4R2QA

Wilms tumor protein (wt1) zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
b'SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2qA00
2HGHA 2YTOA 4R2AA 1YSAC 1KJKA 2EM7A 2D9HA 3VHTB 2ENHA 2EPRA 2J7JA 2ENCA 2EOMA 2EL6A 2GLIA 2EMCA 2MKDA 4WSGA 2BB8A 2ADRA 4FK5C 2EQ3A 2EMBA 2DLKA 2EMWA 2EN3A 2YTIA 1X6HA 2DLQA 1UN6B 3EPKA 4R2EA 2VRDA 2R1FA 2DMIA 2EM4A 3M99B 1MEYC 1P47A 2YTGA 2EORA 5KL3A 2EE8A 1JK2A 3EPHA 2ENAA 4R2SA 2LCEA 1ZR9A 2EM2A 5KL2A 2EL4A 4F2JC 1Z1BA 1UBDC 2ELYA 2GHFA 1NCSA 1TF6A 2EMKA 4GZNC 2MDGA 2EMZA 2EOYA 1G2FC 2EPXA 1WJPA 1TN9A 2YRKA 2EPZA 1X5WA 1DGCA 2YTQA 2YRMA 4R2DA 2MKNA 1A1KA 2EOJA 5KL6A 2EMIA 1X3CA 1A1GA 4R2PA 1ZAAC 2EN4A 2EMHA 4R2QA 4IJDA 1LLMC 1JK1A 2EQ0A 2EQ1A 2ELZA 2DGCA 2EM3A 1B69A 2M9AA 2EPAA 2EM6A 5KL5A 2YSOA 1F2IG 2EOQA 2WBSA 2PRTA 2YTPA 2EOOA 2RSIA 1G2DC 1A1LA 2EN8A 2EL5A 2E72A 2WBTA 2WCC3 2EN2A 1A1FA 1X6FA 2EMLA 2JPAA 2YTJA 2LT7A 1A1JA 1YUJA 1BB8A 2LVHA 2EN7A 2EM0A 3MHSC 1A1IA 2EM8A 4IS1C 2EMGA 2YTDA 4F6NA 2EPCA 2YU5A 2CSHA 2YTNA 2EOHA 5KL4A 5KL7A 3EPJA 2YSPA 1BBOA 2EM5A 2EOIA 4M9VC 1RMDA 2EOSA 2YRHA 1ZU1A 2EOZA 2EMXA 2YTFA 2EP3A 2EPPA 2EOEA 2EMYA 4F6MA 2DRPA 3UK3C 1A1HA 2EN1A 1AAYA 2EPUA 2WBUA 2EOXA 2JP9A 2YTEA 1YUIA 2EOFA 2YU8A 1TF3A 2RPCA 4R2CA 2A25A 2EM9A 2LV2A 2EJ4A 2NABA 2EMFA 1X6EA 2EMAA 2EN6A 2CTDA 3EPLA 2LO3A 3MHHC 4X9JA 4R2RA 2CT1A 2I13A
chains in the Genus database with same CATH superfamily
2YTOA 4F9AB 1IBLE 2EM7A 3VHTB 2EPRA 2RS6A 2EZ6A 2GLIA 1HNZE 4BHBA 4OX9E 5IXMB 2ODRD 3AUZA 4HTGA 2H36X 5LMNE 2EMWA 3ADLA 2DLQA 2LUPB 3EPKA 3M99B 4X66E 2YTGA 2V8QB 2EE8A 3EPHA 4R2SA 2LCEA 3T1HE 1QNTA 4GEQB 1TF6A 2EMKA 2V89A 4DV7E 2EMZA 4LF5E 4DV1E 2EPXA 1WJPA 1TN9A 4LFCE 1X5WA 4JI2E 4O43A 2V87A 2JY9A 1A1KA 2K4VA 5ADZA 4R2PA 4IJDA 4X8WA 5AASA 3HTXA 1N3GA 2JR1A 2UUCE 1HNWE 4DKKA 1KYQA 3IWCA 4O24A 4X62E 3DJWA 4Q28A 1XNQE 5LMUE 2EPLX 3F6GA 2YT4A 2VE7C 1G2DC 4R03A 3P1XA 2NUEA 2EL5A 2E72A 2EN2A 4WX9A 2F4VE 3ADIA 3EQ1A 2M7QA 2JPAA 3BF2A 2L2NA 4L5NC 2EN7A 4LU9A 4WFTA 4WYQB 1PJTA 1A1IA 1MGTA 4IS1C 2EMGA 2YTDA 2FGGA 2B9DA 1GQEA 2EOHA 4BMJA 1T38A 4JI6E 2EPNA 1BBOA 1RMDA 1T4LB 4B3ME 4RHBB 4GKJE 3F6HA 2EPPA 3MSWA 2EMYA 3FIGA 3C6KA 2EOXA 3ADJA 1XMOE 2YU8A 4HEIA 5A6BA 4JI0E 4R2CA 5A6AA 4JI7E 3BIDA 4BS9A 2EMFA 2N3HA 2L3JA 2EMAA 2KHXA 2L92A 2EN6A 1AH5A 2BBGA 2LO3A 1A1HA 1A1FA 3HPZA 2LT7A 2I13A 1J26A 2N8XA 4P7DA 1N32E 4BBYA 1N36E 4Q35B 1X48A 4MLVA 2EOMA 2EL6A 4WSGA 2BB8A 1T39A 4YY3E 2YZTA 4FK5C 2L2MA 2UUBE 4DR7E 1EH8A 2EMBA 2EPKX 3THOB 1X6HA 5A6BD 2L2KB 1UN6B 4R2EA 2VRDA 4BC7A 2DB2A 2M1SA 5KL3A 3KZYA 3J81C 1DI2A 1UBDC 4B3TE 1X49A 4TUIA 1PKPA 3LMLA 4GZNC 2Q8UA 1XNRE 1ZBQA 4J8ZA 3RMPA 1UILA 4F9CB 2WZOA 5KL6A 4LF8E 2FV4B 2EPOA 4R2QA 5LLQA 4LFBE 4B3SE 4NXME 2ELZA 3OMLA 2NUGA 3BGHA 2DGCA 2EM3A 2EPAA 2EM6A 1IMUA 3C4TA 1F2IG 2WBSA 2PRTA 1PJQA 4M2ZA 4RH8A 5FLXC 4JI8E 3VK6A 2E1MA 4B3RE 1BB8A 1WRJA 5F3WA 5A69A 1T4OA 2V85A 1YYOA 2EPCA 5KL7A 2HJJA 4M0VA 3J7AG 2JOXA 2EM5A 2EOSA 2YRHA 1O0WA 4TUGA 4DV5E 2KONA 2KOUA 2EOEA 2CPNA 2EPMX 2WBUA 5IV8B 2JP9A 2I9IA 2NABA 4DR5E 4NXNE 3JTZA 5IWAE 2VF1A 3DF6A 4O4KA 3TQMA 1NEIA 2UXCE 3EPLA 4GKKE 2B3TB 4X9JA 2LTRA 2HGHA 2LUQA 5BR8E 1STUA 4DR6E 1YSAC 1IQOA 1KJKA 4KHPE 2D9HA 1T4NA 4X65E 2DIXA 3VYXA 1SR9A 2ENHA 2J7JA 2ENCA 4KWYA 2EMCA 2MKDA 3J7Yp 1IBKE 2ADRA 4JYAE 1IQSA 1BBGA 3T1YE 2DLKA 2EN3A 2YTIA 2L33A 3BBGA 3C4BA 2R1FA 1N34E 2EM4A 1MEYC 1P47A 4WPYA 1JK2A 2ENAA 1RC7A 1ZR9A 2EM2A 2G7HA 2EL4A 3HXLA 4I8OA 4F2JC 1Z1BA 2ELYA 2DSYA 4LF9E 1NCSA 2MDGA 4LF7E 2MC6A 2YRKA 2EPZA 4DUYE 3HQ1A 2L3CA 4R2DA 4DV4E 1WHNA 1N33E 3OTOE 4AQYE 2EN4A 2RTXA 5AC4A 5LL6R 1LLMC 1JK1A 5DNYA 1QU6A 2UU9E 3ECRA 4BC9A 2M9AA 5AC5A 3ZOQB 2EOQA 3JU0A 3KZZA 5AE1A 4BCAA 3IWBA 3JAMC 2YTPA 2EOOA 4JV5E 2RSIA 4LF6E 1YZ9A 2EN8A 2WBTA 2UUAE 3LLHA 4BHCA 1X6FA 2EMLA 5AE2A 2YTJA 5IT9C 2RSMA 1A1JA 4DV6E 1YUJA 2LVHA 5A6KA 4ZYEA 2F8BA 4JI4E 2EM8A 4WXDA 2B7VA 4F6NA 4JI5E 2ZM6E 2YPNA 2ODRC 2N3GA 4F9BB 2UXBE 2YSPA 4ZYDA 1GZ6A 2EOIA 4M9VC 2JWOA 4F54A 1ZU1A 1EH7A 4YHHE 2L6MA 2LMZA 2YTFA 1YYWA 4DR3E 4X64E 2V88A 4F6MA 3UK3C 4DR4E 1UHZA 1AAYA 4K0KE 1YUIA 1ZBTA 4DV2E 1TF3A 1GTKA 2YWQA 2VQEE 2NUFA 2RPCA 5TSEA 4DMIA 2EM9A 3ADGA 2LBSB 1WHQA 2JOBA 1L4SA 1X6EA 1EH6A 1RQ0A 2CTDA 4R2RA 3C6MA 1HR0E 2MC5A 5CFFE 4O5GA 2K7IA 2LJUA 4R2AA 4LF4E 2B7TA 4ZYGA 3J80C 4R8OA 2M4IA 2EQ3A 4WSPA 2MDRA 1I94E 1SFEA 4JI3E 4LFAE 2JVAA 2NA2A 1YYKA 4LTYA 5A2QC 3H09A 2DMIA 2JYAA 2EORA 2HHHE 3VYYA 4DUZE 5KL2A 2GHFA 2LE2A 2EOYA 1G2FC 1DGCA 2YTQA 4NHRA 2L8TA 2YRMA 1FKAE 2MKNA 4NZVA 2EOJA 2EMIA 1X3CA 1A1GA 1XMQE 1ZAAC 4MLQA 2EMHA 3K6QA 4ZYHA 2EQ0A 2EQ1A 1YFHA 4JI1E 4DV3E 1B69A 5KL5A 2YSOA 4DV0E 2IHR1 4P78A 1EKZA 1A1LA 2DMYA 2GPIA 2LRSA 2RS7A 2WCC3 2LJHA 4DR2E 3HPSA 4WXCA 1X47A 5T6JA 2EM0A 2V83A 2R76A 3MHSC 1DQ3A 2JXPA 3THNA 2V86A 2YU5A 3AV0A 5AE3A 1PJSA 2CSHA 2YTNA 3IWDA 5KL4A 3EPJA 3L00A 1FJGE 3KWRA 2EOZA 2EMXA 2HC5A 2EP3A 4N4RB 2VQFE 2UXDE 1HNXE 2EWLA 2DRPA 5A6JA 2EN1A 2E5LE 2EPUA 2YTEA 2EOFA 2A25A 4DR1E 1WXRA 4KZSA 2LV2A 2EJ4A 2RQLA 1J5EE 1YPNA 4M30A 4L8NA 2LTSA 1PDAA 3QG5C 3MHHC 4OOGC 1IBME 2FTXB 2CT1A
chains in the Genus database with same CATH topology
2HGHA 2YTOA 4R2AA 1YSAC 1KJKA 2EM7A 2D9HA 3VHTB 2ENHA 2EPRA 2J7JA 2ENCA 2EOMA 2EL6A 2GLIA 2EMCA 2MKDA 4WSGA 2BB8A 2ADRA 4FK5C 2EQ3A 2EMBA 2DLKA 2EMWA 2EN3A 2YTIA 1X6HA 2DLQA 1UN6B 3EPKA 4R2EA 2VRDA 2R1FA 2DMIA 2EM4A 3M99B 1MEYC 1P47A 2YTGA 2EORA 5KL3A 2EE8A 1JK2A 3EPHA 2ENAA 4R2SA 2LCEA 1ZR9A 2EM2A 5KL2A 2EL4A 4F2JC 1Z1BA 1UBDC 2ELYA 2GHFA 1NCSA 1TF6A 2EMKA 4GZNC 2MDGA 2EMZA 2EOYA 1G2FC 2EPXA 1WJPA 1TN9A 2YRKA 2EPZA 1X5WA 1DGCA 2YTQA 2YRMA 4R2DA 2MKNA 1A1KA 2EOJA 5KL6A 2EMIA 1X3CA 1A1GA 4R2PA 1ZAAC 2EN4A 2EMHA 4R2QA 4IJDA 1LLMC 1JK1A 2EQ0A 2EQ1A 2ELZA 2DGCA 2EM3A 1B69A 2M9AA 2EPAA 2EM6A 5KL5A 2YSOA 1F2IG 2EOQA 2WBSA 2PRTA 2YTPA 2EOOA 2RSIA 1G2DC 1A1LA 2EN8A 2EL5A 2E72A 2WBTA 2WCC3 2EN2A 1A1FA 1X6FA 2EMLA 2JPAA 2YTJA 2LT7A 1A1JA 1YUJA 1BB8A 2LVHA 2EN7A 2EM0A 3MHSC 1A1IA 2EM8A 4IS1C 2EMGA 2YTDA 4F6NA 2EPCA 2YU5A 2CSHA 2YTNA 2EOHA 5KL4A 5KL7A 3EPJA 2YSPA 1BBOA 2EM5A 2EOIA 4M9VC 1RMDA 2EOSA 2YRHA 1ZU1A 2EOZA 2EMXA 2YTFA 2EP3A 2EPPA 2EOEA 2EMYA 4F6MA 2DRPA 3UK3C 1A1HA 2EN1A 1AAYA 2EPUA 2WBUA 2EOXA 2JP9A 2YTEA 1YUIA 2EOFA 2YU8A 1TF3A 2RPCA 4R2CA 2A25A 2EM9A 2LV2A 2EJ4A 2NABA 2EMFA 1X6EA 2EMAA 2EN6A 2CTDA 3EPLA 2LO3A 3MHHC 4X9JA 4R2RA 2CT1A 2I13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HGH A;  2YTO A;  4R2A A;  1YSA C;  1KJK A;  2EM7 A;  2D9H A;  3VHT B;  2ENH A;  2EPR A;  2J7J A;  2ENC A;  2EOM A;  2EL6 A;  2GLI A;  2EMC A;  2MKD A;  4WSG A;  2BB8 A;  2ADR A;  4FK5 C;  2EQ3 A;  2EMB A;  2DLK A;  2EMW A;  2EN3 A;  2YTI A;  1X6H A;  2DLQ A;  1UN6 B;  3EPK A;  4R2E A;  2VRD A;  2R1F A;  2DMI A;  2EM4 A;  3M99 B;  1MEY C;  1P47 A;  2YTG A;  2EOR A;  5KL3 A;  2EE8 A;  1JK2 A;  3EPH A;  2ENA A;  4R2S A;  2LCE A;  1ZR9 A;  2EM2 A;  5KL2 A;  2EL4 A;  4F2J C;  1Z1B A;  1UBD C;  2ELY A;  2GHF A;  1NCS A;  1TF6 A;  2EMK A;  4GZN C;  2MDG A;  2EMZ A;  2EOY A;  1G2F C;  2EPX A;  1WJP A;  1TN9 A;  2YRK A;  2EPZ A;  1X5W A;  1DGC A;  2YTQ A;  2YRM A;  4R2D A;  2MKN A;  1A1K A;  2EOJ A;  5KL6 A;  2EMI A;  1X3C A;  1A1G A;  4R2P A;  1ZAA C;  2EN4 A;  2EMH A;  4R2Q A;  4IJD A;  1LLM C;  1JK1 A;  2EQ0 A;  2EQ1 A;  2ELZ A;  2DGC A;  2EM3 A;  1B69 A;  2M9A A;  2EPA A;  2EM6 A;  5KL5 A;  2YSO A;  1F2I G;  2EOQ A;  2WBS A;  2PRT A;  2YTP A;  2EOO A;  2RSI A;  1G2D C;  1A1L A;  2EN8 A;  2EL5 A;  2E72 A;  2WBT A;  2WCC 3;  2EN2 A;  1A1F A;  1X6F A;  2EML A;  2JPA A;  2YTJ A;  2LT7 A;  1A1J A;  1YUJ A;  1BB8 A;  2LVH A;  2EN7 A;  2EM0 A;  3MHS C;  1A1I A;  2EM8 A;  4IS1 C;  2EMG A;  2YTD A;  4F6N A;  2EPC A;  2YU5 A;  2CSH A;  2YTN A;  2EOH A;  5KL4 A;  5KL7 A;  3EPJ A;  2YSP A;  1BBO A;  2EM5 A;  2EOI A;  4M9V C;  1RMD A;  2EOS A;  2YRH A;  1ZU1 A;  2EOZ A;  2EMX A;  2YTF A;  2EP3 A;  2EPP A;  2EOE A;  2EMY A;  4F6M A;  2DRP A;  3UK3 C;  1A1H A;  2EN1 A;  1AAY A;  2EPU A;  2WBU A;  2EOX A;  2JP9 A;  2YTE A;  1YUI A;  2EOF A;  2YU8 A;  1TF3 A;  2RPC A;  4R2C A;  2A25 A;  2EM9 A;  2LV2 A;  2EJ4 A;  2NAB A;  2EMF A;  1X6E A;  2EMA A;  2EN6 A;  2CTD A;  3EPL A;  2LO3 A;  3MHH C;  4X9J A;  4R2R A;  2CT1 A;  2I13 A; 
#chains in the Genus database with same CATH topology
 2YTO A;  4F9A B;  1IBL E;  2EM7 A;  3VHT B;  2EPR A;  2RS6 A;  2EZ6 A;  2GLI A;  1HNZ E;  4BHB A;  4OX9 E;  5IXM B;  2ODR D;  3AUZ A;  4HTG A;  2H36 X;  5LMN E;  2EMW A;  3ADL A;  2DLQ A;  2LUP B;  3EPK A;  3M99 B;  4X66 E;  2YTG A;  2V8Q B;  2EE8 A;  3EPH A;  4R2S A;  2LCE A;  3T1H E;  1QNT A;  4GEQ B;  1TF6 A;  2EMK A;  2V89 A;  4DV7 E;  2EMZ A;  4LF5 E;  4DV1 E;  2EPX A;  1WJP A;  1TN9 A;  4LFC E;  1X5W A;  4JI2 E;  4O43 A;  2V87 A;  2JY9 A;  1A1K A;  2K4V A;  5ADZ A;  4R2P A;  4IJD A;  4X8W A;  5AAS A;  3HTX A;  1N3G A;  2JR1 A;  2UUC E;  1HNW E;  4DKK A;  1KYQ A;  3IWC A;  4O24 A;  4X62 E;  3DJW A;  4Q28 A;  1XNQ E;  5LMU E;  2EPL X;  3F6G A;  2YT4 A;  2VE7 C;  1G2D C;  4R03 A;  3P1X A;  2NUE A;  2EL5 A;  2E72 A;  2EN2 A;  4WX9 A;  2F4V E;  3ADI A;  3EQ1 A;  2M7Q A;  2JPA A;  3BF2 A;  2L2N A;  4L5N C;  2EN7 A;  4LU9 A;  4WFT A;  4WYQ B;  1PJT A;  1A1I A;  1MGT A;  4IS1 C;  2EMG A;  2YTD A;  2FGG A;  2B9D A;  1GQE A;  2EOH A;  4BMJ A;  1T38 A;  4JI6 E;  2EPN A;  1BBO A;  1RMD A;  1T4L B;  4B3M E;  4RHB B;  4GKJ E;  3F6H A;  2EPP A;  3MSW A;  2EMY A;  3FIG A;  3C6K A;  2EOX A;  3ADJ A;  1XMO E;  2YU8 A;  4HEI A;  5A6B A;  4JI0 E;  4R2C A;  5A6A A;  4JI7 E;  3BID A;  4BS9 A;  2EMF A;  2N3H A;  2L3J A;  2EMA A;  2KHX A;  2L92 A;  2EN6 A;  1AH5 A;  2BBG A;  2LO3 A;  1A1H A;  1A1F A;  3HPZ A;  2LT7 A;  2I13 A;  1J26 A;  2N8X A;  4P7D A;  1N32 E;  4BBY A;  1N36 E;  4Q35 B;  1X48 A;  4MLV A;  2EOM A;  2EL6 A;  4WSG A;  2BB8 A;  1T39 A;  4YY3 E;  2YZT A;  4FK5 C;  2L2M A;  2UUB E;  4DR7 E;  1EH8 A;  2EMB A;  2EPK X;  3THO B;  1X6H A;  5A6B D;  2L2K B;  1UN6 B;  4R2E A;  2VRD A;  4BC7 A;  2DB2 A;  2M1S A;  5KL3 A;  3KZY A;  3J81 C;  1DI2 A;  1UBD C;  4B3T E;  1X49 A;  4TUI A;  1PKP A;  3LML A;  4GZN C;  2Q8U A;  1XNR E;  1ZBQ A;  4J8Z A;  3RMP A;  1UIL A;  4F9C B;  2WZO A;  5KL6 A;  4LF8 E;  2FV4 B;  2EPO A;  4R2Q A;  5LLQ A;  4LFB E;  4B3S E;  4NXM E;  2ELZ A;  3OML A;  2NUG A;  3BGH A;  2DGC A;  2EM3 A;  2EPA A;  2EM6 A;  1IMU A;  3C4T A;  1F2I G;  2WBS A;  2PRT A;  1PJQ A;  4M2Z A;  4RH8 A;  5FLX C;  4JI8 E;  3VK6 A;  2E1M A;  4B3R E;  1BB8 A;  1WRJ A;  5F3W A;  5A69 A;  1T4O A;  2V85 A;  1YYO A;  2EPC A;  5KL7 A;  2HJJ A;  4M0V A;  3J7A G;  2JOX A;  2EM5 A;  2EOS A;  2YRH A;  1O0W A;  4TUG A;  4DV5 E;  2KON A;  2KOU A;  2EOE A;  2CPN A;  2EPM X;  2WBU A;  5IV8 B;  2JP9 A;  2I9I A;  2NAB A;  4DR5 E;  4NXN E;  3JTZ A;  5IWA E;  2VF1 A;  3DF6 A;  4O4K A;  3TQM A;  1NEI A;  2UXC E;  3EPL A;  4GKK E;  2B3T B;  4X9J A;  2LTR A;  2HGH A;  2LUQ A;  5BR8 E;  1STU A;  4DR6 E;  1YSA C;  1IQO A;  1KJK A;  4KHP E;  2D9H A;  1T4N A;  4X65 E;  2DIX A;  3VYX A;  1SR9 A;  2ENH A;  2J7J A;  2ENC A;  4KWY A;  2EMC A;  2MKD A;  3J7Y p;  1IBK E;  2ADR A;  4JYA E;  1IQS A;  1BBG A;  3T1Y E;  2DLK A;  2EN3 A;  2YTI A;  2L33 A;  3BBG A;  3C4B A;  2R1F A;  1N34 E;  2EM4 A;  1MEY C;  1P47 A;  4WPY A;  1JK2 A;  2ENA A;  1RC7 A;  1ZR9 A;  2EM2 A;  2G7H A;  2EL4 A;  3HXL A;  4I8O A;  4F2J C;  1Z1B A;  2ELY A;  2DSY A;  4LF9 E;  1NCS A;  2MDG A;  4LF7 E;  2MC6 A;  2YRK A;  2EPZ A;  4DUY E;  3HQ1 A;  2L3C A;  4R2D A;  4DV4 E;  1WHN A;  1N33 E;  3OTO E;  4AQY E;  2EN4 A;  2RTX A;  5AC4 A;  5LL6 R;  1LLM C;  1JK1 A;  5DNY A;  1QU6 A;  2UU9 E;  3ECR A;  4BC9 A;  2M9A A;  5AC5 A;  3ZOQ B;  2EOQ A;  3JU0 A;  3KZZ A;  5AE1 A;  4BCA A;  3IWB A;  3JAM C;  2YTP A;  2EOO A;  4JV5 E;  2RSI A;  4LF6 E;  1YZ9 A;  2EN8 A;  2WBT A;  2UUA E;  3LLH A;  4BHC A;  1X6F A;  2EML A;  5AE2 A;  2YTJ A;  5IT9 C;  2RSM A;  1A1J A;  4DV6 E;  1YUJ A;  2LVH A;  5A6K A;  4ZYE A;  2F8B A;  4JI4 E;  2EM8 A;  4WXD A;  2B7V A;  4F6N A;  4JI5 E;  2ZM6 E;  2YPN A;  2ODR C;  2N3G A;  4F9B B;  2UXB E;  2YSP A;  4ZYD A;  1GZ6 A;  2EOI A;  4M9V C;  2JWO A;  4F54 A;  1ZU1 A;  1EH7 A;  4YHH E;  2L6M A;  2LMZ A;  2YTF A;  1YYW A;  4DR3 E;  4X64 E;  2V88 A;  4F6M A;  3UK3 C;  4DR4 E;  1UHZ A;  1AAY A;  4K0K E;  1YUI A;  1ZBT A;  4DV2 E;  1TF3 A;  1GTK A;  2YWQ A;  2VQE E;  2NUF A;  2RPC A;  5TSE A;  4DMI A;  2EM9 A;  3ADG A;  2LBS B;  1WHQ A;  2JOB A;  1L4S A;  1X6E A;  1EH6 A;  1RQ0 A;  2CTD A;  4R2R A;  3C6M A;  1HR0 E;  2MC5 A;  5CFF E;  4O5G A;  2K7I A;  2LJU A;  4R2A A;  4LF4 E;  2B7T A;  4ZYG A;  3J80 C;  4R8O A;  2M4I A;  2EQ3 A;  4WSP A;  2MDR A;  1I94 E;  1SFE A;  4JI3 E;  4LFA E;  2JVA A;  2NA2 A;  1YYK A;  4LTY A;  5A2Q C;  3H09 A;  2DMI A;  2JYA A;  2EOR A;  2HHH E;  3VYY A;  4DUZ E;  5KL2 A;  2GHF A;  2LE2 A;  2EOY A;  1G2F C;  1DGC A;  2YTQ A;  4NHR A;  2L8T A;  2YRM A;  1FKA E;  2MKN A;  4NZV A;  2EOJ A;  2EMI A;  1X3C A;  1A1G A;  1XMQ E;  1ZAA C;  4MLQ A;  2EMH A;  3K6Q A;  4ZYH A;  2EQ0 A;  2EQ1 A;  1YFH A;  4JI1 E;  4DV3 E;  1B69 A;  5KL5 A;  2YSO A;  4DV0 E;  2IHR 1;  4P78 A;  1EKZ A;  1A1L A;  2DMY A;  2GPI A;  2LRS A;  2RS7 A;  2WCC 3;  2LJH A;  4DR2 E;  3HPS A;  4WXC A;  1X47 A;  5T6J A;  2EM0 A;  2V83 A;  2R76 A;  3MHS C;  1DQ3 A;  2JXP A;  3THN A;  2V86 A;  2YU5 A;  3AV0 A;  5AE3 A;  1PJS A;  2CSH A;  2YTN A;  3IWD A;  5KL4 A;  3EPJ A;  3L00 A;  1FJG E;  3KWR A;  2EOZ A;  2EMX A;  2HC5 A;  2EP3 A;  4N4R B;  2VQF E;  2UXD E;  1HNX E;  2EWL A;  2DRP A;  5A6J A;  2EN1 A;  2E5L E;  2EPU A;  2YTE A;  2EOF A;  2A25 A;  4DR1 E;  1WXR A;  4KZS A;  2LV2 A;  2EJ4 A;  2RQL A;  1J5E E;  1YPN A;  4M30 A;  4L8N A;  2LTS A;  1PDA A;  3QG5 C;  3MHH C;  4OOG C;  1IBM E;  2FTX B;  2CT1 A; 
#chains in the Genus database with same CATH homology
 2HGH A;  2YTO A;  4R2A A;  1YSA C;  1KJK A;  2EM7 A;  2D9H A;  3VHT B;  2ENH A;  2EPR A;  2J7J A;  2ENC A;  2EOM A;  2EL6 A;  2GLI A;  2EMC A;  2MKD A;  4WSG A;  2BB8 A;  2ADR A;  4FK5 C;  2EQ3 A;  2EMB A;  2DLK A;  2EMW A;  2EN3 A;  2YTI A;  1X6H A;  2DLQ A;  1UN6 B;  3EPK A;  4R2E A;  2VRD A;  2R1F A;  2DMI A;  2EM4 A;  3M99 B;  1MEY C;  1P47 A;  2YTG A;  2EOR A;  5KL3 A;  2EE8 A;  1JK2 A;  3EPH A;  2ENA A;  4R2S A;  2LCE A;  1ZR9 A;  2EM2 A;  5KL2 A;  2EL4 A;  4F2J C;  1Z1B A;  1UBD C;  2ELY A;  2GHF A;  1NCS A;  1TF6 A;  2EMK A;  4GZN C;  2MDG A;  2EMZ A;  2EOY A;  1G2F C;  2EPX A;  1WJP A;  1TN9 A;  2YRK A;  2EPZ A;  1X5W A;  1DGC A;  2YTQ A;  2YRM A;  4R2D A;  2MKN A;  1A1K A;  2EOJ A;  5KL6 A;  2EMI A;  1X3C A;  1A1G A;  4R2P A;  1ZAA C;  2EN4 A;  2EMH A;  4R2Q A;  4IJD A;  1LLM C;  1JK1 A;  2EQ0 A;  2EQ1 A;  2ELZ A;  2DGC A;  2EM3 A;  1B69 A;  2M9A A;  2EPA A;  2EM6 A;  5KL5 A;  2YSO A;  1F2I G;  2EOQ A;  2WBS A;  2PRT A;  2YTP A;  2EOO A;  2RSI A;  1G2D C;  1A1L A;  2EN8 A;  2EL5 A;  2E72 A;  2WBT A;  2WCC 3;  2EN2 A;  1A1F A;  1X6F A;  2EML A;  2JPA A;  2YTJ A;  2LT7 A;  1A1J A;  1YUJ A;  1BB8 A;  2LVH A;  2EN7 A;  2EM0 A;  3MHS C;  1A1I A;  2EM8 A;  4IS1 C;  2EMG A;  2YTD A;  4F6N A;  2EPC A;  2YU5 A;  2CSH A;  2YTN A;  2EOH A;  5KL4 A;  5KL7 A;  3EPJ A;  2YSP A;  1BBO A;  2EM5 A;  2EOI A;  4M9V C;  1RMD A;  2EOS A;  2YRH A;  1ZU1 A;  2EOZ A;  2EMX A;  2YTF A;  2EP3 A;  2EPP A;  2EOE A;  2EMY A;  4F6M A;  2DRP A;  3UK3 C;  1A1H A;  2EN1 A;  1AAY A;  2EPU A;  2WBU A;  2EOX A;  2JP9 A;  2YTE A;  1YUI A;  2EOF A;  2YU8 A;  1TF3 A;  2RPC A;  4R2C A;  2A25 A;  2EM9 A;  2LV2 A;  2EJ4 A;  2NAB A;  2EMF A;  1X6E A;  2EMA A;  2EN6 A;  2CTD A;  3EPL A;  2LO3 A;  3MHH C;  4X9J A;  4R2R A;  2CT1 A;  2I13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...