4R2QA

Wilms tumor protein (wt1) zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2qA00
1A1LA 2NABA 2YU8A 3EPLA 2EOIA 2YSPA 3UK3C 2PRTA 2YTEA 2EM4A 2EM6A 2GHFA 2EQ1A 2EM3A 1P47A 2DRPA 1WJPA 1MEYC 2EE8A 2RSIA 4GZNC 1TF6A 1RMDA 2EMZA 2EOFA 2EL5A 4R2DA 2I13A 5KL6A 2YRHA 2EMAA 2EN6A 2YTIA 2EM5A 2EMXA 1UBDC 1AAYA 1A1KA 1X6FA 2YTJA 3EPJA 2DGCA 1X6EA 2EMKA 2EOJA 2EOXA 2EPAA 2J7JA 2EPRA 2LV2A 2ENAA 2EOSA 2CTDA 2EOEA 1BBOA 2MDGA 2EMBA 2EMCA 1JK1A 1DGCA 3MHSC 4WSGA 4R2QA 5KL5A 1A1HA 4F6NA 2A25A 2YTOA 1YSAC 2MKNA 2WBSA 1TF3A 2YSOA 4F6MA 2EOQA 2EN2A 2CT1A 2EPCA 2ENCA 2EOMA 4R2EA 4F2JC 1B69A 2EMWA 2EM8A 2EMGA 4R2SA 5KL7A 2EMYA 2YTFA 2EP3A 3EPHA 2EM7A 2YRKA 2EQ0A 2LCEA 2LT7A 2JPAA 2GLIA 2ENHA 1A1IA 1X5WA 4R2PA 1A1GA 2YRMA 3EPKA 2WBTA 1G2FC 2E72A 2WBUA 2BB8A 2EMIA 1F2IG 2LO3A 2EMHA 4IS1C 2EOZA 2EL4A 2EOOA 2M9AA 2YTNA 4IJDA 1A1FA 2LVHA 1YUJA 1YUIA 2DMIA 4X9JA 5KL4A 2HGHA 2RPCA 2EPUA 1JK2A 1A1JA 2YTDA 2R1FA 2YTQA 2MKDA 5KL2A 2DLKA 1TN9A 2JP9A 3MHHC 2EM9A 2EPZA 2EM0A 1X6HA 2EM2A 1BB8A 4R2RA 2YU5A 2ELYA 3M99B 4FK5C 2YTGA 2EORA 2EPXA 2D9HA 1ZR9A 1NCSA 4R2CA 2WCC3 2VRDA 2EJ4A 2ADRA 2CSHA 2EMFA 5KL3A 1UN6B 2EQ3A 2EN1A 1ZU1A 2EOHA 1G2DC 2EN8A 1ZAAC 4M9VC 2EPPA 1X3CA 2EN4A 1Z1BA 1KJKA 2EMLA 4R2AA 2DLQA 2EL6A 3VHTB 2ELZA 2EN7A 2EN3A 1LLMC 2EOYA 2YTPA
chains in the Genus database with same CATH superfamily
2NABA 2YU8A 4LF6E 4GKJE 2HJJA 2YSPA 2PRTA 2YTEA 2LUPB 2YT4A 1P47A 2L2MA 4BMJA 5AC4A 1N33E 4DV3E 4WYQB 3BIDA 1IMUA 4DV5E 1RMDA 2KONA 2DSYA 5KL6A 1L4SA 2F8BA 1YZ9A 2EM5A 4LF9E 2EPLX 2L6MA 1X6EA 2EOXA 4JI8E 2CTDA 4BHBA 2KHXA 5LLQA 4LF8E 4X66E 1J5EE 4OX9E 3VYXA 3BF2A 1EKZA 3JU0A 2YSOA 4F6MA 2JOXA 3J80C 2EOQA 2EN2A 3MSWA 5CFFE 2GPIA 2ENCA 4MLVA 2EMWA 2L8TA 4M2ZA 3EPHA 2EM7A 4L8NA 2VQEE 2GLIA 5A6KA 4R2PA 3EPKA 2WBTA 2E72A 2WBUA 2BB8A 1F2IG 2LO3A 3HQ1A 5T6JA 4DV6E 2EOOA 2YTNA 4B3ME 2LVHA 2DMIA 1SFEA 4B3SE 2HGHA 4X64E 2NUFA 3AUZA 4WFTA 2YTQA 1T4LB 3C4TA 4BHCA 2DLKA 1TN9A 1BBGA 2JP9A 1T4NA 2RS7A 1BB8A 2LUQA 2Q8UA 2ELYA 3M99B 2FGGA 4O4KA 4ZYDA 1X49A 4J8ZA 1N32E 2K7IA 2M1SA 2JR1A 5KL3A 4JI2E 2EN8A 5LMUE 2V8QB 2LJHA 1X3CA 2DLQA 2FTXB 4L5NC 4RHBB 4B3TE 4HEIA 1QNTA 1X48A 1A1KA 2EOYA 2YTPA 3T1YE 4OOGC 3EPLA 4Q28A 2L92A 3UK3C 2JXPA 2EM6A 2EQ1A 2EM3A 1WJPA 1MEYC 4F9BB 1EH6A 2LRSA 3TQMA 5A6JA 1WHNA 3THNA 3J81C 4BC9A 3DJWA 3VK6A 2EMXA 3FIGA 3C6KA 3EPJA 2EOJA 2EMKA 2EPRA 3ZOQB 1EH7A 3C4BA 1DI2A 1HNWE 5AC5A 2EMBA 1NEIA 2EMCA 1JK1A 2N8XA 2E5LE 4DUYE 3JTZA 3BGHA 4JI6E 2MKNA 2V86A 4LFBE 4GEQB 1TF3A 1KYQA 3KZZA 4DV1E 4N4RB 1IQOA 2G7HA 1ZBTA 1B69A 1GQEA 5KL7A 4BCAA 4DR3E 2EP3A 2UUBE 2EQ0A 1WRJA 2MDRA 5A6AA 1XNRE 2M4IA 4P7DA 1A1IA 4JI7E 4LF7E 3EQ1A 2EOZA 2EL4A 4IJDA 1BBOA 1YUIA 1PJQA 2EPUA 1WHQA 2L3CA 4NXME 1A1JA 2YTDA 2R1FA 1PKPA 2NUEA 2UXBE 5KL2A 3C6MA 2JOBA 2IHR1 2I9IA 2FV4B 2EM9A 1X6HA 2EM0A 2UUAE 5A6BD 3J7AG 4LU9A 4NHRA 2YZTA 3T1HE 1PDAA 2B7TA 4FK5C 2YTGA 2VRDA 2CSHA 2EOHA 1AH5A 2LTSA 1Z1BA 2EN4A 2EMLA 2ODRC 2EL6A 2ELZA 4JI5E 1GTKA 4LFCE 2UUCE 2EN7A 2EN3A 1LLMC 2RS6A 1T38A 4LF4E 4KHPE 3KZYA 3IWDA 4X8WA 5IWAE 2GHFA 1N34E 2DRPA 4TUIA 2L3JA 3LLHA 2RSIA 5IXMB 3ADGA 4GZNC 2V88A 1GZ6A 2EMZA 4DV2E 2N3GA 4R2DA 4DR6E 2EMAA 3H09A 2EN6A 2KOUA 4KZSA 2EPMX 1EH8A 1UBDC 1AAYA 1N3GA 1X6FA 1WXRA 3RMPA 4KWYA 2EPAA 4JI0E 2YWQA 4JI4E 1YYWA 4DUZE 4DV4E 2EOEA 2JWOA 4DV0E 1DGCA 3MHSC 4WSGA 4R2QA 3AV0A 4DR7E 4B3RE 2YTOA 1T39A 2B9DA 3ADIA 4LTYA 5AASA 4M0VA 1J26A 2LTRA 2CT1A 2EPCA 2EOMA 4R2EA 4AQYE 4F2JC 1FKAE 4NXNE 2EM8A 4F54A 2EMGA 3IWBA 4R2SA 2VQFE 3HTXA 2EMYA 3F6GA 4HTGA 3HPSA 2YRKA 2LCEA 2LT7A 3ADJA 2JPAA 3IWCA 1RQ0A 2HC5A 3OTOE 1X5WA 4LF5E 1G2FC 4P78A 1IBKE 4R03A 1T4OA 2EMIA 4YY3E 1PJSA 4IS1C 2E1MA 2F4VE 3K6QA 4RH8A 1A1FA 2NA2A 4NZVA 5KL4A 1I94E 4JV5E 2K4VA 1DQ3A 2EPNA 2HHHE 4X62E 1ZBQA 1HR0E 2VE7C 2MC5A 2EM2A 4R2RA 1YYKA 2YU5A 2N3HA 5AE2A 5DNYA 5A2QC 1YYOA 4R8OA 4X65E 4O43A 2LMZA 1IBLE 1QU6A 2EORA 4O5GA 3VYYA 1XMQE 1ZR9A 1NCSA 4I8OA 2ZM6E 4BBYA 2EJ4A 3HXLA 1UN6B 4ZYHA 1RC7A 2EN1A 1ZU1A 2RQLA 2UXDE 1ZAAC 5LL6R 3OMLA 2M7QA 3KWRA 5ADZA 2H36X 5A6BA 4R2AA 3J7Yp 4K0KE 3VHTB 2YPNA 4WXDA 4WX9A 4Q35B 2JY9A 2DMYA 4LFAE 2DB2A 1A1LA 5IV8B 2EOIA 3JAMC 4DV7E 2RSMA 2L2KB 2UU9E 3L00A 2EM4A 1FJGE 4DR2E 2EE8A 2VF1A 2JYAA 4WSPA 4DR4E 2EPOA 1TF6A 1SR9A 4BC7A 2EOFA 5TSEA 5FLXC 2EL5A 2I13A 3BBGA 2YRHA 2LE2A 4WXCA 2YTIA 2CPNA 1XNQE 5LMNE 1IQSA 2LBSB 4F9CB 2V89A 2YTJA 2NUGA 5AE3A 2DGCA 2JVAA 3HPZA 1YFHA 2J7JA 2LV2A 2ENAA 2EOSA 4JYAE 2B7VA 2EPKX 2MDGA 2ODRD 5BR8E 4DMIA 1STUA 5KL5A 3DF6A 4F6NA 1A1HA 2A25A 1YSAC 1PJTA 2V87A 2WBSA 1IBME 4JI3E 2L33A 5F3WA 2DIXA 2B3TB 1MGTA 2EWLA 2YTFA 2UXCE 3F6HA 1HNZE 4O24A 2V85A 2MC6A 2RTXA 4BS9A 5AE1A 2ENHA 2R76A 1A1GA 2YRMA 1UHZA 2EMHA 1UILA 2L2NA 2M9AA 4WPYA 1YUJA 3THOB 4X9JA 2RPCA 4GKKE 1JK2A 2MKDA 1O0WA 3P1XA 1YPNA 3MHHC 2EPZA 4M30A 4JI1E 3LMLA 2EPXA 4MLQA 4DKKA 4TUGA 5IT9C 2D9HA 1HNXE 4DR5E 4R2CA 2V83A 2WCC3 1N36E 2ADRA 3ADLA 2EMFA 3QG5C 2EQ3A 1G2DC 2WZOA 4ZYGA 3ECRA 1X47A 4DR1E 1XMOE 4ZYEA 5A69A 4M9VC 2EPPA 1KJKA 4YHHE 2EZ6A 2LJUA 2BBGA 4F9AB
chains in the Genus database with same CATH topology
1A1LA 2NABA 2YU8A 3EPLA 2EOIA 2YSPA 3UK3C 2PRTA 2YTEA 2EM4A 2EM6A 2GHFA 2EQ1A 2EM3A 1P47A 2DRPA 1WJPA 1MEYC 2EE8A 2RSIA 4GZNC 1TF6A 1RMDA 2EMZA 2EOFA 2EL5A 4R2DA 2I13A 5KL6A 2YRHA 2EMAA 2EN6A 2YTIA 2EM5A 2EMXA 1UBDC 1AAYA 1A1KA 1X6FA 2YTJA 3EPJA 2DGCA 1X6EA 2EMKA 2EOJA 2EOXA 2EPAA 2J7JA 2EPRA 2LV2A 2ENAA 2EOSA 2CTDA 2EOEA 1BBOA 2MDGA 2EMBA 2EMCA 1JK1A 1DGCA 3MHSC 4WSGA 4R2QA 5KL5A 1A1HA 4F6NA 2A25A 2YTOA 1YSAC 2MKNA 2WBSA 1TF3A 2YSOA 4F6MA 2EOQA 2EN2A 2CT1A 2EPCA 2ENCA 2EOMA 4R2EA 4F2JC 1B69A 2EMWA 2EM8A 2EMGA 4R2SA 5KL7A 2EMYA 2YTFA 2EP3A 3EPHA 2EM7A 2YRKA 2EQ0A 2LCEA 2LT7A 2JPAA 2GLIA 2ENHA 1A1IA 1X5WA 4R2PA 1A1GA 2YRMA 3EPKA 2WBTA 1G2FC 2E72A 2WBUA 2BB8A 2EMIA 1F2IG 2LO3A 2EMHA 4IS1C 2EOZA 2EL4A 2EOOA 2M9AA 2YTNA 4IJDA 1A1FA 2LVHA 1YUJA 1YUIA 2DMIA 4X9JA 5KL4A 2HGHA 2RPCA 2EPUA 1JK2A 1A1JA 2YTDA 2R1FA 2YTQA 2MKDA 5KL2A 2DLKA 1TN9A 2JP9A 3MHHC 2EM9A 2EPZA 2EM0A 1X6HA 2EM2A 1BB8A 4R2RA 2YU5A 2ELYA 3M99B 4FK5C 2YTGA 2EORA 2EPXA 2D9HA 1ZR9A 1NCSA 4R2CA 2WCC3 2VRDA 2EJ4A 2ADRA 2CSHA 2EMFA 5KL3A 1UN6B 2EQ3A 2EN1A 1ZU1A 2EOHA 1G2DC 2EN8A 1ZAAC 4M9VC 2EPPA 1X3CA 2EN4A 1Z1BA 1KJKA 2EMLA 4R2AA 2DLQA 2EL6A 3VHTB 2ELZA 2EN7A 2EN3A 1LLMC 2EOYA 2YTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1L A;  2NAB A;  2YU8 A;  3EPL A;  2EOI A;  2YSP A;  3UK3 C;  2PRT A;  2YTE A;  2EM4 A;  2EM6 A;  2GHF A;  2EQ1 A;  2EM3 A;  1P47 A;  2DRP A;  1WJP A;  1MEY C;  2EE8 A;  2RSI A;  4GZN C;  1TF6 A;  1RMD A;  2EMZ A;  2EOF A;  2EL5 A;  4R2D A;  2I13 A;  5KL6 A;  2YRH A;  2EMA A;  2EN6 A;  2YTI A;  2EM5 A;  2EMX A;  1UBD C;  1AAY A;  1A1K A;  1X6F A;  2YTJ A;  3EPJ A;  2DGC A;  1X6E A;  2EMK A;  2EOJ A;  2EOX A;  2EPA A;  2J7J A;  2EPR A;  2LV2 A;  2ENA A;  2EOS A;  2CTD A;  2EOE A;  1BBO A;  2MDG A;  2EMB A;  2EMC A;  1JK1 A;  1DGC A;  3MHS C;  4WSG A;  4R2Q A;  5KL5 A;  1A1H A;  4F6N A;  2A25 A;  2YTO A;  1YSA C;  2MKN A;  2WBS A;  1TF3 A;  2YSO A;  4F6M A;  2EOQ A;  2EN2 A;  2CT1 A;  2EPC A;  2ENC A;  2EOM A;  4R2E A;  4F2J C;  1B69 A;  2EMW A;  2EM8 A;  2EMG A;  4R2S A;  5KL7 A;  2EMY A;  2YTF A;  2EP3 A;  3EPH A;  2EM7 A;  2YRK A;  2EQ0 A;  2LCE A;  2LT7 A;  2JPA A;  2GLI A;  2ENH A;  1A1I A;  1X5W A;  4R2P A;  1A1G A;  2YRM A;  3EPK A;  2WBT A;  1G2F C;  2E72 A;  2WBU A;  2BB8 A;  2EMI A;  1F2I G;  2LO3 A;  2EMH A;  4IS1 C;  2EOZ A;  2EL4 A;  2EOO A;  2M9A A;  2YTN A;  4IJD A;  1A1F A;  2LVH A;  1YUJ A;  1YUI A;  2DMI A;  4X9J A;  5KL4 A;  2HGH A;  2RPC A;  2EPU A;  1JK2 A;  1A1J A;  2YTD A;  2R1F A;  2YTQ A;  2MKD A;  5KL2 A;  2DLK A;  1TN9 A;  2JP9 A;  3MHH C;  2EM9 A;  2EPZ A;  2EM0 A;  1X6H A;  2EM2 A;  1BB8 A;  4R2R A;  2YU5 A;  2ELY A;  3M99 B;  4FK5 C;  2YTG A;  2EOR A;  2EPX A;  2D9H A;  1ZR9 A;  1NCS A;  4R2C A;  2WCC 3;  2VRD A;  2EJ4 A;  2ADR A;  2CSH A;  2EMF A;  5KL3 A;  1UN6 B;  2EQ3 A;  2EN1 A;  1ZU1 A;  2EOH A;  1G2D C;  2EN8 A;  1ZAA C;  4M9V C;  2EPP A;  1X3C A;  2EN4 A;  1Z1B A;  1KJK A;  2EML A;  4R2A A;  2DLQ A;  2EL6 A;  3VHT B;  2ELZ A;  2EN7 A;  2EN3 A;  1LLM C;  2EOY A;  2YTP A; 
#chains in the Genus database with same CATH topology
 2NAB A;  2YU8 A;  4LF6 E;  4GKJ E;  2HJJ A;  2YSP A;  2PRT A;  2YTE A;  2LUP B;  2YT4 A;  1P47 A;  2L2M A;  4BMJ A;  5AC4 A;  1N33 E;  4DV3 E;  4WYQ B;  3BID A;  1IMU A;  4DV5 E;  1RMD A;  2KON A;  2DSY A;  5KL6 A;  1L4S A;  2F8B A;  1YZ9 A;  2EM5 A;  4LF9 E;  2EPL X;  2L6M A;  1X6E A;  2EOX A;  4JI8 E;  2CTD A;  4BHB A;  2KHX A;  5LLQ A;  4LF8 E;  4X66 E;  1J5E E;  4OX9 E;  3VYX A;  3BF2 A;  1EKZ A;  3JU0 A;  2YSO A;  4F6M A;  2JOX A;  3J80 C;  2EOQ A;  2EN2 A;  3MSW A;  5CFF E;  2GPI A;  2ENC A;  4MLV A;  2EMW A;  2L8T A;  4M2Z A;  3EPH A;  2EM7 A;  4L8N A;  2VQE E;  2GLI A;  5A6K A;  4R2P A;  3EPK A;  2WBT A;  2E72 A;  2WBU A;  2BB8 A;  1F2I G;  2LO3 A;  3HQ1 A;  5T6J A;  4DV6 E;  2EOO A;  2YTN A;  4B3M E;  2LVH A;  2DMI A;  1SFE A;  4B3S E;  2HGH A;  4X64 E;  2NUF A;  3AUZ A;  4WFT A;  2YTQ A;  1T4L B;  3C4T A;  4BHC A;  2DLK A;  1TN9 A;  1BBG A;  2JP9 A;  1T4N A;  2RS7 A;  1BB8 A;  2LUQ A;  2Q8U A;  2ELY A;  3M99 B;  2FGG A;  4O4K A;  4ZYD A;  1X49 A;  4J8Z A;  1N32 E;  2K7I A;  2M1S A;  2JR1 A;  5KL3 A;  4JI2 E;  2EN8 A;  5LMU E;  2V8Q B;  2LJH A;  1X3C A;  2DLQ A;  2FTX B;  4L5N C;  4RHB B;  4B3T E;  4HEI A;  1QNT A;  1X48 A;  1A1K A;  2EOY A;  2YTP A;  3T1Y E;  4OOG C;  3EPL A;  4Q28 A;  2L92 A;  3UK3 C;  2JXP A;  2EM6 A;  2EQ1 A;  2EM3 A;  1WJP A;  1MEY C;  4F9B B;  1EH6 A;  2LRS A;  3TQM A;  5A6J A;  1WHN A;  3THN A;  3J81 C;  4BC9 A;  3DJW A;  3VK6 A;  2EMX A;  3FIG A;  3C6K A;  3EPJ A;  2EOJ A;  2EMK A;  2EPR A;  3ZOQ B;  1EH7 A;  3C4B A;  1DI2 A;  1HNW E;  5AC5 A;  2EMB A;  1NEI A;  2EMC A;  1JK1 A;  2N8X A;  2E5L E;  4DUY E;  3JTZ A;  3BGH A;  4JI6 E;  2MKN A;  2V86 A;  4LFB E;  4GEQ B;  1TF3 A;  1KYQ A;  3KZZ A;  4DV1 E;  4N4R B;  1IQO A;  2G7H A;  1ZBT A;  1B69 A;  1GQE A;  5KL7 A;  4BCA A;  4DR3 E;  2EP3 A;  2UUB E;  2EQ0 A;  1WRJ A;  2MDR A;  5A6A A;  1XNR E;  2M4I A;  4P7D A;  1A1I A;  4JI7 E;  4LF7 E;  3EQ1 A;  2EOZ A;  2EL4 A;  4IJD A;  1BBO A;  1YUI A;  1PJQ A;  2EPU A;  1WHQ A;  2L3C A;  4NXM E;  1A1J A;  2YTD A;  2R1F A;  1PKP A;  2NUE A;  2UXB E;  5KL2 A;  3C6M A;  2JOB A;  2IHR 1;  2I9I A;  2FV4 B;  2EM9 A;  1X6H A;  2EM0 A;  2UUA E;  5A6B D;  3J7A G;  4LU9 A;  4NHR A;  2YZT A;  3T1H E;  1PDA A;  2B7T A;  4FK5 C;  2YTG A;  2VRD A;  2CSH A;  2EOH A;  1AH5 A;  2LTS A;  1Z1B A;  2EN4 A;  2EML A;  2ODR C;  2EL6 A;  2ELZ A;  4JI5 E;  1GTK A;  4LFC E;  2UUC E;  2EN7 A;  2EN3 A;  1LLM C;  2RS6 A;  1T38 A;  4LF4 E;  4KHP E;  3KZY A;  3IWD A;  4X8W A;  5IWA E;  2GHF A;  1N34 E;  2DRP A;  4TUI A;  2L3J A;  3LLH A;  2RSI A;  5IXM B;  3ADG A;  4GZN C;  2V88 A;  1GZ6 A;  2EMZ A;  4DV2 E;  2N3G A;  4R2D A;  4DR6 E;  2EMA A;  3H09 A;  2EN6 A;  2KOU A;  4KZS A;  2EPM X;  1EH8 A;  1UBD C;  1AAY A;  1N3G A;  1X6F A;  1WXR A;  3RMP A;  4KWY A;  2EPA A;  4JI0 E;  2YWQ A;  4JI4 E;  1YYW A;  4DUZ E;  4DV4 E;  2EOE A;  2JWO A;  4DV0 E;  1DGC A;  3MHS C;  4WSG A;  4R2Q A;  3AV0 A;  4DR7 E;  4B3R E;  2YTO A;  1T39 A;  2B9D A;  3ADI A;  4LTY A;  5AAS A;  4M0V A;  1J26 A;  2LTR A;  2CT1 A;  2EPC A;  2EOM A;  4R2E A;  4AQY E;  4F2J C;  1FKA E;  4NXN E;  2EM8 A;  4F54 A;  2EMG A;  3IWB A;  4R2S A;  2VQF E;  3HTX A;  2EMY A;  3F6G A;  4HTG A;  3HPS A;  2YRK A;  2LCE A;  2LT7 A;  3ADJ A;  2JPA A;  3IWC A;  1RQ0 A;  2HC5 A;  3OTO E;  1X5W A;  4LF5 E;  1G2F C;  4P78 A;  1IBK E;  4R03 A;  1T4O A;  2EMI A;  4YY3 E;  1PJS A;  4IS1 C;  2E1M A;  2F4V E;  3K6Q A;  4RH8 A;  1A1F A;  2NA2 A;  4NZV A;  5KL4 A;  1I94 E;  4JV5 E;  2K4V A;  1DQ3 A;  2EPN A;  2HHH E;  4X62 E;  1ZBQ A;  1HR0 E;  2VE7 C;  2MC5 A;  2EM2 A;  4R2R A;  1YYK A;  2YU5 A;  2N3H A;  5AE2 A;  5DNY A;  5A2Q C;  1YYO A;  4R8O A;  4X65 E;  4O43 A;  2LMZ A;  1IBL E;  1QU6 A;  2EOR A;  4O5G A;  3VYY A;  1XMQ E;  1ZR9 A;  1NCS A;  4I8O A;  2ZM6 E;  4BBY A;  2EJ4 A;  3HXL A;  1UN6 B;  4ZYH A;  1RC7 A;  2EN1 A;  1ZU1 A;  2RQL A;  2UXD E;  1ZAA C;  5LL6 R;  3OML A;  2M7Q A;  3KWR A;  5ADZ A;  2H36 X;  5A6B A;  4R2A A;  3J7Y p;  4K0K E;  3VHT B;  2YPN A;  4WXD A;  4WX9 A;  4Q35 B;  2JY9 A;  2DMY A;  4LFA E;  2DB2 A;  1A1L A;  5IV8 B;  2EOI A;  3JAM C;  4DV7 E;  2RSM A;  2L2K B;  2UU9 E;  3L00 A;  2EM4 A;  1FJG E;  4DR2 E;  2EE8 A;  2VF1 A;  2JYA A;  4WSP A;  4DR4 E;  2EPO A;  1TF6 A;  1SR9 A;  4BC7 A;  2EOF A;  5TSE A;  5FLX C;  2EL5 A;  2I13 A;  3BBG A;  2YRH A;  2LE2 A;  4WXC A;  2YTI A;  2CPN A;  1XNQ E;  5LMN E;  1IQS A;  2LBS B;  4F9C B;  2V89 A;  2YTJ A;  2NUG A;  5AE3 A;  2DGC A;  2JVA A;  3HPZ A;  1YFH A;  2J7J A;  2LV2 A;  2ENA A;  2EOS A;  4JYA E;  2B7V A;  2EPK X;  2MDG A;  2ODR D;  5BR8 E;  4DMI A;  1STU A;  5KL5 A;  3DF6 A;  4F6N A;  1A1H A;  2A25 A;  1YSA C;  1PJT A;  2V87 A;  2WBS A;  1IBM E;  4JI3 E;  2L33 A;  5F3W A;  2DIX A;  2B3T B;  1MGT A;  2EWL A;  2YTF A;  2UXC E;  3F6H A;  1HNZ E;  4O24 A;  2V85 A;  2MC6 A;  2RTX A;  4BS9 A;  5AE1 A;  2ENH A;  2R76 A;  1A1G A;  2YRM A;  1UHZ A;  2EMH A;  1UIL A;  2L2N A;  2M9A A;  4WPY A;  1YUJ A;  3THO B;  4X9J A;  2RPC A;  4GKK E;  1JK2 A;  2MKD A;  1O0W A;  3P1X A;  1YPN A;  3MHH C;  2EPZ A;  4M30 A;  4JI1 E;  3LML A;  2EPX A;  4MLQ A;  4DKK A;  4TUG A;  5IT9 C;  2D9H A;  1HNX E;  4DR5 E;  4R2C A;  2V83 A;  2WCC 3;  1N36 E;  2ADR A;  3ADL A;  2EMF A;  3QG5 C;  2EQ3 A;  1G2D C;  2WZO A;  4ZYG A;  3ECR A;  1X47 A;  4DR1 E;  1XMO E;  4ZYE A;  5A69 A;  4M9V C;  2EPP A;  1KJK A;  4YHH E;  2EZ6 A;  2LJU A;  2BBG A;  4F9A B; 
#chains in the Genus database with same CATH homology
 1A1L A;  2NAB A;  2YU8 A;  3EPL A;  2EOI A;  2YSP A;  3UK3 C;  2PRT A;  2YTE A;  2EM4 A;  2EM6 A;  2GHF A;  2EQ1 A;  2EM3 A;  1P47 A;  2DRP A;  1WJP A;  1MEY C;  2EE8 A;  2RSI A;  4GZN C;  1TF6 A;  1RMD A;  2EMZ A;  2EOF A;  2EL5 A;  4R2D A;  2I13 A;  5KL6 A;  2YRH A;  2EMA A;  2EN6 A;  2YTI A;  2EM5 A;  2EMX A;  1UBD C;  1AAY A;  1A1K A;  1X6F A;  2YTJ A;  3EPJ A;  2DGC A;  1X6E A;  2EMK A;  2EOJ A;  2EOX A;  2EPA A;  2J7J A;  2EPR A;  2LV2 A;  2ENA A;  2EOS A;  2CTD A;  2EOE A;  1BBO A;  2MDG A;  2EMB A;  2EMC A;  1JK1 A;  1DGC A;  3MHS C;  4WSG A;  4R2Q A;  5KL5 A;  1A1H A;  4F6N A;  2A25 A;  2YTO A;  1YSA C;  2MKN A;  2WBS A;  1TF3 A;  2YSO A;  4F6M A;  2EOQ A;  2EN2 A;  2CT1 A;  2EPC A;  2ENC A;  2EOM A;  4R2E A;  4F2J C;  1B69 A;  2EMW A;  2EM8 A;  2EMG A;  4R2S A;  5KL7 A;  2EMY A;  2YTF A;  2EP3 A;  3EPH A;  2EM7 A;  2YRK A;  2EQ0 A;  2LCE A;  2LT7 A;  2JPA A;  2GLI A;  2ENH A;  1A1I A;  1X5W A;  4R2P A;  1A1G A;  2YRM A;  3EPK A;  2WBT A;  1G2F C;  2E72 A;  2WBU A;  2BB8 A;  2EMI A;  1F2I G;  2LO3 A;  2EMH A;  4IS1 C;  2EOZ A;  2EL4 A;  2EOO A;  2M9A A;  2YTN A;  4IJD A;  1A1F A;  2LVH A;  1YUJ A;  1YUI A;  2DMI A;  4X9J A;  5KL4 A;  2HGH A;  2RPC A;  2EPU A;  1JK2 A;  1A1J A;  2YTD A;  2R1F A;  2YTQ A;  2MKD A;  5KL2 A;  2DLK A;  1TN9 A;  2JP9 A;  3MHH C;  2EM9 A;  2EPZ A;  2EM0 A;  1X6H A;  2EM2 A;  1BB8 A;  4R2R A;  2YU5 A;  2ELY A;  3M99 B;  4FK5 C;  2YTG A;  2EOR A;  2EPX A;  2D9H A;  1ZR9 A;  1NCS A;  4R2C A;  2WCC 3;  2VRD A;  2EJ4 A;  2ADR A;  2CSH A;  2EMF A;  5KL3 A;  1UN6 B;  2EQ3 A;  2EN1 A;  1ZU1 A;  2EOH A;  1G2D C;  2EN8 A;  1ZAA C;  4M9V C;  2EPP A;  1X3C A;  2EN4 A;  1Z1B A;  1KJK A;  2EML A;  4R2A A;  2DLQ A;  2EL6 A;  3VHT B;  2ELZ A;  2EN7 A;  2EN3 A;  1LLM C;  2EOY A;  2YTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...