3LLHA

Crystal structure of the first dsrbd of tar rna-binding protein 2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
64
Chain Sequence
b'GKTPISLLQEYGTRIGKTPVYDLLKAEPNFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RISC-loading complex subunit TARBP2
publication title The structures of dsRBDs of human TRBP
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 15
structure length 64
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3llhA00
4DV4E 1J26A 2DMYA 4JI4E 3HTXA 1PKPA 2UU9E 2NUGA 1UILA 2L3CA 4DV5E 2LJHA 3C4BA 4B3ME 1I94E 5CFFE 2VQEE 1EKZA 4DKKA 2NUFA 2UUAE 4DV7E 2DB2A 4YY3E 2RSMA 4X62E 4M30A 2YT4A 3ADIA 4DR6E 4LFCE 2UXCE 1UHZA 2L3JA 1X49A 2NUEA 4JI0E 3T1YE 1O0WA 2DIXA 4LF8E 4DUZE 2HHHE 4OX9E 4DR1E 1RC7A 1X47A 1YYOA 1X48A 2B7VA 4OOGC 1XMQE 4DV0E 1IBME 1N32E 2B3TB 3ADJA 4DV3E 4JI8E 5IWAE 2LTSA 3J7Yp 2ZM6E 1IBKE 4DR5E 2UXDE 4JI2E 2LUQA 5LMNE 1J5EE 4LF4E 4DV2E 4KHPE 4JI5E 4GKKE 4JI1E 1YYKA 4GKJE 1FKAE 4JV5E 2LRSA 4X66E 1STUA 1N34E 1IBLE 4LFAE 3ADGA 1N33E 4DV6E 2L2MA 4X8WA 2IHR1 2JY9A 1HNZE 1HNWE 1XMOE 2L2NA 2RS7A 2F4VE 4X64E 1GQEA 2UXBE 2N3GA 2LUPB 3OTOE 3ADLA 1QU6A 2UUCE 4DR4E 4DR3E 1RQ0A 4LFBE 1YYWA 4LF5E 4NXNE 3VYXA 1HNXE 1N36E 4LF9E 4B3RE 4K0KE 5BR8E 4DUYE 4LF6E 2N3HA 4AQYE 1T4LB 1T4NA 2MDRA 4JI6E 1HR0E 1YZ9A 2E5LE 2EZ6A 1XNQE 4JI7E 2B7TA 2JVAA 2UUBE 1XNRE 4B3TE 2RTXA 2LBSB 2L2KB 2L33A 2NA2A 1DI2A 4B3SE 3T1HE 4JI3E 1FJGE 1WHNA 3C4TA 2RS6A 4DR7E 4WFTA 4M2ZA 2VQFE 4LF7E 2KHXA 1T4OA 4NXME 4DV1E 2CPNA 4WYQB 1ZBTA 4YHHE 5LMUE 2LTRA 4X65E 3LLHA 3VYYA 1WHQA 4JYAE 3P1XA 4DR2E
chains in the Genus database with same CATH superfamily
4IS1C 5AC5A 3EQ1A 2YRHA 5A6BD 2EMIA 2YTDA 4TUGA 3C4BA 5CFFE 1EKZA 4NZVA 5KL3A 4F6NA 3MHSC 4YY3E 1YFHA 2RSMA 2RPCA 1AAYA 5AE3A 2YTQA 2EQ3A 2MC6A 4NHRA 2ELYA 4DUZE 2EOFA 4IJDA 3AUZA 2EOJA 1X47A 4MLVA 4FK5C 1YYOA 1XMQE 1T38A 3F6HA 3ADJA 4DV3E 2MKDA 2ZM6E 1IBKE 5FLXC 1YSAC 4JI2E 2YPNA 4R2DA 2EOQA 1J5EE 4BC7A 4JI5E 3BBGA 4GKJE 2EL5A 4JV5E 1P47A 2YRKA 1IBLE 2HGHA 2YTGA 3VHTB 3ADGA 4LFAE 2EN6A 3IWCA 2JY9A 3HXLA 4J8ZA 1A1GA 1IQSA 2BBGA 2ADRA 2N3GA 4N4RB 2JP9A 1ZR9A 2N8XA 1X6EA 4O5GA 1SFEA 1A1JA 4LU9A 4NXNE 1NCSA 2YSPA 2LV2A 3IWDA 3M99B 2EOZA 4F9BB 2LCEA 2EM7A 2EPNA 1N36E 4LF9E 4B3RE 2KOUA 2LO3A 4K0KE 5BR8E 1MEYC 2V83A 1T4NA 2GLIA 2UUBE 2YWQA 1XNRE 4B3TE 2EMYA 4GZNC 2LBSB 5DNYA 4HTGA 1PJQA 2EPUA 2L33A 1DI2A 4F6MA 3T1HE 2V88A 4BCAA 4L8NA 3C6MA 1WHNA 2EWLA 2VE7C 4LF7E 1DQ3A 1RMDA 1ZBTA 1MGTA 2WCC3 1YUJA 2EJ4A 4HEIA 3LLHA 2EQ1A 4TUIA 3C6KA 1J26A 2EMZA 3LMLA 2A25A 2EMKA 4R2SA 2FV4B 4BBYA 1UILA 3EPKA 2CSHA 5A6JA 2L3CA 2EPKX 2Q8UA 2LJHA 2ODRC 4Q28A 4R2CA 4B3ME 2VQEE 1JK1A 3FIGA 4X62E 4R2PA 3ADIA 3IWBA 2UXCE 1JK2A 4JI0E 3HQ1A 3T1YE 1O0WA 2DIXA 3KZYA 2JWOA 4OX9E 2HHHE 2YZTA 4DR1E 3EPHA 1KJKA 2GPIA 2DSYA 3THOB 1UBDC 1X48A 1IBME 2M1SA 4DV0E 2B3TB 4JI8E 5IWAE 5A2QC 1X3CA 2EE8A 2EMWA 1GTKA 1X5WA 2LUQA 2V89A 4LF4E 3AV0A 5KL5A 4JI1E 2EMCA 3EPJA 3BF2A 4WPYA 2EL4A 2F8BA 1STUA 1N34E 2EPZA 1PJSA 2J7JA 2EM3A 2L2MA 4WSPA 2IHR1 5AE1A 1HNZE 1HNWE 4ZYEA 5KL6A 1XMOE 2EPMX 2L2NA 2RS7A 4R2QA 2F4VE 1GQEA 4F9AB 1UN6B 2YTPA 2LUPB 2PRTA 3ECRA 1QU6A 4R03A 4LFBE 4LF5E 2LT7A 3VYXA 1HNXE 1LLMC 4P7DA 3J80C 2EPLX 2EPXA 4DUYE 2EOXA 2BB8A 2WBTA 2YTIA 4JI6E 5IT9C 1YZ9A 2ENAA 4L5NC 4X9JA 2WZOA 2E5LE 1XNQE 3TQMA 4JI7E 2JVAA 2JOXA 2JXPA 2EM8A 4WXDA 1YUIA 2D9HA 4B3SE 1L4SA 2V8QB 3C4TA 2RS6A 2I13A 1PJTA 2EN7A 2R1FA 4NXME 4R8OA 4Q35B 4YHHE 5LMUE 2LTRA 1EH8A 4JYAE 5T6JA 4BHBA 1B69A 2EOOA 4DR2E 2E72A 2DMYA 3BIDA 2DGCA 2EMBA 4JI4E 3THNA 4BS9A 2L8TA 3HTXA 2UU9E 2V87A 2LE2A 2V85A 4LTYA 1I94E 1PDAA 4DKKA 2NUFA 2UUAE 4ZYHA 2EOEA 5KL7A 4R2EA 1X6HA 4KWYA 2YT4A 2M9AA 1X49A 2ODRD 2EM4A 2EPRA 3DJWA 2CTDA 4MLQA 2L92A 1RC7A 4BHCA 2YSOA 5ADZA 2JYAA 5KL4A 1A1LA 2K4VA 2YTEA 4O43A 1N32E 3H09A 3QG5C 3DF6A 4R2RA 1EH6A 2LTSA 3JU0A 3J7Yp 2YTFA 2YTOA 2KONA 2UXDE 2R76A 2EP3A 4GKKE 1YYKA 2V86A 2LRSA 4X66E 4DV6E 4X8WA 1QNTA 2MKNA 4O4KA 2EOSA 2UXBE 2EOMA 3VK6A 4ZYDA 2EN8A 3MHHC 3ADLA 2EPAA 5A6KA 4WXCA 2UUCE 4DR4E 4DR3E 1RQ0A 1YYWA 2MDGA 2EPOA 4KZSA 1TF6A 5AE2A 2JR1A 4BMJA 1A1KA 2G7HA 4LF6E 2EMXA 2N3HA 2DLKA 2JOBA 2YRMA 2K7IA 2MC5A 4AQYE 2MDRA 1HR0E 4I8OA 2EN1A 5A6AA 3HPSA 2EM0A 2WBSA 2EM2A 3EPLA 2VRDA 1A1HA 2RTXA 4P78A 5A6BA 2EMAA 2EORA 2DRPA 2LJUA 4F2JC 1FJGE 2EM9A 4GEQB 1AH5A 1T4OA 1ZAAC 1NEIA 2YU5A 2RQLA 3RMPA 3JTZA 4X65E 2EL6A 1IQOA 2LMZA 1F2IG 4DV4E 3KZZA 4DMIA 1WRJA 2WBUA 2L6MA 4F54A 1PKPA 2NUGA 5AASA 4DV5E 2YU8A 3J7AG 4R2AA 4RHBB 1G2DC 2EMHA 5IXMB 4DV7E 2DB2A 1BBGA 5F3WA 2E1MA 4M30A 5TSEA 4F9CB 4DR6E 2EOIA 4LFCE 1UHZA 2L3JA 3J81C 2NUEA 1G2FC 4LF8E 4M0VA 3UK3C 5A69A 2LVHA 3OMLA 3ZOQB 1ZBQA 2EPPA 2I9IA 2B7VA 5IV8B 2NABA 2EQ0A 4M9VC 4OOGC 1TN9A 1N3GA 2M4IA 1A1FA 2DLQA 2ELZA 2EMLA 5AC4A 1SR9A 3K6QA 4DR5E 1WXRA 1BB8A 5LMNE 3L00A 4DV2E 4KHPE 4RH8A 1FKAE 2M7QA 2JPAA 2YTJA 2EN3A 5LLQA 2FTXB 1A1IA 1N33E 2B9DA 1GZ6A 2HC5A 4WX9A 2HJJA 4X64E 2EMGA 1T39A 2EOYA 2ENHA 3OTOE 1WJPA 1Z1BA 2EOHA 1DGCA 2EMFA 2DMIA 5KL2A 3KWRA 2EM5A 2EN4A 2FGGA 4WSGA 2EM6A 1BBOA 4ZYGA 5LL6R 2EPCA 2RSIA 4O24A 1T4LB 3JAMC 2EN2A 3MSWA 2EZ6A 2H36X 2CT1A 2B7TA 2VF1A 3BGHA 2GHFA 1TF3A 4BC9A 2L2KB 2NA2A 4JI3E 2YTNA 1YPNA 2ENCA 4WFTA 4M2ZA 3HPZA 2VQFE 4DR7E 1EH7A 1KYQA 2KHXA 4DV1E 1IMUA 2CPNA 4WYQB 1X6FA 1ZU1A 3F6GA 3VYYA 1WHQA 3P1XA
chains in the Genus database with same CATH topology
2LMZA 4DV4E 4DMIA 1J26A 2DMYA 3LMLA 4JI4E 2FV4B 4BS9A 2L6MA 2L8TA 4BBYA 1PKPA 4F54A 2UU9E 1UILA 2NUGA 5AASA 2V87A 2L3CA 3HTXA 4TUGA 4DV5E 2LJHA 2ODRC 2LE2A 3C4BA 4Q28A 2V85A 4LTYA 5CFFE 2VQEE 1I94E 1EKZA 4B3ME 3J7AG 4DKKA 2NUFA 2UUAE 4DV7E 2DB2A 4YY3E 3FIGA 2RSMA 4X62E 5F3WA 2E1MA 4M30A 4F9CB 2YT4A 3ADIA 3IWBA 4LFCE 4DR6E 2UXCE 1UHZA 5AE3A 2L3JA 3J81C 1X49A 2ODRD 2NUEA 2MC6A 4JI0E 3HQ1A 3T1YE 1O0WA 2DIXA 4M0VA 2JWOA 3DJWA 4LF8E 4DUZE 2HHHE 2YZTA 4DR1E 4OX9E 3OMLA 2L92A 3ZOQB 1RC7A 1ZBQA 3AUZA 2DSYA 1X47A 5ADZA 1YYOA 1X48A 2K4VA 2B7VA 4OOGC 2M1SA 4DV0E 1XMQE 1IBME 2B3TB 3F6HA 3ADJA 2M4IA 3H09A 3DF6A 4DV3E 4JI8E 5IWAE 5A2QC 3P1XA 2LTSA 3JU0A 3J7Yp 2ZM6E 1SR9A 3K6QA 2KONA 4DR5E 5FLXC 1WXRA 1IBKE 2UXDE 4JI2E 2V89A 2LUQA 5LMNE 1J5EE 4BC7A 4DV2E 4LF4E 4KHPE 3AV0A 4JI5E 4JI1E 4GKKE 1YYKA 4GKJE 1FKAE 2M7QA 4JV5E 2V86A 4WPYA 2LRSA 2F8BA 1STUA 4X66E 1N34E 1IBLE 2FTXB 4LFAE 3ADGA 2B9DA 1N33E 4DV6E 2L2MA 1GZ6A 3IWCA 2IHR1 2JY9A 4WSPA 4X8WA 5AE1A 1HNZE 1N32E 3HXLA 1XMOE 1HNWE 2L2NA 4J8ZA 2RS7A 2F4VE 4X64E 1GQEA 2UXBE 3VK6A 4F9AB 2N3GA 2LUPB 3OTOE 3ADLA 1QU6A 4R03A 2UUCE 4DR4E 4DR3E 1RQ0A 4LFBE 1YYWA 4LU9A 4LF5E 4NXNE 4KZSA 3IWDA 5AE2A 2JR1A 4BMJA 3VYXA 4F9BB 1HNXE 4P7DA 3J80C 3KWRA 1N36E 4LF9E 4B3RE 2G7HA 2KOUA 2FGGA 4K0KE 5BR8E 4DUYE 4LF6E 2N3HA 5LL6R 2JOBA 2V83A 2MC5A 4AQYE 1T4LB 1T4NA 2MDRA 4JI6E 5IT9C 4I8OA 3MSWA 4L5NC 3JAMC 1HR0E 1YZ9A 2WZOA 2E5LE 2H36X 1XNQE 3HPSA 2EZ6A 4JI7E 2B7TA 2VF1A 2JVAA 2UUBE 1XNRE 2JOXA 4B3TE 2RTXA 4P78A 2LBSB 5DNYA 4BC9A 2L2KB 2L33A 2NA2A 1DI2A 4B3SE 3T1HE 2V88A 4JI3E 4BCAA 4L8NA 1FJGE 1WHNA 2V8QB 4GEQB 3C4TA 2RS6A 4DR7E 4WFTA 4M2ZA 3HPZA 2VQFE 2EWLA 2VE7C 4LF7E 2KHXA 1T4OA 4NXME 1DQ3A 4R8OA 4DV1E 2CPNA 4WYQB 1ZBTA 3RMPA 4YHHE 5LMUE 2LTRA 3JTZA 4X65E 3LLHA 3VYYA 4TUIA 1WHQA 4JYAE 5T6JA 3F6GA 4DR2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 E;  1J26 A;  2DMY A;  4JI4 E;  3HTX A;  1PKP A;  2UU9 E;  2NUG A;  1UIL A;  2L3C A;  4DV5 E;  2LJH A;  3C4B A;  4B3M E;  1I94 E;  5CFF E;  2VQE E;  1EKZ A;  4DKK A;  2NUF A;  2UUA E;  4DV7 E;  2DB2 A;  4YY3 E;  2RSM A;  4X62 E;  4M30 A;  2YT4 A;  3ADI A;  4DR6 E;  4LFC E;  2UXC E;  1UHZ A;  2L3J A;  1X49 A;  2NUE A;  4JI0 E;  3T1Y E;  1O0W A;  2DIX A;  4LF8 E;  4DUZ E;  2HHH E;  4OX9 E;  4DR1 E;  1RC7 A;  1X47 A;  1YYO A;  1X48 A;  2B7V A;  4OOG C;  1XMQ E;  4DV0 E;  1IBM E;  1N32 E;  2B3T B;  3ADJ A;  4DV3 E;  4JI8 E;  5IWA E;  2LTS A;  3J7Y p;  2ZM6 E;  1IBK E;  4DR5 E;  2UXD E;  4JI2 E;  2LUQ A;  5LMN E;  1J5E E;  4LF4 E;  4DV2 E;  4KHP E;  4JI5 E;  4GKK E;  4JI1 E;  1YYK A;  4GKJ E;  1FKA E;  4JV5 E;  2LRS A;  4X66 E;  1STU A;  1N34 E;  1IBL E;  4LFA E;  3ADG A;  1N33 E;  4DV6 E;  2L2M A;  4X8W A;  2IHR 1;  2JY9 A;  1HNZ E;  1HNW E;  1XMO E;  2L2N A;  2RS7 A;  2F4V E;  4X64 E;  1GQE A;  2UXB E;  2N3G A;  2LUP B;  3OTO E;  3ADL A;  1QU6 A;  2UUC E;  4DR4 E;  4DR3 E;  1RQ0 A;  4LFB E;  1YYW A;  4LF5 E;  4NXN E;  3VYX A;  1HNX E;  1N36 E;  4LF9 E;  4B3R E;  4K0K E;  5BR8 E;  4DUY E;  4LF6 E;  2N3H A;  4AQY E;  1T4L B;  1T4N A;  2MDR A;  4JI6 E;  1HR0 E;  1YZ9 A;  2E5L E;  2EZ6 A;  1XNQ E;  4JI7 E;  2B7T A;  2JVA A;  2UUB E;  1XNR E;  4B3T E;  2RTX A;  2LBS B;  2L2K B;  2L33 A;  2NA2 A;  1DI2 A;  4B3S E;  3T1H E;  4JI3 E;  1FJG E;  1WHN A;  3C4T A;  2RS6 A;  4DR7 E;  4WFT A;  4M2Z A;  2VQF E;  4LF7 E;  2KHX A;  1T4O A;  4NXM E;  4DV1 E;  2CPN A;  4WYQ B;  1ZBT A;  4YHH E;  5LMU E;  2LTR A;  4X65 E;  3LLH A;  3VYY A;  1WHQ A;  4JYA E;  3P1X A;  4DR2 E; 
#chains in the Genus database with same CATH topology
 4IS1 C;  5AC5 A;  3EQ1 A;  2YRH A;  5A6B D;  2EMI A;  2YTD A;  4TUG A;  3C4B A;  5CFF E;  1EKZ A;  4NZV A;  5KL3 A;  4F6N A;  3MHS C;  4YY3 E;  1YFH A;  2RSM A;  2RPC A;  1AAY A;  5AE3 A;  2YTQ A;  2EQ3 A;  2MC6 A;  4NHR A;  2ELY A;  4DUZ E;  2EOF A;  4IJD A;  3AUZ A;  2EOJ A;  1X47 A;  4MLV A;  4FK5 C;  1YYO A;  1XMQ E;  1T38 A;  3F6H A;  3ADJ A;  4DV3 E;  2MKD A;  2ZM6 E;  1IBK E;  5FLX C;  1YSA C;  4JI2 E;  2YPN A;  4R2D A;  2EOQ A;  1J5E E;  4BC7 A;  4JI5 E;  3BBG A;  4GKJ E;  2EL5 A;  4JV5 E;  1P47 A;  2YRK A;  1IBL E;  2HGH A;  2YTG A;  3VHT B;  3ADG A;  4LFA E;  2EN6 A;  3IWC A;  2JY9 A;  3HXL A;  4J8Z A;  1A1G A;  1IQS A;  2BBG A;  2ADR A;  2N3G A;  4N4R B;  2JP9 A;  1ZR9 A;  2N8X A;  1X6E A;  4O5G A;  1SFE A;  1A1J A;  4LU9 A;  4NXN E;  1NCS A;  2YSP A;  2LV2 A;  3IWD A;  3M99 B;  2EOZ A;  4F9B B;  2LCE A;  2EM7 A;  2EPN A;  1N36 E;  4LF9 E;  4B3R E;  2KOU A;  2LO3 A;  4K0K E;  5BR8 E;  1MEY C;  2V83 A;  1T4N A;  2GLI A;  2UUB E;  2YWQ A;  1XNR E;  4B3T E;  2EMY A;  4GZN C;  2LBS B;  5DNY A;  4HTG A;  1PJQ A;  2EPU A;  2L33 A;  1DI2 A;  4F6M A;  3T1H E;  2V88 A;  4BCA A;  4L8N A;  3C6M A;  1WHN A;  2EWL A;  2VE7 C;  4LF7 E;  1DQ3 A;  1RMD A;  1ZBT A;  1MGT A;  2WCC 3;  1YUJ A;  2EJ4 A;  4HEI A;  3LLH A;  2EQ1 A;  4TUI A;  3C6K A;  1J26 A;  2EMZ A;  3LML A;  2A25 A;  2EMK A;  4R2S A;  2FV4 B;  4BBY A;  1UIL A;  3EPK A;  2CSH A;  5A6J A;  2L3C A;  2EPK X;  2Q8U A;  2LJH A;  2ODR C;  4Q28 A;  4R2C A;  4B3M E;  2VQE E;  1JK1 A;  3FIG A;  4X62 E;  4R2P A;  3ADI A;  3IWB A;  2UXC E;  1JK2 A;  4JI0 E;  3HQ1 A;  3T1Y E;  1O0W A;  2DIX A;  3KZY A;  2JWO A;  4OX9 E;  2HHH E;  2YZT A;  4DR1 E;  3EPH A;  1KJK A;  2GPI A;  2DSY A;  3THO B;  1UBD C;  1X48 A;  1IBM E;  2M1S A;  4DV0 E;  2B3T B;  4JI8 E;  5IWA E;  5A2Q C;  1X3C A;  2EE8 A;  2EMW A;  1GTK A;  1X5W A;  2LUQ A;  2V89 A;  4LF4 E;  3AV0 A;  5KL5 A;  4JI1 E;  2EMC A;  3EPJ A;  3BF2 A;  4WPY A;  2EL4 A;  2F8B A;  1STU A;  1N34 E;  2EPZ A;  1PJS A;  2J7J A;  2EM3 A;  2L2M A;  4WSP A;  2IHR 1;  5AE1 A;  1HNZ E;  1HNW E;  4ZYE A;  5KL6 A;  1XMO E;  2EPM X;  2L2N A;  2RS7 A;  4R2Q A;  2F4V E;  1GQE A;  4F9A B;  1UN6 B;  2YTP A;  2LUP B;  2PRT A;  3ECR A;  1QU6 A;  4R03 A;  4LFB E;  4LF5 E;  2LT7 A;  3VYX A;  1HNX E;  1LLM C;  4P7D A;  3J80 C;  2EPL X;  2EPX A;  4DUY E;  2EOX A;  2BB8 A;  2WBT A;  2YTI A;  4JI6 E;  5IT9 C;  1YZ9 A;  2ENA A;  4L5N C;  4X9J A;  2WZO A;  2E5L E;  1XNQ E;  3TQM A;  4JI7 E;  2JVA A;  2JOX A;  2JXP A;  2EM8 A;  4WXD A;  1YUI A;  2D9H A;  4B3S E;  1L4S A;  2V8Q B;  3C4T A;  2RS6 A;  2I13 A;  1PJT A;  2EN7 A;  2R1F A;  4NXM E;  4R8O A;  4Q35 B;  4YHH E;  5LMU E;  2LTR A;  1EH8 A;  4JYA E;  5T6J A;  4BHB A;  1B69 A;  2EOO A;  4DR2 E;  2E72 A;  2DMY A;  3BID A;  2DGC A;  2EMB A;  4JI4 E;  3THN A;  4BS9 A;  2L8T A;  3HTX A;  2UU9 E;  2V87 A;  2LE2 A;  2V85 A;  4LTY A;  1I94 E;  1PDA A;  4DKK A;  2NUF A;  2UUA E;  4ZYH A;  2EOE A;  5KL7 A;  4R2E A;  1X6H A;  4KWY A;  2YT4 A;  2M9A A;  1X49 A;  2ODR D;  2EM4 A;  2EPR A;  3DJW A;  2CTD A;  4MLQ A;  2L92 A;  1RC7 A;  4BHC A;  2YSO A;  5ADZ A;  2JYA A;  5KL4 A;  1A1L A;  2K4V A;  2YTE A;  4O43 A;  1N32 E;  3H09 A;  3QG5 C;  3DF6 A;  4R2R A;  1EH6 A;  2LTS A;  3JU0 A;  3J7Y p;  2YTF A;  2YTO A;  2KON A;  2UXD E;  2R76 A;  2EP3 A;  4GKK E;  1YYK A;  2V86 A;  2LRS A;  4X66 E;  4DV6 E;  4X8W A;  1QNT A;  2MKN A;  4O4K A;  2EOS A;  2UXB E;  2EOM A;  3VK6 A;  4ZYD A;  2EN8 A;  3MHH C;  3ADL A;  2EPA A;  5A6K A;  4WXC A;  2UUC E;  4DR4 E;  4DR3 E;  1RQ0 A;  1YYW A;  2MDG A;  2EPO A;  4KZS A;  1TF6 A;  5AE2 A;  2JR1 A;  4BMJ A;  1A1K A;  2G7H A;  4LF6 E;  2EMX A;  2N3H A;  2DLK A;  2JOB A;  2YRM A;  2K7I A;  2MC5 A;  4AQY E;  2MDR A;  1HR0 E;  4I8O A;  2EN1 A;  5A6A A;  3HPS A;  2EM0 A;  2WBS A;  2EM2 A;  3EPL A;  2VRD A;  1A1H A;  2RTX A;  4P78 A;  5A6B A;  2EMA A;  2EOR A;  2DRP A;  2LJU A;  4F2J C;  1FJG E;  2EM9 A;  4GEQ B;  1AH5 A;  1T4O A;  1ZAA C;  1NEI A;  2YU5 A;  2RQL A;  3RMP A;  3JTZ A;  4X65 E;  2EL6 A;  1IQO A;  2LMZ A;  1F2I G;  4DV4 E;  3KZZ A;  4DMI A;  1WRJ A;  2WBU A;  2L6M A;  4F54 A;  1PKP A;  2NUG A;  5AAS A;  4DV5 E;  2YU8 A;  3J7A G;  4R2A A;  4RHB B;  1G2D C;  2EMH A;  5IXM B;  4DV7 E;  2DB2 A;  1BBG A;  5F3W A;  2E1M A;  4M30 A;  5TSE A;  4F9C B;  4DR6 E;  2EOI A;  4LFC E;  1UHZ A;  2L3J A;  3J81 C;  2NUE A;  1G2F C;  4LF8 E;  4M0V A;  3UK3 C;  5A69 A;  2LVH A;  3OML A;  3ZOQ B;  1ZBQ A;  2EPP A;  2I9I A;  2B7V A;  5IV8 B;  2NAB A;  2EQ0 A;  4M9V C;  4OOG C;  1TN9 A;  1N3G A;  2M4I A;  1A1F A;  2DLQ A;  2ELZ A;  2EML A;  5AC4 A;  1SR9 A;  3K6Q A;  4DR5 E;  1WXR A;  1BB8 A;  5LMN E;  3L00 A;  4DV2 E;  4KHP E;  4RH8 A;  1FKA E;  2M7Q A;  2JPA A;  2YTJ A;  2EN3 A;  5LLQ A;  2FTX B;  1A1I A;  1N33 E;  2B9D A;  1GZ6 A;  2HC5 A;  4WX9 A;  2HJJ A;  4X64 E;  2EMG A;  1T39 A;  2EOY A;  2ENH A;  3OTO E;  1WJP A;  1Z1B A;  2EOH A;  1DGC A;  2EMF A;  2DMI A;  5KL2 A;  3KWR A;  2EM5 A;  2EN4 A;  2FGG A;  4WSG A;  2EM6 A;  1BBO A;  4ZYG A;  5LL6 R;  2EPC A;  2RSI A;  4O24 A;  1T4L B;  3JAM C;  2EN2 A;  3MSW A;  2EZ6 A;  2H36 X;  2CT1 A;  2B7T A;  2VF1 A;  3BGH A;  2GHF A;  1TF3 A;  4BC9 A;  2L2K B;  2NA2 A;  4JI3 E;  2YTN A;  1YPN A;  2ENC A;  4WFT A;  4M2Z A;  3HPZ A;  2VQF E;  4DR7 E;  1EH7 A;  1KYQ A;  2KHX A;  4DV1 E;  1IMU A;  2CPN A;  4WYQ B;  1X6F A;  1ZU1 A;  3F6G A;  3VYY A;  1WHQ A;  3P1X A; 
#chains in the Genus database with same CATH homology
 2LMZ A;  4DV4 E;  4DMI A;  1J26 A;  2DMY A;  3LML A;  4JI4 E;  2FV4 B;  4BS9 A;  2L6M A;  2L8T A;  4BBY A;  1PKP A;  4F54 A;  2UU9 E;  1UIL A;  2NUG A;  5AAS A;  2V87 A;  2L3C A;  3HTX A;  4TUG A;  4DV5 E;  2LJH A;  2ODR C;  2LE2 A;  3C4B A;  4Q28 A;  2V85 A;  4LTY A;  5CFF E;  2VQE E;  1I94 E;  1EKZ A;  4B3M E;  3J7A G;  4DKK A;  2NUF A;  2UUA E;  4DV7 E;  2DB2 A;  4YY3 E;  3FIG A;  2RSM A;  4X62 E;  5F3W A;  2E1M A;  4M30 A;  4F9C B;  2YT4 A;  3ADI A;  3IWB A;  4LFC E;  4DR6 E;  2UXC E;  1UHZ A;  5AE3 A;  2L3J A;  3J81 C;  1X49 A;  2ODR D;  2NUE A;  2MC6 A;  4JI0 E;  3HQ1 A;  3T1Y E;  1O0W A;  2DIX A;  4M0V A;  2JWO A;  3DJW A;  4LF8 E;  4DUZ E;  2HHH E;  2YZT A;  4DR1 E;  4OX9 E;  3OML A;  2L92 A;  3ZOQ B;  1RC7 A;  1ZBQ A;  3AUZ A;  2DSY A;  1X47 A;  5ADZ A;  1YYO A;  1X48 A;  2K4V A;  2B7V A;  4OOG C;  2M1S A;  4DV0 E;  1XMQ E;  1IBM E;  2B3T B;  3F6H A;  3ADJ A;  2M4I A;  3H09 A;  3DF6 A;  4DV3 E;  4JI8 E;  5IWA E;  5A2Q C;  3P1X A;  2LTS A;  3JU0 A;  3J7Y p;  2ZM6 E;  1SR9 A;  3K6Q A;  2KON A;  4DR5 E;  5FLX C;  1WXR A;  1IBK E;  2UXD E;  4JI2 E;  2V89 A;  2LUQ A;  5LMN E;  1J5E E;  4BC7 A;  4DV2 E;  4LF4 E;  4KHP E;  3AV0 A;  4JI5 E;  4JI1 E;  4GKK E;  1YYK A;  4GKJ E;  1FKA E;  2M7Q A;  4JV5 E;  2V86 A;  4WPY A;  2LRS A;  2F8B A;  1STU A;  4X66 E;  1N34 E;  1IBL E;  2FTX B;  4LFA E;  3ADG A;  2B9D A;  1N33 E;  4DV6 E;  2L2M A;  1GZ6 A;  3IWC A;  2IHR 1;  2JY9 A;  4WSP A;  4X8W A;  5AE1 A;  1HNZ E;  1N32 E;  3HXL A;  1XMO E;  1HNW E;  2L2N A;  4J8Z A;  2RS7 A;  2F4V E;  4X64 E;  1GQE A;  2UXB E;  3VK6 A;  4F9A B;  2N3G A;  2LUP B;  3OTO E;  3ADL A;  1QU6 A;  4R03 A;  2UUC E;  4DR4 E;  4DR3 E;  1RQ0 A;  4LFB E;  1YYW A;  4LU9 A;  4LF5 E;  4NXN E;  4KZS A;  3IWD A;  5AE2 A;  2JR1 A;  4BMJ A;  3VYX A;  4F9B B;  1HNX E;  4P7D A;  3J80 C;  3KWR A;  1N36 E;  4LF9 E;  4B3R E;  2G7H A;  2KOU A;  2FGG A;  4K0K E;  5BR8 E;  4DUY E;  4LF6 E;  2N3H A;  5LL6 R;  2JOB A;  2V83 A;  2MC5 A;  4AQY E;  1T4L B;  1T4N A;  2MDR A;  4JI6 E;  5IT9 C;  4I8O A;  3MSW A;  4L5N C;  3JAM C;  1HR0 E;  1YZ9 A;  2WZO A;  2E5L E;  2H36 X;  1XNQ E;  3HPS A;  2EZ6 A;  4JI7 E;  2B7T A;  2VF1 A;  2JVA A;  2UUB E;  1XNR E;  2JOX A;  4B3T E;  2RTX A;  4P78 A;  2LBS B;  5DNY A;  4BC9 A;  2L2K B;  2L33 A;  2NA2 A;  1DI2 A;  4B3S E;  3T1H E;  2V88 A;  4JI3 E;  4BCA A;  4L8N A;  1FJG E;  1WHN A;  2V8Q B;  4GEQ B;  3C4T A;  2RS6 A;  4DR7 E;  4WFT A;  4M2Z A;  3HPZ A;  2VQF E;  2EWL A;  2VE7 C;  4LF7 E;  2KHX A;  1T4O A;  4NXM E;  1DQ3 A;  4R8O A;  4DV1 E;  2CPN A;  4WYQ B;  1ZBT A;  3RMP A;  4YHH E;  5LMU E;  2LTR A;  3JTZ A;  4X65 E;  3LLH A;  3VYY A;  4TUI A;  1WHQ A;  4JYA E;  5T6J A;  3F6G A;  4DR2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...