3LLHA

Crystal structure of the first dsrbd of tar rna-binding protein 2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
64
Chain Sequence
GKTPISLLQEYGTRIGKTPVYDLLKAEPNFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RISC-loading complex subunit TARBP2
publication title The structures of dsRBDs of human TRBP
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 15
structure length 64
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3llhA00
1X48A 1J26A 3VYXA 4NXNE 4DV3E 1I94E 1HR0E 1N34E 1J5EE 1N32E 1T4LB 2RTXA 4M30A 4DKKA 4AQYE 2NA2A 1WHQA 4KHPE 2NUGA 4LFCE 4LFBE 1N33E 3HTXA 2UXCE 3ADGA 4LF4E 1UHZA 5LMNE 1ZBTA 4X8WA 1FKAE 2NUEA 1WHNA 4M2ZA 4B3SE 3VYYA 4DV4E 2LUPB 4X66E 4LF5E 1STUA 1N36E 1FJGE 4LFAE 2CPNA 1YYOA 4DR3E 3P1XA 4JI8E 2L3CA 5CFFE 2L3JA 2LTRA 2LBSB 1O0WA 4JI1E 4JV5E 1HNWE 2L2MA 4DR5E 2E5LE 1PKPA 4B3ME 4OX9E 2UXDE 4DR1E 4DR4E 4WYQB 2RSMA 2JVAA 4WFTA 2B3TB 1YZ9A 2UU9E 2L33A 3J7Yp 5IWAE 4DV2E 3OTOE 4X64E 2UUAE 4DV6E 3C4BA 2EZ6A 4JI6E 4LF7E 2F4VE 4YY3E 4JI2E 1IBME 2UXBE 4B3TE 2MDRA 4DV7E 2IHR1 1X49A 4DR6E 2VQFE 4YHHE 4NXME 1T4NA 1HNZE 2JY9A 1YYWA 2HHHE 4X65E 1X47A 2L2KB 2LRSA 1XMOE 5LMUE 4DR7E 2KHXA 3T1YE 1YYKA 4LF6E 4K0KE 2N3HA 3C4TA 4JI0E 2NUFA 1T4OA 2N3GA 3LLHA 4JI7E 4GKJE 4JI5E 2DB2A 2RS7A 4DV5E 1RC7A 3ADIA 2YT4A 2LJHA 2UUBE 4JYAE 4B3RE 1UILA 4JI4E 1XNRE 4DUYE 3T1HE 3ADJA 2UUCE 1EKZA 2VQEE 4GKKE 1XNQE 1GQEA 4OOGC 2RS6A 1HNXE 4JI3E 4LF9E 2LUQA 4X62E 1IBKE 4LF8E 1RQ0A 4DV1E 1XMQE 2B7VA 2L2NA 4DUZE 3ADLA 2DMYA 2B7TA 2DIXA 5BR8E 2ZM6E 1QU6A 1DI2A 1IBLE 4DR2E 2LTSA 4DV0E
chains in the Genus database with same CATH superfamily
5A6BD 3BGHA 3THOB 1J26A 1RMDA 4R2CA 4NXNE 5TSEA 4DV3E 1X5WA 1I94E 3J7AG 1J5EE 1N32E 1T4LB 4BC9A 1NEIA 2RTXA 2VE7C 1DGCA 4M30A 1N33E 1WHQA 1GZ6A 2V89A 2YTFA 2DGCA 5ADZA 5KL5A 1IQSA 2BB8A 3ADGA 4R2SA 1BB8A 4LTYA 2EPNA 2EN2A 5A6AA 2YTJA 5KL2A 2EPAA 5AC4A 4B3SE 2EOFA 2LUPB 1FJGE 1BBGA 2EMYA 3P1XA 4JI8E 2EJ4A 2A25A 2YSOA 2ELZA 2EMHA 2FGGA 1O0WA 2DLQA 2WZOA 1X6HA 4F9BB 3DF6A 2E5LE 2GHFA 4NHRA 4F54A 4DR4E 2ELYA 2RSMA 2J7JA 2EOSA 1JK1A 5IWAE 2MKDA 1EH7A 4JI6E 2F4VE 4FK5C 4BC7A 2EOEA 2YRMA 1X3CA 5FLXC 3C6MA 1A1IA 4NXME 4L5NC 3BIDA 2HHHE 4X65E 3HQ1A 3AUZA 2L2KB 1XMOE 2L92A 3HPZA 2YPNA 3UK3C 2KHXA 3T1YE 1YYKA 4F6NA 2EORA 4K0KE 2ODRC 1T4OA 1ZBQA 4JI7E 2GPIA 3H09A 2EN7A 1RC7A 2EM3A 5AE1A 1ZU1A 2EQ1A 4DUYE 2YTPA 2EN8A 2DLKA 2LV2A 2VF1A 2VQEE 2LCEA 2LVHA 2ENAA 2RS6A 2LO3A 1HNXE 3IWBA 1DQ3A 4LF9E 1T38A 1IBKE 4R2QA 2EN6A 2K7IA 1YPNA 2B7TA 4R2AA 2ZM6E 4KZSA 5LLQA 1G2FC 2EOXA 1IBLE 3EPLA 2EM0A 5F3WA 2YU8A 2ENCA 2MC5A 4IJDA 2EPZA 2WCC3 4R2RA 4ZYEA 2EOJA 2NA2A 2EMLA 2B9DA 2CTDA 1UHZA 1ZBTA 4X8WA 3JAMC 2RQLA 2EWLA 2EPMX 3VYYA 1G2DC 2YU5A 3FIGA 4LFAE 4BCAA 2L3CA 2YTGA 2EM6A 3C6KA 5CFFE 1LLMC 4Q28A 2HGHA 2L3JA 2LTRA 2LBSB 1A1FA 1HNWE 4GZNC 4OX9E 2KONA 4ZYHA 5DNYA 2UXDE 3BBGA 1MEYC 2EMCA 4WX9A 2EL6A 2LMZA 3OTOE 2CT1A 4X64E 3EPHA 2EN3A 3IWCA 4LF7E 2MDGA 4O5GA 2ODRD 2EMXA 4DV7E 2EMAA 2EL4A 1T4NA 3F6GA 1HNZE 1N3GA 1X47A 1A1HA 2EPXA 4L8NA 4WSGA 4WXDA 2I13A 4DR7E 2NABA 4LF6E 4R8OA 3C4TA 2MKNA 2NUFA 2H36X 1UBDC 2K4VA 4GKJE 3ADIA 4DV5E 2YT4A 1TF3A 2JYAA 2EOHA 2LJHA 2UUBE 4GEQB 4B3RE 4JI4E 5KL7A 4BHCA 2I9IA 2BBGA 2FV4B 3MHSC 3AV0A 5KL4A 1X6EA 2WBSA 4F2JC 1A1LA 1YUJA 3M99B 2EMZA 4WSPA 1P47A 4X9JA 4X62E 2YSPA 2EN1A 4LF8E 5AE2A 2EM9A 1TN9A 4RH8A 3ADLA 2DMYA 2EM8A 5BR8E 3RMPA 1WJPA 5A6JA 1QU6A 4I8OA 1DI2A 4DR2E 5A2QC 4KWYA 3VYXA 2EE8A 2EPKX 5LL6R 1HR0E 1N34E 5KL6A 2EOQA 4AQYE 4LFBE 2EMGA 4LFCE 4NZVA 3J81C 1A1JA 2EQ3A 2EM2A 3HTXA 2WBTA 2UXCE 5LMNE 2JOXA 4ZYDA 1SR9A 3LMLA 2M4IA 3VK6A 1WHNA 1SFEA 2V87A 4X66E 4P7DA 4LF5E 1STUA 1ZAAC 1YYOA 4DR3E 4RHBB 4JI1E 1BBOA 2E1MA 4BS9A 5AC5A 2MC6A 4DR5E 1PKPA 2L6MA 1GTKA 1IQOA 2E72A 2EOYA 4WYQB 2DMIA 1YZ9A 2L33A 3J7Yp 3C4BA 2EZ6A 2EMIA 2HC5A 4JI2E 1PJSA 2UXBE 4B3TE 1T39A 4DR6E 4HTGA 5A69A 3K6QA 2JXPA 2EPLX 4M0VA 4YHHE 2EMFA 2JR1A 4BBYA 2JY9A 2EN4A 1YYWA 2EM7A 2EMWA 2LRSA 2V83A 5A6KA 1KYQA 4F9CB 2VRDA 2N3HA 3MSWA 4JI0E 1UN6B 4J8ZA 2N3GA 3LLHA 1X6FA 2M1SA 4F9AB 1TF6A 4JI5E 2DB2A 1QNTA 2HJJA 4O43A 3OMLA 2PRTA 4TUGA 4JYAE 4WXCA 2V8QB 3EQ1A 3ECRA 1XNRE 5AE3A 3T1HE 3J80C 3ADJA 4GKKE 1XNQE 1KJKA 2KOUA 4OOGC 3HXLA 5AASA 2JP9A 4JI3E 3KZYA 3KZZA 2EOMA 1PJQA 3THNA 1RQ0A 2EPUA 2L2NA 4DUZE 1MGTA 4TUIA 4R2EA 2V88A 3JU0A 2EM4A 1A1GA 2R1FA 1EH6A 2EPOA 3F6HA 2N8XA 2LTSA 4DV0E 5T6JA 1X48A 4N4RB 1B69A 4IS1C 4O4KA 4WPYA 2DRPA 2LT7A 4LU9A 2EOOA 5IV8B 2EMKA 4DKKA 4KHPE 5KL3A 2ENHA 2NUGA 1L4SA 4M9VC 2GLIA 3BF2A 4LF4E 1FKAE 2DSYA 2NUEA 4HEIA 4M2ZA 4DV4E 1N36E 2CPNA 2L8TA 4MLVA 2YRKA 3QG5C 1AAYA 4P78A 4JV5E 2V86A 1PDAA 2F8BA 2L2MA 1A1KA 4B3ME 4DR1E 2JVAA 4WFTA 2B3TB 4ZYGA 2UU9E 5A6BA 1AH5A 2YZTA 4DV2E 2UUAE 1YSAC 4R2PA 2YTDA 4DV6E 4R2DA 1JK2A 1WXRA 4YY3E 2JPAA 3MHHC 1IBME 2MDRA 4O24A 3IWDA 2Q8UA 2YWQA 2IHR1 1X49A 2RPCA 2V85A 2RSIA 2VQFE 1WRJA 2EOIA 2M9AA 3L00A 2G7HA 4Q35B 2FTXB 3DJWA 4F6MA 5LMUE 3ZOQB 2YTOA 1ZR9A 4DMIA 2EP3A 3TQMA 2EL5A 2EM5A 2CSHA 3EPKA 5IT9C 1F2IG 2RS7A 2JWOA 3KWRA 1IMUA 2EOZA 1YUIA 1UILA 4MLQA 5IXMB 1PJTA 2ADRA 2D9HA 2YRHA 1EH8A 2UUCE 1EKZA 2JOBA 1GQEA 2EQ0A 2YTNA 2LUQA 3HPSA 3EPJA 4R03A 2LE2A 2EPCA 2YTQA 1Z1BA 4DV1E 1XMQE 2B7VA 1YFHA 2EPPA 2YTEA 1NCSA 2DIXA 2WBUA 2EMBA 2M7QA 3VHTB 2LJUA 3JTZA 4BHBA 4BMJA 2R76A 2YTIA 2EPRA
chains in the Genus database with same CATH topology
1X48A 5A2QC 1J26A 5F3WA 3VYXA 2MC5A 4WPYA 4NXNE 4DV3E 4LU9A 1I94E 1HR0E 5LL6R 3J7AG 1N34E 1J5EE 1N32E 1T4LB 4BC9A 2RTXA 2VE7C 4M30A 4DKKA 4AQYE 2NA2A 1WHQA 1GZ6A 2NUGA 4LFCE 2V89A 2B9DA 3J81C 5ADZA 3HTXA 2UXCE 3ADGA 4LF4E 1UHZA 4LTYA 2JOXA 5LMNE 1SR9A 1ZBTA 4X8WA 3LMLA 2M4IA 4LFBE 3JAMC 3VK6A 1FKAE 2DSYA 1WHNA 2NUEA 4M2ZA 4B3SE 2EWLA 3VYYA 2V87A 4DV4E 2LUPB 4X66E 4P7DA 4LF5E 1STUA 1N36E 3FIGA 1FJGE 4LFAE 2CPNA 1YYOA 4BCAA 3P1XA 4JI8E 2L8TA 2L3CA 4DR3E 5CFFE 4Q28A 2L3JA 2FGGA 2LTRA 2LBSB 1O0WA 4JI1E 4P78A 4JV5E 2V86A 2WZOA 2E1MA 1HNWE 2F8BA 2L2MA 4BS9A 4F9BB 2MC6A 4DR5E 3DF6A 1PKPA 2KONA 2L6MA 5DNYA 2E5LE 4B3ME 4F54A 4OX9E 4KHPE 4DR1E 4DR4E 2UXDE 4WYQB 2RSMA 2JVAA 4WFTA 2B3TB 1YZ9A 2UU9E 2L33A 3J7Yp 2YZTA 5IWAE 2LMZA 4DV2E 3OTOE 4X64E 2UUAE 4DV6E 3C4BA 2EZ6A 3IWCA 4JI6E 4LF7E 2F4VE 1WXRA 4YY3E 4BC7A 4JI2E 1IBME 1N33E 2ODRD 4B3TE 2UXBE 2MDRA 3IWDA 4DV7E 2IHR1 1X49A 4DR6E 2V85A 3K6QA 2VQFE 5FLXC 4M0VA 4YHHE 4NXME 1T4NA 2G7HA 2JR1A 3F6GA 4L5NC 4BBYA 1HNZE 2JY9A 1YYWA 2FTXB 3DJWA 3HQ1A 1X47A 3AUZA 4X65E 4L8NA 2L2KB 2LRSA 1XMOE 2L92A 3HPZA 5LMUE 2V83A 2KHXA 3ZOQB 3T1YE 1YYKA 4DR7E 4LF6E 4R8OA 4F9CB 4K0KE 2N3HA 2ODRC 3C4TA 3MSWA 4DMIA 4JI0E 2NUFA 1T4OA 2H36X 2N3GA 4J8ZA 3LLHA 1ZBQA 2M1SA 2K4VA 4JI7E 4F9AB 2DB2A 5IT9C 4JI5E 4GKJE 2RS7A 2JWOA 3H09A 3KWRA 3OMLA 4DV5E 1RC7A 2YT4A 3ADIA 2LJHA 5AE1A 4TUGA 2UUBE 4JYAE 4GEQB 4B3RE 1UILA 2V8QB 4JI4E 1XNRE 5AE3A 4DUYE 3T1HE 3J80C 2FV4B 3ADJA 3AV0A 2VF1A 2UUCE 1EKZA 2VQEE 4GKKE 1XNQE 2JOBA 2KOUA 1GQEA 4OOGC 2RS6A 1HNXE 3HXLA 5AASA 4JI3E 3IWBA 4WSPA 1DQ3A 2LUQA 3HPSA 4LF9E 4R03A 4X62E 2LE2A 2HHHE 1IBKE 4LF8E 1RQ0A 4DV1E 1XMQE 2B7VA 2L2NA 5AE2A 4DUZE 3ADLA 2DMYA 2B7TA 2DIXA 5BR8E 4TUIA 3RMPA 2V88A 3JU0A 2M7QA 2ZM6E 1QU6A 4I8OA 4KZSA 1DI2A 3JTZA 1IBLE 3F6HA 4BMJA 4DR2E 2LTSA 4DV0E 5T6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X48 A;  1J26 A;  3VYX A;  4NXN E;  4DV3 E;  1I94 E;  1HR0 E;  1N34 E;  1J5E E;  1N32 E;  1T4L B;  2RTX A;  4M30 A;  4DKK A;  4AQY E;  2NA2 A;  1WHQ A;  4KHP E;  2NUG A;  4LFC E;  4LFB E;  1N33 E;  3HTX A;  2UXC E;  3ADG A;  4LF4 E;  1UHZ A;  5LMN E;  1ZBT A;  4X8W A;  1FKA E;  2NUE A;  1WHN A;  4M2Z A;  4B3S E;  3VYY A;  4DV4 E;  2LUP B;  4X66 E;  4LF5 E;  1STU A;  1N36 E;  1FJG E;  4LFA E;  2CPN A;  1YYO A;  4DR3 E;  3P1X A;  4JI8 E;  2L3C A;  5CFF E;  2L3J A;  2LTR A;  2LBS B;  1O0W A;  4JI1 E;  4JV5 E;  1HNW E;  2L2M A;  4DR5 E;  2E5L E;  1PKP A;  4B3M E;  4OX9 E;  2UXD E;  4DR1 E;  4DR4 E;  4WYQ B;  2RSM A;  2JVA A;  4WFT A;  2B3T B;  1YZ9 A;  2UU9 E;  2L33 A;  3J7Y p;  5IWA E;  4DV2 E;  3OTO E;  4X64 E;  2UUA E;  4DV6 E;  3C4B A;  2EZ6 A;  4JI6 E;  4LF7 E;  2F4V E;  4YY3 E;  4JI2 E;  1IBM E;  2UXB E;  4B3T E;  2MDR A;  4DV7 E;  2IHR 1;  1X49 A;  4DR6 E;  2VQF E;  4YHH E;  4NXM E;  1T4N A;  1HNZ E;  2JY9 A;  1YYW A;  2HHH E;  4X65 E;  1X47 A;  2L2K B;  2LRS A;  1XMO E;  5LMU E;  4DR7 E;  2KHX A;  3T1Y E;  1YYK A;  4LF6 E;  4K0K E;  2N3H A;  3C4T A;  4JI0 E;  2NUF A;  1T4O A;  2N3G A;  3LLH A;  4JI7 E;  4GKJ E;  4JI5 E;  2DB2 A;  2RS7 A;  4DV5 E;  1RC7 A;  3ADI A;  2YT4 A;  2LJH A;  2UUB E;  4JYA E;  4B3R E;  1UIL A;  4JI4 E;  1XNR E;  4DUY E;  3T1H E;  3ADJ A;  2UUC E;  1EKZ A;  2VQE E;  4GKK E;  1XNQ E;  1GQE A;  4OOG C;  2RS6 A;  1HNX E;  4JI3 E;  4LF9 E;  2LUQ A;  4X62 E;  1IBK E;  4LF8 E;  1RQ0 A;  4DV1 E;  1XMQ E;  2B7V A;  2L2N A;  4DUZ E;  3ADL A;  2DMY A;  2B7T A;  2DIX A;  5BR8 E;  2ZM6 E;  1QU6 A;  1DI2 A;  1IBL E;  4DR2 E;  2LTS A;  4DV0 E; 
#chains in the Genus database with same CATH topology
 5A6B D;  3BGH A;  3THO B;  1J26 A;  1RMD A;  4R2C A;  4NXN E;  5TSE A;  4DV3 E;  1X5W A;  1I94 E;  3J7A G;  1J5E E;  1N32 E;  1T4L B;  4BC9 A;  1NEI A;  2RTX A;  2VE7 C;  1DGC A;  4M30 A;  1N33 E;  1WHQ A;  1GZ6 A;  2V89 A;  2YTF A;  2DGC A;  5ADZ A;  5KL5 A;  1IQS A;  2BB8 A;  3ADG A;  4R2S A;  1BB8 A;  4LTY A;  2EPN A;  2EN2 A;  5A6A A;  2YTJ A;  5KL2 A;  2EPA A;  5AC4 A;  4B3S E;  2EOF A;  2LUP B;  1FJG E;  1BBG A;  2EMY A;  3P1X A;  4JI8 E;  2EJ4 A;  2A25 A;  2YSO A;  2ELZ A;  2EMH A;  2FGG A;  1O0W A;  2DLQ A;  2WZO A;  1X6H A;  4F9B B;  3DF6 A;  2E5L E;  2GHF A;  4NHR A;  4F54 A;  4DR4 E;  2ELY A;  2RSM A;  2J7J A;  2EOS A;  1JK1 A;  5IWA E;  2MKD A;  1EH7 A;  4JI6 E;  2F4V E;  4FK5 C;  4BC7 A;  2EOE A;  2YRM A;  1X3C A;  5FLX C;  3C6M A;  1A1I A;  4NXM E;  4L5N C;  3BID A;  2HHH E;  4X65 E;  3HQ1 A;  3AUZ A;  2L2K B;  1XMO E;  2L92 A;  3HPZ A;  2YPN A;  3UK3 C;  2KHX A;  3T1Y E;  1YYK A;  4F6N A;  2EOR A;  4K0K E;  2ODR C;  1T4O A;  1ZBQ A;  4JI7 E;  2GPI A;  3H09 A;  2EN7 A;  1RC7 A;  2EM3 A;  5AE1 A;  1ZU1 A;  2EQ1 A;  4DUY E;  2YTP A;  2EN8 A;  2DLK A;  2LV2 A;  2VF1 A;  2VQE E;  2LCE A;  2LVH A;  2ENA A;  2RS6 A;  2LO3 A;  1HNX E;  3IWB A;  1DQ3 A;  4LF9 E;  1T38 A;  1IBK E;  4R2Q A;  2EN6 A;  2K7I A;  1YPN A;  2B7T A;  4R2A A;  2ZM6 E;  4KZS A;  5LLQ A;  1G2F C;  2EOX A;  1IBL E;  3EPL A;  2EM0 A;  5F3W A;  2YU8 A;  2ENC A;  2MC5 A;  4IJD A;  2EPZ A;  2WCC 3;  4R2R A;  4ZYE A;  2EOJ A;  2NA2 A;  2EML A;  2B9D A;  2CTD A;  1UHZ A;  1ZBT A;  4X8W A;  3JAM C;  2RQL A;  2EWL A;  2EPM X;  3VYY A;  1G2D C;  2YU5 A;  3FIG A;  4LFA E;  4BCA A;  2L3C A;  2YTG A;  2EM6 A;  3C6K A;  5CFF E;  1LLM C;  4Q28 A;  2HGH A;  2L3J A;  2LTR A;  2LBS B;  1A1F A;  1HNW E;  4GZN C;  4OX9 E;  2KON A;  4ZYH A;  5DNY A;  2UXD E;  3BBG A;  1MEY C;  2EMC A;  4WX9 A;  2EL6 A;  2LMZ A;  3OTO E;  2CT1 A;  4X64 E;  3EPH A;  2EN3 A;  3IWC A;  4LF7 E;  2MDG A;  4O5G A;  2ODR D;  2EMX A;  4DV7 E;  2EMA A;  2EL4 A;  1T4N A;  3F6G A;  1HNZ E;  1N3G A;  1X47 A;  1A1H A;  2EPX A;  4L8N A;  4WSG A;  4WXD A;  2I13 A;  4DR7 E;  2NAB A;  4LF6 E;  4R8O A;  3C4T A;  2MKN A;  2NUF A;  2H36 X;  1UBD C;  2K4V A;  4GKJ E;  3ADI A;  4DV5 E;  2YT4 A;  1TF3 A;  2JYA A;  2EOH A;  2LJH A;  2UUB E;  4GEQ B;  4B3R E;  4JI4 E;  5KL7 A;  4BHC A;  2I9I A;  2BBG A;  2FV4 B;  3MHS C;  3AV0 A;  5KL4 A;  1X6E A;  2WBS A;  4F2J C;  1A1L A;  1YUJ A;  3M99 B;  2EMZ A;  4WSP A;  1P47 A;  4X9J A;  4X62 E;  2YSP A;  2EN1 A;  4LF8 E;  5AE2 A;  2EM9 A;  1TN9 A;  4RH8 A;  3ADL A;  2DMY A;  2EM8 A;  5BR8 E;  3RMP A;  1WJP A;  5A6J A;  1QU6 A;  4I8O A;  1DI2 A;  4DR2 E;  5A2Q C;  4KWY A;  3VYX A;  2EE8 A;  2EPK X;  5LL6 R;  1HR0 E;  1N34 E;  5KL6 A;  2EOQ A;  4AQY E;  4LFB E;  2EMG A;  4LFC E;  4NZV A;  3J81 C;  1A1J A;  2EQ3 A;  2EM2 A;  3HTX A;  2WBT A;  2UXC E;  5LMN E;  2JOX A;  4ZYD A;  1SR9 A;  3LML A;  2M4I A;  3VK6 A;  1WHN A;  1SFE A;  2V87 A;  4X66 E;  4P7D A;  4LF5 E;  1STU A;  1ZAA C;  1YYO A;  4DR3 E;  4RHB B;  4JI1 E;  1BBO A;  2E1M A;  4BS9 A;  5AC5 A;  2MC6 A;  4DR5 E;  1PKP A;  2L6M A;  1GTK A;  1IQO A;  2E72 A;  2EOY A;  4WYQ B;  2DMI A;  1YZ9 A;  2L33 A;  3J7Y p;  3C4B A;  2EZ6 A;  2EMI A;  2HC5 A;  4JI2 E;  1PJS A;  2UXB E;  4B3T E;  1T39 A;  4DR6 E;  4HTG A;  5A69 A;  3K6Q A;  2JXP A;  2EPL X;  4M0V A;  4YHH E;  2EMF A;  2JR1 A;  4BBY A;  2JY9 A;  2EN4 A;  1YYW A;  2EM7 A;  2EMW A;  2LRS A;  2V83 A;  5A6K A;  1KYQ A;  4F9C B;  2VRD A;  2N3H A;  3MSW A;  4JI0 E;  1UN6 B;  4J8Z A;  2N3G A;  3LLH A;  1X6F A;  2M1S A;  4F9A B;  1TF6 A;  4JI5 E;  2DB2 A;  1QNT A;  2HJJ A;  4O43 A;  3OML A;  2PRT A;  4TUG A;  4JYA E;  4WXC A;  2V8Q B;  3EQ1 A;  3ECR A;  1XNR E;  5AE3 A;  3T1H E;  3J80 C;  3ADJ A;  4GKK E;  1XNQ E;  1KJK A;  2KOU A;  4OOG C;  3HXL A;  5AAS A;  2JP9 A;  4JI3 E;  3KZY A;  3KZZ A;  2EOM A;  1PJQ A;  3THN A;  1RQ0 A;  2EPU A;  2L2N A;  4DUZ E;  1MGT A;  4TUI A;  4R2E A;  2V88 A;  3JU0 A;  2EM4 A;  1A1G A;  2R1F A;  1EH6 A;  2EPO A;  3F6H A;  2N8X A;  2LTS A;  4DV0 E;  5T6J A;  1X48 A;  4N4R B;  1B69 A;  4IS1 C;  4O4K A;  4WPY A;  2DRP A;  2LT7 A;  4LU9 A;  2EOO A;  5IV8 B;  2EMK A;  4DKK A;  4KHP E;  5KL3 A;  2ENH A;  2NUG A;  1L4S A;  4M9V C;  2GLI A;  3BF2 A;  4LF4 E;  1FKA E;  2DSY A;  2NUE A;  4HEI A;  4M2Z A;  4DV4 E;  1N36 E;  2CPN A;  2L8T A;  4MLV A;  2YRK A;  3QG5 C;  1AAY A;  4P78 A;  4JV5 E;  2V86 A;  1PDA A;  2F8B A;  2L2M A;  1A1K A;  4B3M E;  4DR1 E;  2JVA A;  4WFT A;  2B3T B;  4ZYG A;  2UU9 E;  5A6B A;  1AH5 A;  2YZT A;  4DV2 E;  2UUA E;  1YSA C;  4R2P A;  2YTD A;  4DV6 E;  4R2D A;  1JK2 A;  1WXR A;  4YY3 E;  2JPA A;  3MHH C;  1IBM E;  2MDR A;  4O24 A;  3IWD A;  2Q8U A;  2YWQ A;  2IHR 1;  1X49 A;  2RPC A;  2V85 A;  2RSI A;  2VQF E;  1WRJ A;  2EOI A;  2M9A A;  3L00 A;  2G7H A;  4Q35 B;  2FTX B;  3DJW A;  4F6M A;  5LMU E;  3ZOQ B;  2YTO A;  1ZR9 A;  4DMI A;  2EP3 A;  3TQM A;  2EL5 A;  2EM5 A;  2CSH A;  3EPK A;  5IT9 C;  1F2I G;  2RS7 A;  2JWO A;  3KWR A;  1IMU A;  2EOZ A;  1YUI A;  1UIL A;  4MLQ A;  5IXM B;  1PJT A;  2ADR A;  2D9H A;  2YRH A;  1EH8 A;  2UUC E;  1EKZ A;  2JOB A;  1GQE A;  2EQ0 A;  2YTN A;  2LUQ A;  3HPS A;  3EPJ A;  4R03 A;  2LE2 A;  2EPC A;  2YTQ A;  1Z1B A;  4DV1 E;  1XMQ E;  2B7V A;  1YFH A;  2EPP A;  2YTE A;  1NCS A;  2DIX A;  2WBU A;  2EMB A;  2M7Q A;  3VHT B;  2LJU A;  3JTZ A;  4BHB A;  4BMJ A;  2R76 A;  2YTI A;  2EPR A; 
#chains in the Genus database with same CATH homology
 1X48 A;  5A2Q C;  1J26 A;  5F3W A;  3VYX A;  2MC5 A;  4WPY A;  4NXN E;  4DV3 E;  4LU9 A;  1I94 E;  1HR0 E;  5LL6 R;  3J7A G;  1N34 E;  1J5E E;  1N32 E;  1T4L B;  4BC9 A;  2RTX A;  2VE7 C;  4M30 A;  4DKK A;  4AQY E;  2NA2 A;  1WHQ A;  1GZ6 A;  2NUG A;  4LFC E;  2V89 A;  2B9D A;  3J81 C;  5ADZ A;  3HTX A;  2UXC E;  3ADG A;  4LF4 E;  1UHZ A;  4LTY A;  2JOX A;  5LMN E;  1SR9 A;  1ZBT A;  4X8W A;  3LML A;  2M4I A;  4LFB E;  3JAM C;  3VK6 A;  1FKA E;  2DSY A;  1WHN A;  2NUE A;  4M2Z A;  4B3S E;  2EWL A;  3VYY A;  2V87 A;  4DV4 E;  2LUP B;  4X66 E;  4P7D A;  4LF5 E;  1STU A;  1N36 E;  3FIG A;  1FJG E;  4LFA E;  2CPN A;  1YYO A;  4BCA A;  3P1X A;  4JI8 E;  2L8T A;  2L3C A;  4DR3 E;  5CFF E;  4Q28 A;  2L3J A;  2FGG A;  2LTR A;  2LBS B;  1O0W A;  4JI1 E;  4P78 A;  4JV5 E;  2V86 A;  2WZO A;  2E1M A;  1HNW E;  2F8B A;  2L2M A;  4BS9 A;  4F9B B;  2MC6 A;  4DR5 E;  3DF6 A;  1PKP A;  2KON A;  2L6M A;  5DNY A;  2E5L E;  4B3M E;  4F54 A;  4OX9 E;  4KHP E;  4DR1 E;  4DR4 E;  2UXD E;  4WYQ B;  2RSM A;  2JVA A;  4WFT A;  2B3T B;  1YZ9 A;  2UU9 E;  2L33 A;  3J7Y p;  2YZT A;  5IWA E;  2LMZ A;  4DV2 E;  3OTO E;  4X64 E;  2UUA E;  4DV6 E;  3C4B A;  2EZ6 A;  3IWC A;  4JI6 E;  4LF7 E;  2F4V E;  1WXR A;  4YY3 E;  4BC7 A;  4JI2 E;  1IBM E;  1N33 E;  2ODR D;  4B3T E;  2UXB E;  2MDR A;  3IWD A;  4DV7 E;  2IHR 1;  1X49 A;  4DR6 E;  2V85 A;  3K6Q A;  2VQF E;  5FLX C;  4M0V A;  4YHH E;  4NXM E;  1T4N A;  2G7H A;  2JR1 A;  3F6G A;  4L5N C;  4BBY A;  1HNZ E;  2JY9 A;  1YYW A;  2FTX B;  3DJW A;  3HQ1 A;  1X47 A;  3AUZ A;  4X65 E;  4L8N A;  2L2K B;  2LRS A;  1XMO E;  2L92 A;  3HPZ A;  5LMU E;  2V83 A;  2KHX A;  3ZOQ B;  3T1Y E;  1YYK A;  4DR7 E;  4LF6 E;  4R8O A;  4F9C B;  4K0K E;  2N3H A;  2ODR C;  3C4T A;  3MSW A;  4DMI A;  4JI0 E;  2NUF A;  1T4O A;  2H36 X;  2N3G A;  4J8Z A;  3LLH A;  1ZBQ A;  2M1S A;  2K4V A;  4JI7 E;  4F9A B;  2DB2 A;  5IT9 C;  4JI5 E;  4GKJ E;  2RS7 A;  2JWO A;  3H09 A;  3KWR A;  3OML A;  4DV5 E;  1RC7 A;  2YT4 A;  3ADI A;  2LJH A;  5AE1 A;  4TUG A;  2UUB E;  4JYA E;  4GEQ B;  4B3R E;  1UIL A;  2V8Q B;  4JI4 E;  1XNR E;  5AE3 A;  4DUY E;  3T1H E;  3J80 C;  2FV4 B;  3ADJ A;  3AV0 A;  2VF1 A;  2UUC E;  1EKZ A;  2VQE E;  4GKK E;  1XNQ E;  2JOB A;  2KOU A;  1GQE A;  4OOG C;  2RS6 A;  1HNX E;  3HXL A;  5AAS A;  4JI3 E;  3IWB A;  4WSP A;  1DQ3 A;  2LUQ A;  3HPS A;  4LF9 E;  4R03 A;  4X62 E;  2LE2 A;  2HHH E;  1IBK E;  4LF8 E;  1RQ0 A;  4DV1 E;  1XMQ E;  2B7V A;  2L2N A;  5AE2 A;  4DUZ E;  3ADL A;  2DMY A;  2B7T A;  2DIX A;  5BR8 E;  4TUI A;  3RMP A;  2V88 A;  3JU0 A;  2M7Q A;  2ZM6 E;  1QU6 A;  4I8O A;  4KZS A;  1DI2 A;  3JTZ A;  1IBL E;  3F6H A;  4BMJ A;  4DR2 E;  2LTS A;  4DV0 E;  5T6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...