4R2QA

Wilms tumor protein (wt1) zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2qA00
2EOXA 2ENCA 4R2RA 2EMAA 2EN1A 2EOMA 4R2PA 2GHFA 2E72A 2EMYA 1X3CA 2EM8A 1A1GA 5KL3A 2YSOA 2CT1A 1A1IA 1TF6A 2EMIA 4R2DA 1A1KA 1A1LA 1AAYA 1JK1A 2M9AA 2YTPA 3EPHA 2EM6A 2RPCA 1X6HA 2ENHA 4R2AA 2EOQA 2A25A 2LV2A 2YRKA 5KL7A 2EOHA 1P47A 4R2SA 2YTEA 2EOEA 3EPJA 2JP9A 2BB8A 2EMBA 2EOYA 2MKNA 2EN7A 2EOJA 2CSHA 1ZU1A 2EMHA 3MHHC 3VHTB 2EQ3A 2EL4A 1KJKA 2YTFA 1JK2A 1A1HA 2ADRA 1A1JA 2EOIA 2YTNA 2DLKA 2EMXA 2EOZA 2YTQA 2DRPA 2LO3A 2YU5A 1YUIA 2EPAA 2EMZA 2EMLA 1X6FA 2EPPA 2YSPA 2LT7A 1YUJA 2EN2A 4R2QA 2EPZA 5KL2A 1YSAC 4X9JA 3EPKA 1LLMC 2EPCA 2VRDA 2DGCA 2EL6A 2YRMA 2EMFA 1ZR9A 3M99B 4F2JC 2YTJA 4F6MA 4R2EA 1DGCA 1G2FC 2EPRA 1TF3A 2EE8A 2EMWA 3UK3C 2YTGA 1ZAAC 5KL4A 2I13A 1RMDA 2ELYA 4WSGA 2LCEA 1G2DC 2EM0A 2EN8A 2EM7A 2YU8A 2D9HA 2EL5A 2EPUA 2EORA 4IJDA 4F6NA 4GZNC 1F2IG 2EMKA 2EQ1A 1NCSA 2EM3A 3EPLA 2DMIA 2DLQA 2NABA 2ELZA 2EOSA 2WCC3 4R2CA 2EP3A 5KL5A 2EOOA 4FK5C 1MEYC 1UN6B 1A1FA 2EOFA 2YTIA 2EM5A 2EMCA 1X6EA 1BB8A 2EM2A 2PRTA 1TN9A 2ENAA 2YTOA 4IS1C 1Z1BA 3MHSC 2RSIA 2WBUA 2J7JA 1WJPA 2CTDA 2EM9A 2MDGA 1UBDC 2GLIA 2EN6A 2EMGA 5KL6A 2EQ0A 1BBOA 2EN3A 1X5WA 2MKDA 2YTDA 2EPXA 2EM4A 2EJ4A 4M9VC 1B69A 2WBSA 2EN4A 2R1FA 2WBTA 2LVHA 2YRHA 2JPAA 2HGHA
chains in the Genus database with same CATH superfamily
2V88A 4M2ZA 2ENCA 2EN1A 4JI7E 3C4TA 3BIDA 4JI4E 2EMYA 3LMLA 5A6AA 2YWQA 2CT1A 1PJTA 2EMIA 2WZOA 1XNQE 4B3SE 1IQOA 2L2NA 1P47A 4DUYE 2YTEA 2H36X 3VK6A 3EPJA 2V8QB 2JP9A 4BMJA 4OOGC 3KWRA 2EN7A 4N4RB 3BF2A 4J8ZA 5LMNE 1AH5A 1YFHA 2YTFA 4KWYA 2EPOA 1GZ6A 4JI0E 3IWDA 3QG5C 4JI6E 1YUIA 2EPAA 2CPNA 3P1XA 2EMLA 4NXME 2EPPA 2JR1A 2EN2A 2EPKX 1I94E 2EPCA 2EL6A 2RQLA 2KOUA 4LU9A 4ZYHA 1PJSA 3M99B 2EPMX 1MGTA 4BBYA 1T4OA 1DGCA 2DIXA 2NUEA 1RQ0A 4DV1E 3UK3C 3K6QA 1WHQA 3ADJA 1XMQE 1X48A 5IT9C 1ZAAC 2M4IA 5AE3A 4I8OA 1RMDA 2HC5A 4DV3E 1IQSA 4X8WA 2K4VA 2D9HA 2EL5A 1F2IG 2Q8UA 3J80C 4WYQB 2EQ1A 2E1MA 3VYXA 1IBME 4DV2E 2EM3A 2NABA 2EOSA 1N3GA 4KZSA 1L4SA 2EOOA 2UXDE 1HNXE 2EMCA 4GKKE 3HQ1A 5A6BD 1EKZA 2RSIA 1T4LB 2WBUA 1UILA 1WRJA 1XNRE 1WJPA 2GLIA 4LF6E 1UBDC 4WX9A 2EMGA 4JI2E 2VQFE 1FJGE 5IWAE 2EPXA 5A6BA 1DQ3A 2VF1A 2EM4A 2WBSA 2R1FA 1WXRA 2RS6A 1HNWE 2JXPA 2JWOA 3DF6A 4F9AB 2GHFA 4ZYGA 2EM8A 2HJJA 4BS9A 4X65E 4LTYA 4JI8E 1A1KA 4R2DA 2NA2A 1JK1A 4BCAA 5IXMB 4WSPA 1NEIA 2ENHA 4R2AA 4L5NC 4R03A 2JOBA 2YRKA 5KL7A 2EOHA 4X62E 4HEIA 4NHRA 4M30A 3JTZA 2EOYA 2FV4B 3OMLA 2MKNA 4L8NA 4LFCE 2B7VA 2CSHA 1DI2A 3MHHC 3H09A 3VHTB 1KJKA 2YTNA 2FTXB 2YTQA 2NUFA 2BBGA 2YU5A 1YPNA 5A6KA 3IWBA 2EPZA 3KZYA 1LLMC 4LF4E 2YRMA 2UXCE 5BR8E 2EMFA 3LLHA 4BHCA 4JI1E 2DB2A 1G2FC 2K7IA 5IV8B 1TF3A 2EMWA 3T1HE 3HTXA 3J7AG 2M7QA 2V83A 2I13A 2ODRD 1T39A 4WFTA 1J26A 2GPIA 3ADLA 4WSGA 2LCEA 2EM0A 2EN8A 2EM7A 2EPUA 2EORA 2FGGA 4GZNC 2LMZA 1RC7A 1FKAE 3F6HA 1HR0E 1T38A 3C6MA 2ELZA 1YYOA 2WCC3 4R2CA 1GQEA 2EP3A 5TSEA 2LBSB 4JYAE 4ZYDA 4FK5C 4DV0E 2LE2A 2EOFA 1BBGA 1BB8A 2EM2A 2PRTA 4P78A 2ENAA 4IS1C 4B3ME 2UUBE 1IMUA 3ZOQB 4TUGA 3ECRA 2RTXA 4AQYE 2EN6A 5KL6A 1QNTA 4Q35B 2L33A 1IBLE 4KHPE 2EJ4A 3MSWA 4DUZE 1B69A 4DR2E 2L8TA 2RS7A 2R76A 2HGHA 2EOXA 2EMAA 5A2QC 4O4KA 4R2PA 2EPNA 2E72A 2MC5A 5AC4A 1X3CA 2B7TA 4WPYA 2YSOA 1X49A 1N36E 2V85A 1A1LA 1AAYA 2M9AA 4MLQA 1SR9A 2LUQA 4YY3E 3EPHA 2EM6A 1PJQA 2LTSA 4DR3E 2EOQA 2UUCE 2LV2A 4LF5E 5AC5A 4LF7E 2I9IA 3JU0A 1YYKA 2DSYA 2EOEA 5T6JA 2BB8A 2EMBA 4DR5E 4DR7E 2EOJA 2EMHA 2EQ3A 2EL4A 1JK2A 1X47A 4DV4E 1A1JA 1A1HA 2DLKA 1IBKE 2EOZA 2N3HA 5LLQA 3FIGA 1ZBTA 5A6JA 1N32E 1STUA 2EMZA 1PDAA 4NZVA 2B9DA 2LT7A 4F9BB 4ZYEA 1YSAC 4X9JA 2L2MA 2DGCA 4MLVA 2EZ6A 2VQEE 1YYWA 2NUGA 2LJUA 4DR6E 4F2JC 2YTJA 4F6MA 4R2EA 1HNZE 2EPRA 2N3GA 2UXBE 2YTGA 5KL4A 4F54A 3RMPA 2ELYA 5AASA 1G2DC 2MDRA 2JY9A 4F6NA 2YU8A 4RH8A 4NXNE 2LUPB 1T4NA 2IHR1 1NCSA 2L6MA 2KHXA 2KONA 2L2KB 1UN6B 4BC7A 1A1FA 1J5EE 2YTIA 3THNA 5AE1A 4M0VA 4JI5E 2UUAE 2YTOA 1Z1BA 3MHSC 4Q28A 5A69A 2CTDA 2EM9A 1BBOA 3VYYA 4M9VC 1EH6A 3L00A 3J81C 2EPLX 2YRHA 4HTGA 3TQMA 4LFAE 3C4BA 2JPAA 1XMOE 4R2RA 4R8OA 2EOMA 4DV6E 3T1YE 4P7DA 1A1GA 5KL3A 2G7HA 3J7Yp 1A1IA 1TF6A 2YPNA 5LMUE 2HHHE 2YTPA 3AV0A 5LL6R 3HPZA 2RPCA 1X6HA 2N8XA 5AE2A 2YZTA 3DJWA 2A25A 2V89A 1O0WA 4WXDA 4TUIA 4R2SA 1KYQA 2F4VE 4JI3E 2E5LE 4DKKA 1ZU1A 1PKPA 1N33E 1QU6A 2ADRA 2EOIA 4YHHE 2EMXA 4DR1E 5F3WA 2DRPA 2LO3A 4DR4E 4B3TE 1UHZA 4O24A 5ADZA 3HXLA 2YT4A 4BHBA 1X6FA 4DV7E 2YSPA 2EWLA 4DMIA 1YUJA 4R2QA 5KL2A 3EPKA 2ODRC 2VRDA 2LTRA 2M1SA 2V87A 3KZZA 2L3JA 4O43A 2UU9E 4F9CB 1ZR9A 4BC9A 2DMYA 4X66E 2JOXA 2EE8A 1EH8A 3IWCA 3JAMC 4JV5E 4OX9E 1ZBQA 4WXCA 2JYAA 4IJDA 1GTKA 2B3TB 2MC6A 4X64E 2EMKA 1WHNA 3EPLA 2DMIA 2DLQA 2LJHA 5FLXC 4LF8E 3F6GA 3AUZA 5KL5A 2JVAA 3OTOE 4GKJE 1MEYC 3THOB 1N34E 2EM5A 2L92A 4RHBB 1X6EA 3ADGA 4B3RE 4LFBE 4GEQB 1SFEA 3HPSA 1TN9A 4O5GA 4LF9E 4DV5E 2J7JA 3ADIA 3BGHA 3EQ1A 4K0KE 1YZ9A 2V86A 2MDGA 2EQ0A 2EN3A 1X5WA 2MKDA 2YTDA 5CFFE 2VE7C 3C6KA 3BBGA 2EN4A 5DNYA 2WBTA 2LVHA 2ZM6E 1EH7A 2RSMA 2LRSA 2L3CA 2F8BA
chains in the Genus database with same CATH topology
2EOXA 2ENCA 4R2RA 2EMAA 2EN1A 2EOMA 4R2PA 2GHFA 2E72A 2EMYA 1X3CA 2EM8A 1A1GA 5KL3A 2YSOA 2CT1A 1A1IA 1TF6A 2EMIA 4R2DA 1A1KA 1A1LA 1AAYA 1JK1A 2M9AA 2YTPA 3EPHA 2EM6A 2RPCA 1X6HA 2ENHA 4R2AA 2EOQA 2A25A 2LV2A 2YRKA 5KL7A 2EOHA 1P47A 4R2SA 2YTEA 2EOEA 3EPJA 2JP9A 2BB8A 2EMBA 2EOYA 2MKNA 2EN7A 2EOJA 2CSHA 1ZU1A 2EMHA 3MHHC 3VHTB 2EQ3A 2EL4A 1KJKA 2YTFA 1JK2A 1A1HA 2ADRA 1A1JA 2EOIA 2YTNA 2DLKA 2EMXA 2EOZA 2YTQA 2DRPA 2LO3A 2YU5A 1YUIA 2EPAA 2EMZA 2EMLA 1X6FA 2EPPA 2YSPA 2LT7A 1YUJA 2EN2A 4R2QA 2EPZA 5KL2A 1YSAC 4X9JA 3EPKA 1LLMC 2EPCA 2VRDA 2DGCA 2EL6A 2YRMA 2EMFA 1ZR9A 3M99B 4F2JC 2YTJA 4F6MA 4R2EA 1DGCA 1G2FC 2EPRA 1TF3A 2EE8A 2EMWA 3UK3C 2YTGA 1ZAAC 5KL4A 2I13A 1RMDA 2ELYA 4WSGA 2LCEA 1G2DC 2EM0A 2EN8A 2EM7A 2YU8A 2D9HA 2EL5A 2EPUA 2EORA 4IJDA 4F6NA 4GZNC 1F2IG 2EMKA 2EQ1A 1NCSA 2EM3A 3EPLA 2DMIA 2DLQA 2NABA 2ELZA 2EOSA 2WCC3 4R2CA 2EP3A 5KL5A 2EOOA 4FK5C 1MEYC 1UN6B 1A1FA 2EOFA 2YTIA 2EM5A 2EMCA 1X6EA 1BB8A 2EM2A 2PRTA 1TN9A 2ENAA 2YTOA 4IS1C 1Z1BA 3MHSC 2RSIA 2WBUA 2J7JA 1WJPA 2CTDA 2EM9A 2MDGA 1UBDC 2GLIA 2EN6A 2EMGA 5KL6A 2EQ0A 1BBOA 2EN3A 1X5WA 2MKDA 2YTDA 2EPXA 2EM4A 2EJ4A 4M9VC 1B69A 2WBSA 2EN4A 2R1FA 2WBTA 2LVHA 2YRHA 2JPAA 2HGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOX A;  2ENC A;  4R2R A;  2EMA A;  2EN1 A;  2EOM A;  4R2P A;  2GHF A;  2E72 A;  2EMY A;  1X3C A;  2EM8 A;  1A1G A;  5KL3 A;  2YSO A;  2CT1 A;  1A1I A;  1TF6 A;  2EMI A;  4R2D A;  1A1K A;  1A1L A;  1AAY A;  1JK1 A;  2M9A A;  2YTP A;  3EPH A;  2EM6 A;  2RPC A;  1X6H A;  2ENH A;  4R2A A;  2EOQ A;  2A25 A;  2LV2 A;  2YRK A;  5KL7 A;  2EOH A;  1P47 A;  4R2S A;  2YTE A;  2EOE A;  3EPJ A;  2JP9 A;  2BB8 A;  2EMB A;  2EOY A;  2MKN A;  2EN7 A;  2EOJ A;  2CSH A;  1ZU1 A;  2EMH A;  3MHH C;  3VHT B;  2EQ3 A;  2EL4 A;  1KJK A;  2YTF A;  1JK2 A;  1A1H A;  2ADR A;  1A1J A;  2EOI A;  2YTN A;  2DLK A;  2EMX A;  2EOZ A;  2YTQ A;  2DRP A;  2LO3 A;  2YU5 A;  1YUI A;  2EPA A;  2EMZ A;  2EML A;  1X6F A;  2EPP A;  2YSP A;  2LT7 A;  1YUJ A;  2EN2 A;  4R2Q A;  2EPZ A;  5KL2 A;  1YSA C;  4X9J A;  3EPK A;  1LLM C;  2EPC A;  2VRD A;  2DGC A;  2EL6 A;  2YRM A;  2EMF A;  1ZR9 A;  3M99 B;  4F2J C;  2YTJ A;  4F6M A;  4R2E A;  1DGC A;  1G2F C;  2EPR A;  1TF3 A;  2EE8 A;  2EMW A;  3UK3 C;  2YTG A;  1ZAA C;  5KL4 A;  2I13 A;  1RMD A;  2ELY A;  4WSG A;  2LCE A;  1G2D C;  2EM0 A;  2EN8 A;  2EM7 A;  2YU8 A;  2D9H A;  2EL5 A;  2EPU A;  2EOR A;  4IJD A;  4F6N A;  4GZN C;  1F2I G;  2EMK A;  2EQ1 A;  1NCS A;  2EM3 A;  3EPL A;  2DMI A;  2DLQ A;  2NAB A;  2ELZ A;  2EOS A;  2WCC 3;  4R2C A;  2EP3 A;  5KL5 A;  2EOO A;  4FK5 C;  1MEY C;  1UN6 B;  1A1F A;  2EOF A;  2YTI A;  2EM5 A;  2EMC A;  1X6E A;  1BB8 A;  2EM2 A;  2PRT A;  1TN9 A;  2ENA A;  2YTO A;  4IS1 C;  1Z1B A;  3MHS C;  2RSI A;  2WBU A;  2J7J A;  1WJP A;  2CTD A;  2EM9 A;  2MDG A;  1UBD C;  2GLI A;  2EN6 A;  2EMG A;  5KL6 A;  2EQ0 A;  1BBO A;  2EN3 A;  1X5W A;  2MKD A;  2YTD A;  2EPX A;  2EM4 A;  2EJ4 A;  4M9V C;  1B69 A;  2WBS A;  2EN4 A;  2R1F A;  2WBT A;  2LVH A;  2YRH A;  2JPA A;  2HGH A; 
#chains in the Genus database with same CATH topology
 2V88 A;  4M2Z A;  2ENC A;  2EN1 A;  4JI7 E;  3C4T A;  3BID A;  4JI4 E;  2EMY A;  3LML A;  5A6A A;  2YWQ A;  2CT1 A;  1PJT A;  2EMI A;  2WZO A;  1XNQ E;  4B3S E;  1IQO A;  2L2N A;  1P47 A;  4DUY E;  2YTE A;  2H36 X;  3VK6 A;  3EPJ A;  2V8Q B;  2JP9 A;  4BMJ A;  4OOG C;  3KWR A;  2EN7 A;  4N4R B;  3BF2 A;  4J8Z A;  5LMN E;  1AH5 A;  1YFH A;  2YTF A;  4KWY A;  2EPO A;  1GZ6 A;  4JI0 E;  3IWD A;  3QG5 C;  4JI6 E;  1YUI A;  2EPA A;  2CPN A;  3P1X A;  2EML A;  4NXM E;  2EPP A;  2JR1 A;  2EN2 A;  2EPK X;  1I94 E;  2EPC A;  2EL6 A;  2RQL A;  2KOU A;  4LU9 A;  4ZYH A;  1PJS A;  3M99 B;  2EPM X;  1MGT A;  4BBY A;  1T4O A;  1DGC A;  2DIX A;  2NUE A;  1RQ0 A;  4DV1 E;  3UK3 C;  3K6Q A;  1WHQ A;  3ADJ A;  1XMQ E;  1X48 A;  5IT9 C;  1ZAA C;  2M4I A;  5AE3 A;  4I8O A;  1RMD A;  2HC5 A;  4DV3 E;  1IQS A;  4X8W A;  2K4V A;  2D9H A;  2EL5 A;  1F2I G;  2Q8U A;  3J80 C;  4WYQ B;  2EQ1 A;  2E1M A;  3VYX A;  1IBM E;  4DV2 E;  2EM3 A;  2NAB A;  2EOS A;  1N3G A;  4KZS A;  1L4S A;  2EOO A;  2UXD E;  1HNX E;  2EMC A;  4GKK E;  3HQ1 A;  5A6B D;  1EKZ A;  2RSI A;  1T4L B;  2WBU A;  1UIL A;  1WRJ A;  1XNR E;  1WJP A;  2GLI A;  4LF6 E;  1UBD C;  4WX9 A;  2EMG A;  4JI2 E;  2VQF E;  1FJG E;  5IWA E;  2EPX A;  5A6B A;  1DQ3 A;  2VF1 A;  2EM4 A;  2WBS A;  2R1F A;  1WXR A;  2RS6 A;  1HNW E;  2JXP A;  2JWO A;  3DF6 A;  4F9A B;  2GHF A;  4ZYG A;  2EM8 A;  2HJJ A;  4BS9 A;  4X65 E;  4LTY A;  4JI8 E;  1A1K A;  4R2D A;  2NA2 A;  1JK1 A;  4BCA A;  5IXM B;  4WSP A;  1NEI A;  2ENH A;  4R2A A;  4L5N C;  4R03 A;  2JOB A;  2YRK A;  5KL7 A;  2EOH A;  4X62 E;  4HEI A;  4NHR A;  4M30 A;  3JTZ A;  2EOY A;  2FV4 B;  3OML A;  2MKN A;  4L8N A;  4LFC E;  2B7V A;  2CSH A;  1DI2 A;  3MHH C;  3H09 A;  3VHT B;  1KJK A;  2YTN A;  2FTX B;  2YTQ A;  2NUF A;  2BBG A;  2YU5 A;  1YPN A;  5A6K A;  3IWB A;  2EPZ A;  3KZY A;  1LLM C;  4LF4 E;  2YRM A;  2UXC E;  5BR8 E;  2EMF A;  3LLH A;  4BHC A;  4JI1 E;  2DB2 A;  1G2F C;  2K7I A;  5IV8 B;  1TF3 A;  2EMW A;  3T1H E;  3HTX A;  3J7A G;  2M7Q A;  2V83 A;  2I13 A;  2ODR D;  1T39 A;  4WFT A;  1J26 A;  2GPI A;  3ADL A;  4WSG A;  2LCE A;  2EM0 A;  2EN8 A;  2EM7 A;  2EPU A;  2EOR A;  2FGG A;  4GZN C;  2LMZ A;  1RC7 A;  1FKA E;  3F6H A;  1HR0 E;  1T38 A;  3C6M A;  2ELZ A;  1YYO A;  2WCC 3;  4R2C A;  1GQE A;  2EP3 A;  5TSE A;  2LBS B;  4JYA E;  4ZYD A;  4FK5 C;  4DV0 E;  2LE2 A;  2EOF A;  1BBG A;  1BB8 A;  2EM2 A;  2PRT A;  4P78 A;  2ENA A;  4IS1 C;  4B3M E;  2UUB E;  1IMU A;  3ZOQ B;  4TUG A;  3ECR A;  2RTX A;  4AQY E;  2EN6 A;  5KL6 A;  1QNT A;  4Q35 B;  2L33 A;  1IBL E;  4KHP E;  2EJ4 A;  3MSW A;  4DUZ E;  1B69 A;  4DR2 E;  2L8T A;  2RS7 A;  2R76 A;  2HGH A;  2EOX A;  2EMA A;  5A2Q C;  4O4K A;  4R2P A;  2EPN A;  2E72 A;  2MC5 A;  5AC4 A;  1X3C A;  2B7T A;  4WPY A;  2YSO A;  1X49 A;  1N36 E;  2V85 A;  1A1L A;  1AAY A;  2M9A A;  4MLQ A;  1SR9 A;  2LUQ A;  4YY3 E;  3EPH A;  2EM6 A;  1PJQ A;  2LTS A;  4DR3 E;  2EOQ A;  2UUC E;  2LV2 A;  4LF5 E;  5AC5 A;  4LF7 E;  2I9I A;  3JU0 A;  1YYK A;  2DSY A;  2EOE A;  5T6J A;  2BB8 A;  2EMB A;  4DR5 E;  4DR7 E;  2EOJ A;  2EMH A;  2EQ3 A;  2EL4 A;  1JK2 A;  1X47 A;  4DV4 E;  1A1J A;  1A1H A;  2DLK A;  1IBK E;  2EOZ A;  2N3H A;  5LLQ A;  3FIG A;  1ZBT A;  5A6J A;  1N32 E;  1STU A;  2EMZ A;  1PDA A;  4NZV A;  2B9D A;  2LT7 A;  4F9B B;  4ZYE A;  1YSA C;  4X9J A;  2L2M A;  2DGC A;  4MLV A;  2EZ6 A;  2VQE E;  1YYW A;  2NUG A;  2LJU A;  4DR6 E;  4F2J C;  2YTJ A;  4F6M A;  4R2E A;  1HNZ E;  2EPR A;  2N3G A;  2UXB E;  2YTG A;  5KL4 A;  4F54 A;  3RMP A;  2ELY A;  5AAS A;  1G2D C;  2MDR A;  2JY9 A;  4F6N A;  2YU8 A;  4RH8 A;  4NXN E;  2LUP B;  1T4N A;  2IHR 1;  1NCS A;  2L6M A;  2KHX A;  2KON A;  2L2K B;  1UN6 B;  4BC7 A;  1A1F A;  1J5E E;  2YTI A;  3THN A;  5AE1 A;  4M0V A;  4JI5 E;  2UUA E;  2YTO A;  1Z1B A;  3MHS C;  4Q28 A;  5A69 A;  2CTD A;  2EM9 A;  1BBO A;  3VYY A;  4M9V C;  1EH6 A;  3L00 A;  3J81 C;  2EPL X;  2YRH A;  4HTG A;  3TQM A;  4LFA E;  3C4B A;  2JPA A;  1XMO E;  4R2R A;  4R8O A;  2EOM A;  4DV6 E;  3T1Y E;  4P7D A;  1A1G A;  5KL3 A;  2G7H A;  3J7Y p;  1A1I A;  1TF6 A;  2YPN A;  5LMU E;  2HHH E;  2YTP A;  3AV0 A;  5LL6 R;  3HPZ A;  2RPC A;  1X6H A;  2N8X A;  5AE2 A;  2YZT A;  3DJW A;  2A25 A;  2V89 A;  1O0W A;  4WXD A;  4TUI A;  4R2S A;  1KYQ A;  2F4V E;  4JI3 E;  2E5L E;  4DKK A;  1ZU1 A;  1PKP A;  1N33 E;  1QU6 A;  2ADR A;  2EOI A;  4YHH E;  2EMX A;  4DR1 E;  5F3W A;  2DRP A;  2LO3 A;  4DR4 E;  4B3T E;  1UHZ A;  4O24 A;  5ADZ A;  3HXL A;  2YT4 A;  4BHB A;  1X6F A;  4DV7 E;  2YSP A;  2EWL A;  4DMI A;  1YUJ A;  4R2Q A;  5KL2 A;  3EPK A;  2ODR C;  2VRD A;  2LTR A;  2M1S A;  2V87 A;  3KZZ A;  2L3J A;  4O43 A;  2UU9 E;  4F9C B;  1ZR9 A;  4BC9 A;  2DMY A;  4X66 E;  2JOX A;  2EE8 A;  1EH8 A;  3IWC A;  3JAM C;  4JV5 E;  4OX9 E;  1ZBQ A;  4WXC A;  2JYA A;  4IJD A;  1GTK A;  2B3T B;  2MC6 A;  4X64 E;  2EMK A;  1WHN A;  3EPL A;  2DMI A;  2DLQ A;  2LJH A;  5FLX C;  4LF8 E;  3F6G A;  3AUZ A;  5KL5 A;  2JVA A;  3OTO E;  4GKJ E;  1MEY C;  3THO B;  1N34 E;  2EM5 A;  2L92 A;  4RHB B;  1X6E A;  3ADG A;  4B3R E;  4LFB E;  4GEQ B;  1SFE A;  3HPS A;  1TN9 A;  4O5G A;  4LF9 E;  4DV5 E;  2J7J A;  3ADI A;  3BGH A;  3EQ1 A;  4K0K E;  1YZ9 A;  2V86 A;  2MDG A;  2EQ0 A;  2EN3 A;  1X5W A;  2MKD A;  2YTD A;  5CFF E;  2VE7 C;  3C6K A;  3BBG A;  2EN4 A;  5DNY A;  2WBT A;  2LVH A;  2ZM6 E;  1EH7 A;  2RSM A;  2LRS A;  2L3C A;  2F8B A; 
#chains in the Genus database with same CATH homology
 2EOX A;  2ENC A;  4R2R A;  2EMA A;  2EN1 A;  2EOM A;  4R2P A;  2GHF A;  2E72 A;  2EMY A;  1X3C A;  2EM8 A;  1A1G A;  5KL3 A;  2YSO A;  2CT1 A;  1A1I A;  1TF6 A;  2EMI A;  4R2D A;  1A1K A;  1A1L A;  1AAY A;  1JK1 A;  2M9A A;  2YTP A;  3EPH A;  2EM6 A;  2RPC A;  1X6H A;  2ENH A;  4R2A A;  2EOQ A;  2A25 A;  2LV2 A;  2YRK A;  5KL7 A;  2EOH A;  1P47 A;  4R2S A;  2YTE A;  2EOE A;  3EPJ A;  2JP9 A;  2BB8 A;  2EMB A;  2EOY A;  2MKN A;  2EN7 A;  2EOJ A;  2CSH A;  1ZU1 A;  2EMH A;  3MHH C;  3VHT B;  2EQ3 A;  2EL4 A;  1KJK A;  2YTF A;  1JK2 A;  1A1H A;  2ADR A;  1A1J A;  2EOI A;  2YTN A;  2DLK A;  2EMX A;  2EOZ A;  2YTQ A;  2DRP A;  2LO3 A;  2YU5 A;  1YUI A;  2EPA A;  2EMZ A;  2EML A;  1X6F A;  2EPP A;  2YSP A;  2LT7 A;  1YUJ A;  2EN2 A;  4R2Q A;  2EPZ A;  5KL2 A;  1YSA C;  4X9J A;  3EPK A;  1LLM C;  2EPC A;  2VRD A;  2DGC A;  2EL6 A;  2YRM A;  2EMF A;  1ZR9 A;  3M99 B;  4F2J C;  2YTJ A;  4F6M A;  4R2E A;  1DGC A;  1G2F C;  2EPR A;  1TF3 A;  2EE8 A;  2EMW A;  3UK3 C;  2YTG A;  1ZAA C;  5KL4 A;  2I13 A;  1RMD A;  2ELY A;  4WSG A;  2LCE A;  1G2D C;  2EM0 A;  2EN8 A;  2EM7 A;  2YU8 A;  2D9H A;  2EL5 A;  2EPU A;  2EOR A;  4IJD A;  4F6N A;  4GZN C;  1F2I G;  2EMK A;  2EQ1 A;  1NCS A;  2EM3 A;  3EPL A;  2DMI A;  2DLQ A;  2NAB A;  2ELZ A;  2EOS A;  2WCC 3;  4R2C A;  2EP3 A;  5KL5 A;  2EOO A;  4FK5 C;  1MEY C;  1UN6 B;  1A1F A;  2EOF A;  2YTI A;  2EM5 A;  2EMC A;  1X6E A;  1BB8 A;  2EM2 A;  2PRT A;  1TN9 A;  2ENA A;  2YTO A;  4IS1 C;  1Z1B A;  3MHS C;  2RSI A;  2WBU A;  2J7J A;  1WJP A;  2CTD A;  2EM9 A;  2MDG A;  1UBD C;  2GLI A;  2EN6 A;  2EMG A;  5KL6 A;  2EQ0 A;  1BBO A;  2EN3 A;  1X5W A;  2MKD A;  2YTD A;  2EPX A;  2EM4 A;  2EJ4 A;  4M9V C;  1B69 A;  2WBS A;  2EN4 A;  2R1F A;  2WBT A;  2LVH A;  2YRH A;  2JPA A;  2HGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...