A;  4DV1 E;  3J81 C;  1ZBT A;  2JOX A;  4DKK A;  4M0V A;  2WZO A;  4X64 E;  2V87 A;  4AQY E;  4DUZ E;  1UHZ A;  2B3T B;  4L8N A;  3HPS A;  2LUP B;  4JI3 E;  2VF1 A;  1IBK E;  2JWO A;  3DJW A;  2ZM6 E;  2L2N A;  3DF6 A;  2K4V A;  2M7Q A;  4LF9 E;  2B7V A;  2L33 A;  3J80 C;  4DV7 E;  4LF6 E;  4X66 E;  4K0K E;  3AUZ A;  5LL6 R;  4DUY E;  2UUB E;  2V85 A;  2V86 A;  2LBS B;  2B7T A;  3K6Q A;  4JYA E;  3IWD A;  3OTO E;  1YYO A;  1N34 E;  4LFB E;  1QU6 A;  4J8Z A;  5DNY A;  5IWA E;  1IBL E;  1X47 A;  1GQE A;  1XNQ E;  4DR7 E;  2DIX A;  2KHX A;  2LJH A;  2EWL A;  2G7H A;  1FKA E;  5AE3 A;  1YZ9 A;  1J26 A;  5A2Q C;  1O0W A;  2EZ6 A;  1T4L B;  2L3C A;  2RS6 A;  4DR2 E;  5LMN E;  4LF5 E;  2CPN A;  4L5N C;  2DB2 A;  4BCA A;  4DV6 E;  2LRS A;  4GKK E;  4F9A B;  4KHP E;  1STU A;  2KON A;  3IWB A;  4TUI A;  2VQF E;  2UU9 E;  2UXC E;  1N33 E;  4B3S E;  2NUF A;  1I94 E;  1N36 E;  3VYX A;  3F6G A;  3FIG A;  5BR8 E;  2L2K B;  4DV5 E;  3ADI A;  2FTX B;  4Q28 A;  4DV2 E;  2L92 A;  2UXD E;  2MDR A;  4BC7 A;  3RMP A;  4TUG A;  4JI6 E;  1HNZ E;  2V89 A;  2RTX A;  3IWC A;  3JAM C;  1RC7 A;  2NUE A;  1SR9 A;  3ZOQ B;  4YHH E;  3KWR A;  4DV4 E;  4B3R E;  2MC5 A;  4LF4 E;  2B9D A;  4BC9 A;  3AV0 A;  1FJG E;  1T4N A;  2DSY A;  5FLX C;  3ADL A;  2N3H A;  2UUA E;  2UUC E;  3VYY A;  1J5E E;  4R8O A;  3VK6 A;  4JI1 E;  4LF7 E;  2MC6 A;  2DMY A;  4JI0 E;  3JTZ A;  2ODR D;  4LU9 A;  2E5L E;  1GZ6 A;  4JI5 E;  2LE2 A;  1WHN A;  1ZBQ A;  3LLH A;  1DQ3 A;  4OX9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...