4R2QA

Wilms tumor protein (wt1) zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2qA00
1UN6B 1JK1A 2YTPA 2EN1A 1JK2A 2EMYA 1BBOA 4R2PA 2EMXA 2J7JA 4F2JC 2EMAA 2ADRA 1WJPA 2RSIA 2JPAA 5KL6A 1YSAC 2YTEA 2WBSA 3EPLA 1ZAAC 2EMBA 1KJKA 2EJ4A 3MHHC 2EOMA 1AAYA 1YUIA 2EPAA 2WBUA 2EOFA 2CSHA 2I13A 1ZU1A 2DGCA 1TF6A 2YTOA 1A1FA 3M99B 2EMFA 2EN8A 2EN6A 2DLQA 2EM9A 2EQ0A 2EMCA 3EPHA 2EORA 1F2IG 2YU8A 2YTQA 1ZR9A 5KL2A 1A1HA 1BB8A 2EMKA 2EN7A 4WSGA 4R2SA 2EM5A 2NABA 2EPRA 1NCSA 2EQ1A 5KL4A 2EOEA 2EMGA 2EE8A 4R2AA 2EPXA 2DRPA 2YTJA 2EOIA 4R2QA 2YTGA 1YUJA 4M9VC 2GHFA 4F6MA 2JP9A 1X6EA 2EM6A 2YSOA 2EM3A 2PRTA 1A1LA 5KL7A 2R1FA 1A1KA 2VRDA 2EPPA 2M9AA 2EOQA 2BB8A 2EN3A 2YRMA 1X3CA 2YRKA 2WCC3 1G2FC 2EMLA 2ENAA 1LLMC 2CT1A 2EMWA 2EN2A 1X5WA 2EL5A 2LT7A 1A1GA 1X6HA 4X9JA 3EPKA 2RPCA 4IJDA 2YTIA 2EM4A 2DMIA 1Z1BA 2HGHA 2WBTA 4R2EA 4R2RA 3EPJA 3VHTB 2EPZA 5KL3A 2ENCA 2EN4A 2EL6A 2EOXA 4GZNC 1TN9A 2EOYA 2DLKA 2EM0A 2EOZA 2LCEA 2YRHA 1P47A 2EL4A 2MKNA 2EPCA 2GLIA 4R2CA 5KL5A 2YTFA 2EOJA 4F6NA 2EM7A 2EMZA 2YU5A 1UBDC 4R2DA 2ENHA 2MDGA 1TF3A 2MKDA 1DGCA 3UK3C 2EOHA 2A25A 2CTDA 2LV2A 2EOSA 1X6FA 1A1IA 2ELZA 2E72A 2YSPA 2EM8A 3MHSC 1A1JA 2ELYA 2EMHA 2YTNA 2EM2A 2EPUA 2YTDA 4FK5C 1B69A 2EMIA 1G2DC 1MEYC 2EQ3A 2EP3A 4IS1C 2EOOA 2LO3A 1RMDA 2LVHA 2D9HA
chains in the Genus database with same CATH superfamily
3FIGA 2GPIA 1SR9A 4O24A 1YFHA 1QNTA 1IBKE 2EMAA 4DV5E 1IQSA 2WZOA 2V89A 2YTEA 4HEIA 1YPNA 2WBSA 1ZAAC 2HC5A 1NEIA 4YY3E 2EOMA 1YUIA 2EOFA 4K0KE 4X64E 1STUA 4DR6E 3C6MA 1A1FA 3RMPA 4N4RB 2FV4B 2EN8A 5TSEA 1J26A 2EORA 2M7QA 1T4LB 2YTQA 4DUYE 2B3TB 4WFTA 1A1HA 3ADLA 2EMKA 2EN7A 3HQ1A 1XMOE 4DMIA 3OMLA 2UXDE 2ODRD 1WRJA 4X65E 3IWCA 1ZBQA 4DR3E 1FKAE 2YTGA 2B7VA 1GTKA 3C6KA 5AE1A 5LMNE 1A1LA 5KL7A 4ZYDA 1A1KA 4BCAA 1GZ6A 3HXLA 2EPMX 4JI6E 1IBLE 1X3CA 2L6MA 2YRKA 4R03A 4NHRA 2EMLA 2ENAA 2Q8UA 2L3JA 1LLMC 2EMWA 2E5LE 3ADJA 1X6HA 3BF2A 4JI1E 2YTIA 4BC9A 4M30A 1GQEA 1T4OA 2EM4A 1Z1BA 3DF6A 4R2EA 4R2RA 3EPJA 3VHTB 4LF6E 2ENCA 2EN4A 2EOXA 3ECRA 4GZNC 3JAMC 1TN9A 1T38A 5A6KA 1N32E 4ZYHA 1T4NA 2GLIA 3BGHA 5KL5A 4F9CB 4TUGA 2DIXA 2YU5A 2VQEE 1WHQA 5AE2A 1TF3A 4LF8E 1DGCA 4DV0E 5A6BA 4JYAE 3T1YE 3J81C 3AUZA 4BMJA 4O4KA 2RS6A 2EM2A 4TUIA 1B69A 1MEYC 2EMIA 4KHPE 2EQ3A 4JI3E 2B9DA 2LE2A 2EOOA 2YTDA 2EPKX 2JWOA 2JOXA 3VK6A 1JK1A 1N33E 2V83A 1BBOA 2YWQA 4GEQB 5LMUE 2EMXA 2J7JA 2V85A 2N3GA 5AASA 3VYXA 2UXCE 3MSWA 1YSAC 4YHHE 2MC6A 1KJKA 1EH8A 3AV0A 4JI5E 1AAYA 1UILA 2EPAA 1ZU1A 3H09A 2DGCA 1TF6A 3M99B 1PKPA 5ADZA 2DLQA 4P78A 5IT9C 3EPHA 1IMUA 4DUZE 4OOGC 2EM5A 2CPNA 1NCSA 1IBME 1HNXE 4X66E 4Q28A 2EMGA 2EE8A 4LF5E 4F9BB 3VYYA 2JY9A 4WX9A 2LRSA 1RQ0A 2EM6A 2LUQA 2EM3A 5LL6R 4DR7E 4AQYE 4RH8A 2VRDA 4JI2E 2ZM6E 1PDAA 2EN3A 3J7AG 2WCC3 1J5EE 2LJHA 4BHCA 2EN2A 3EPKA 2UUBE 2RPCA 4DV4E 4BBYA 4IJDA 2WBTA 3IWBA 4B3TE 4GKJE 5KL3A 3J80C 2E1MA 1RC7A 1HR0E 2DLKA 2MKNA 3LMLA 1N3GA 5A6JA 1DI2A 4O5GA 1T39A 4DKKA 2EM7A 3HPZA 2NUGA 4R2DA 2DMYA 2VF1A 2MDGA 2V86A 2MKDA 2JXPA 4DV2E 2CTDA 1MGTA 4WXDA 2LJUA 3J7Yp 2FGGA 4L5NC 4DV1E 2YZTA 2ELZA 3C4BA 1EKZA 1QU6A 2EM8A 5T6JA 2HJJA 2ELYA 2YTNA 2EPUA 4FK5C 2I9IA 3THNA 2LO3A 3LLHA 1RMDA 4DR2E 4F6MA 2LUPB 1UN6B 1I94E 2YTPA 1JK2A 2L2NA 3P1XA 2NA2A 4JI7E 1BBGA 2JOBA 4JI0E 4F2JC 1HNWE 1WJPA 2RSIA 4DV3E 2JPAA 2NUFA 3F6GA 5AE3A 3EPLA 2EMBA 2MC5A 4ZYEA 2VE7C 2EJ4A 3MHHC 4BHBA 2UUAE 2WBUA 3BIDA 2YPNA 4F9AB 2RSMA 4M2ZA 2EPOA 2ODRC 4I8OA 2EMFA 4LFBE 2L3CA 4NXME 2EQ0A 3BBGA 5AC4A 1F2IG 5F3WA 3ZOQB 3THOB 2NABA 2EPRA 2UUCE 2IHR1 2EQ1A 5KL4A 2EOEA 3KZYA 4BC7A 2UXBE 4DR1E 4LF4E 2EPXA 4DV7E 2DRPA 3HTXA 2EOIA 1YUJA 2GHFA 1SFEA 1YYOA 2N3HA 2JP9A 1PJSA 1X6EA 4L8NA 2YSOA 5A6AA 2PRTA 2V87A 1YZ9A 3C4TA 4B3SE 3ADGA 2LTSA 2H36X 2LBSB 2M9AA 4WYQB 2YRMA 4DR4E 2DB2A 4O43A 1XNRE 4Q35B 1ZBTA 1G2FC 2EL5A 1X5WA 2MDRA 5IV8B 2LT7A 2F4VE 2KONA 1X48A 2EPLX 5A6BD 2HGHA 5CFFE 4LF7E 2NUEA 1KYQA 2EPZA 3JTZA 2KHXA 2EOYA 2V8QB 4NZVA 1O0WA 1P47A 4LU9A 2EPCA 4R2CA 5IWAE 1YYWA 4F6NA 2EOJA 4B3RE 2L33A 1UBDC 2JVAA 2ENHA 2N8XA 2HHHE 2V88A 5AC5A 2LMZA 2EOHA 2A25A 2L2KB 2LV2A 4KWYA 1PJTA 1X6FA 1DQ3A 4BS9A 2E72A 2F8BA 4R8OA 3KZZA 4DV6E 5A2QC 4MLQA 3MHSC 2DSYA 2EMHA 3TQMA 1N34E 2RQLA 5BR8E 1XMQE 2EP3A 4JI8E 1BB8A 2LVHA 4M0VA 3OTOE 2FTXB 2EN1A 1X49A 2EMYA 4LF9E 4R2PA 1XNQE 2ADRA 4JI4E 1AH5A 5KL6A 2KOUA 3JU0A 1PJQA 4X62E 2EPNA 2YT4A 1HNZE 4JV5E 2CSHA 2K7IA 2I13A 2RTXA 4J8ZA 2B7TA 5FLXC 3QG5C 2YTOA 2EN6A 2EM9A 2L92A 2EMCA 2YU8A 1ZR9A 5KL2A 4WSGA 5A69A 4R2SA 2RS7A 4LTYA 4OX9E 4R2AA 2L8TA 4WPYA 4LFCE 3ADIA 2YTJA 3EQ1A 4R2QA 1WHNA 4M9VC 2M1SA 2EZ6A 3HPSA 5DNYA 1UHZA 3DJWA 2R1FA 1WXRA 2LTRA 4HTGA 2VQFE 2BBGA 4ZYGA 5LLQA 2EPPA 4RHBB 4DR5E 2EOQA 2BB8A 2CT1A 4MLVA 1A1GA 4X8WA 4X9JA 4P7DA 1X47A 2DMIA 2JR1A 2EL6A 3K6QA 4F54A 1EH6A 4WXCA 4GKKE 2EM0A 2EOZA 2LCEA 2YRHA 2EL4A 3KWRA 1YYKA 2R76A 2YTFA 2EWLA 3IWDA 2EMZA 2L2MA 1IQOA 4KZSA 4LFAE 1EH7A 3T1HE 1L4SA 3UK3C 2JYAA 2EOSA 1N36E 1A1IA 5IXMB 2YSPA 4WSPA 1FJGE 2G7HA 1A1JA 4B3ME 1G2DC 4IS1C 2M4IA 3F6HA 4NXNE 3L00A 2K4VA 2D9HA 2UU9E
chains in the Genus database with same CATH topology
1UN6B 1JK1A 2YTPA 2EN1A 1JK2A 2EMYA 1BBOA 4R2PA 2EMXA 2J7JA 4F2JC 2EMAA 2ADRA 1WJPA 2RSIA 2JPAA 5KL6A 1YSAC 2YTEA 2WBSA 3EPLA 1ZAAC 2EMBA 1KJKA 2EJ4A 3MHHC 2EOMA 1AAYA 1YUIA 2EPAA 2WBUA 2EOFA 2CSHA 2I13A 1ZU1A 2DGCA 1TF6A 2YTOA 1A1FA 3M99B 2EMFA 2EN8A 2EN6A 2DLQA 2EM9A 2EQ0A 2EMCA 3EPHA 2EORA 1F2IG 2YU8A 2YTQA 1ZR9A 5KL2A 1A1HA 1BB8A 2EMKA 2EN7A 4WSGA 4R2SA 2EM5A 2NABA 2EPRA 1NCSA 2EQ1A 5KL4A 2EOEA 2EMGA 2EE8A 4R2AA 2EPXA 2DRPA 2YTJA 2EOIA 4R2QA 2YTGA 1YUJA 4M9VC 2GHFA 4F6MA 2JP9A 1X6EA 2EM6A 2YSOA 2EM3A 2PRTA 1A1LA 5KL7A 2R1FA 1A1KA 2VRDA 2EPPA 2M9AA 2EOQA 2BB8A 2EN3A 2YRMA 1X3CA 2YRKA 2WCC3 1G2FC 2EMLA 2ENAA 1LLMC 2CT1A 2EMWA 2EN2A 1X5WA 2EL5A 2LT7A 1A1GA 1X6HA 4X9JA 3EPKA 2RPCA 4IJDA 2YTIA 2EM4A 2DMIA 1Z1BA 2HGHA 2WBTA 4R2EA 4R2RA 3EPJA 3VHTB 2EPZA 5KL3A 2ENCA 2EN4A 2EL6A 2EOXA 4GZNC 1TN9A 2EOYA 2DLKA 2EM0A 2EOZA 2LCEA 2YRHA 1P47A 2EL4A 2MKNA 2EPCA 2GLIA 4R2CA 5KL5A 2YTFA 2EOJA 4F6NA 2EM7A 2EMZA 2YU5A 1UBDC 4R2DA 2ENHA 2MDGA 1TF3A 2MKDA 1DGCA 3UK3C 2EOHA 2A25A 2CTDA 2LV2A 2EOSA 1X6FA 1A1IA 2ELZA 2E72A 2YSPA 2EM8A 3MHSC 1A1JA 2ELYA 2EMHA 2YTNA 2EM2A 2EPUA 2YTDA 4FK5C 1B69A 2EMIA 1G2DC 1MEYC 2EQ3A 2EP3A 4IS1C 2EOOA 2LO3A 1RMDA 2LVHA 2D9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN6 B;  1JK1 A;  2YTP A;  2EN1 A;  1JK2 A;  2EMY A;  1BBO A;  4R2P A;  2EMX A;  2J7J A;  4F2J C;  2EMA A;  2ADR A;  1WJP A;  2RSI A;  2JPA A;  5KL6 A;  1YSA C;  2YTE A;  2WBS A;  3EPL A;  1ZAA C;  2EMB A;  1KJK A;  2EJ4 A;  3MHH C;  2EOM A;  1AAY A;  1YUI A;  2EPA A;  2WBU A;  2EOF A;  2CSH A;  2I13 A;  1ZU1 A;  2DGC A;  1TF6 A;  2YTO A;  1A1F A;  3M99 B;  2EMF A;  2EN8 A;  2EN6 A;  2DLQ A;  2EM9 A;  2EQ0 A;  2EMC A;  3EPH A;  2EOR A;  1F2I G;  2YU8 A;  2YTQ A;  1ZR9 A;  5KL2 A;  1A1H A;  1BB8 A;  2EMK A;  2EN7 A;  4WSG A;  4R2S A;  2EM5 A;  2NAB A;  2EPR A;  1NCS A;  2EQ1 A;  5KL4 A;  2EOE A;  2EMG A;  2EE8 A;  4R2A A;  2EPX A;  2DRP A;  2YTJ A;  2EOI A;  4R2Q A;  2YTG A;  1YUJ A;  4M9V C;  2GHF A;  4F6M A;  2JP9 A;  1X6E A;  2EM6 A;  2YSO A;  2EM3 A;  2PRT A;  1A1L A;  5KL7 A;  2R1F A;  1A1K A;  2VRD A;  2EPP A;  2M9A A;  2EOQ A;  2BB8 A;  2EN3 A;  2YRM A;  1X3C A;  2YRK A;  2WCC 3;  1G2F C;  2EML A;  2ENA A;  1LLM C;  2CT1 A;  2EMW A;  2EN2 A;  1X5W A;  2EL5 A;  2LT7 A;  1A1G A;  1X6H A;  4X9J A;  3EPK A;  2RPC A;  4IJD A;  2YTI A;  2EM4 A;  2DMI A;  1Z1B A;  2HGH A;  2WBT A;  4R2E A;  4R2R A;  3EPJ A;  3VHT B;  2EPZ A;  5KL3 A;  2ENC A;  2EN4 A;  2EL6 A;  2EOX A;  4GZN C;  1TN9 A;  2EOY A;  2DLK A;  2EM0 A;  2EOZ A;  2LCE A;  2YRH A;  1P47 A;  2EL4 A;  2MKN A;  2EPC A;  2GLI A;  4R2C A;  5KL5 A;  2YTF A;  2EOJ A;  4F6N A;  2EM7 A;  2EMZ A;  2YU5 A;  1UBD C;  4R2D A;  2ENH A;  2MDG A;  1TF3 A;  2MKD A;  1DGC A;  3UK3 C;  2EOH A;  2A25 A;  2CTD A;  2LV2 A;  2EOS A;  1X6F A;  1A1I A;  2ELZ A;  2E72 A;  2YSP A;  2EM8 A;  3MHS C;  1A1J A;  2ELY A;  2EMH A;  2YTN A;  2EM2 A;  2EPU A;  2YTD A;  4FK5 C;  1B69 A;  2EMI A;  1G2D C;  1MEY C;  2EQ3 A;  2EP3 A;  4IS1 C;  2EOO A;  2LO3 A;  1RMD A;  2LVH A;  2D9H A; 
#chains in the Genus database with same CATH topology
 3FIG A;  2GPI A;  1SR9 A;  4O24 A;  1YFH A;  1QNT A;  1IBK E;  2EMA A;  4DV5 E;  1IQS A;  2WZO A;  2V89 A;  2YTE A;  4HEI A;  1YPN A;  2WBS A;  1ZAA C;  2HC5 A;  1NEI A;  4YY3 E;  2EOM A;  1YUI A;  2EOF A;  4K0K E;  4X64 E;  1STU A;  4DR6 E;  3C6M A;  1A1F A;  3RMP A;  4N4R B;  2FV4 B;  2EN8 A;  5TSE A;  1J26 A;  2EOR A;  2M7Q A;  1T4L B;  2YTQ A;  4DUY E;  2B3T B;  4WFT A;  1A1H A;  3ADL A;  2EMK A;  2EN7 A;  3HQ1 A;  1XMO E;  4DMI A;  3OML A;  2UXD E;  2ODR D;  1WRJ A;  4X65 E;  3IWC A;  1ZBQ A;  4DR3 E;  1FKA E;  2YTG A;  2B7V A;  1GTK A;  3C6K A;  5AE1 A;  5LMN E;  1A1L A;  5KL7 A;  4ZYD A;  1A1K A;  4BCA A;  1GZ6 A;  3HXL A;  2EPM X;  4JI6 E;  1IBL E;  1X3C A;  2L6M A;  2YRK A;  4R03 A;  4NHR A;  2EML A;  2ENA A;  2Q8U A;  2L3J A;  1LLM C;  2EMW A;  2E5L E;  3ADJ A;  1X6H A;  3BF2 A;  4JI1 E;  2YTI A;  4BC9 A;  4M30 A;  1GQE A;  1T4O A;  2EM4 A;  1Z1B A;  3DF6 A;  4R2E A;  4R2R A;  3EPJ A;  3VHT B;  4LF6 E;  2ENC A;  2EN4 A;  2EOX A;  3ECR A;  4GZN C;  3JAM C;  1TN9 A;  1T38 A;  5A6K A;  1N32 E;  4ZYH A;  1T4N A;  2GLI A;  3BGH A;  5KL5 A;  4F9C B;  4TUG A;  2DIX A;  2YU5 A;  2VQE E;  1WHQ A;  5AE2 A;  1TF3 A;  4LF8 E;  1DGC A;  4DV0 E;  5A6B A;  4JYA E;  3T1Y E;  3J81 C;  3AUZ A;  4BMJ A;  4O4K A;  2RS6 A;  2EM2 A;  4TUI A;  1B69 A;  1MEY C;  2EMI A;  4KHP E;  2EQ3 A;  4JI3 E;  2B9D A;  2LE2 A;  2EOO A;  2YTD A;  2EPK X;  2JWO A;  2JOX A;  3VK6 A;  1JK1 A;  1N33 E;  2V83 A;  1BBO A;  2YWQ A;  4GEQ B;  5LMU E;  2EMX A;  2J7J A;  2V85 A;  2N3G A;  5AAS A;  3VYX A;  2UXC E;  3MSW A;  1YSA C;  4YHH E;  2MC6 A;  1KJK A;  1EH8 A;  3AV0 A;  4JI5 E;  1AAY A;  1UIL A;  2EPA A;  1ZU1 A;  3H09 A;  2DGC A;  1TF6 A;  3M99 B;  1PKP A;  5ADZ A;  2DLQ A;  4P78 A;  5IT9 C;  3EPH A;  1IMU A;  4DUZ E;  4OOG C;  2EM5 A;  2CPN A;  1NCS A;  1IBM E;  1HNX E;  4X66 E;  4Q28 A;  2EMG A;  2EE8 A;  4LF5 E;  4F9B B;  3VYY A;  2JY9 A;  4WX9 A;  2LRS A;  1RQ0 A;  2EM6 A;  2LUQ A;  2EM3 A;  5LL6 R;  4DR7 E;  4AQY E;  4RH8 A;  2VRD A;  4JI2 E;  2ZM6 E;  1PDA A;  2EN3 A;  3J7A G;  2WCC 3;  1J5E E;  2LJH A;  4BHC A;  2EN2 A;  3EPK A;  2UUB E;  2RPC A;  4DV4 E;  4BBY A;  4IJD A;  2WBT A;  3IWB A;  4B3T E;  4GKJ E;  5KL3 A;  3J80 C;  2E1M A;  1RC7 A;  1HR0 E;  2DLK A;  2MKN A;  3LML A;  1N3G A;  5A6J A;  1DI2 A;  4O5G A;  1T39 A;  4DKK A;  2EM7 A;  3HPZ A;  2NUG A;  4R2D A;  2DMY A;  2VF1 A;  2MDG A;  2V86 A;  2MKD A;  2JXP A;  4DV2 E;  2CTD A;  1MGT A;  4WXD A;  2LJU A;  3J7Y p;  2FGG A;  4L5N C;  4DV1 E;  2YZT A;  2ELZ A;  3C4B A;  1EKZ A;  1QU6 A;  2EM8 A;  5T6J A;  2HJJ A;  2ELY A;  2YTN A;  2EPU A;  4FK5 C;  2I9I A;  3THN A;  2LO3 A;  3LLH A;  1RMD A;  4DR2 E;  4F6M A;  2LUP B;  1UN6 B;  1I94 E;  2YTP A;  1JK2 A;  2L2N A;  3P1X A;  2NA2 A;  4JI7 E;  1BBG A;  2JOB A;  4JI0 E;  4F2J C;  1HNW E;  1WJP A;  2RSI A;  4DV3 E;  2JPA A;  2NUF A;  3F6G A;  5AE3 A;  3EPL A;  2EMB A;  2MC5 A;  4ZYE A;  2VE7 C;  2EJ4 A;  3MHH C;  4BHB A;  2UUA E;  2WBU A;  3BID A;  2YPN A;  4F9A B;  2RSM A;  4M2Z A;  2EPO A;  2ODR C;  4I8O A;  2EMF A;  4LFB E;  2L3C A;  4NXM E;  2EQ0 A;  3BBG A;  5AC4 A;  1F2I G;  5F3W A;  3ZOQ B;  3THO B;  2NAB A;  2EPR A;  2UUC E;  2IHR 1;  2EQ1 A;  5KL4 A;  2EOE A;  3KZY A;  4BC7 A;  2UXB E;  4DR1 E;  4LF4 E;  2EPX A;  4DV7 E;  2DRP A;  3HTX A;  2EOI A;  1YUJ A;  2GHF A;  1SFE A;  1YYO A;  2N3H A;  2JP9 A;  1PJS A;  1X6E A;  4L8N A;  2YSO A;  5A6A A;  2PRT A;  2V87 A;  1YZ9 A;  3C4T A;  4B3S E;  3ADG A;  2LTS A;  2H36 X;  2LBS B;  2M9A A;  4WYQ B;  2YRM A;  4DR4 E;  2DB2 A;  4O43 A;  1XNR E;  4Q35 B;  1ZBT A;  1G2F C;  2EL5 A;  1X5W A;  2MDR A;  5IV8 B;  2LT7 A;  2F4V E;  2KON A;  1X48 A;  2EPL X;  5A6B D;  2HGH A;  5CFF E;  4LF7 E;  2NUE A;  1KYQ A;  2EPZ A;  3JTZ A;  2KHX A;  2EOY A;  2V8Q B;  4NZV A;  1O0W A;  1P47 A;  4LU9 A;  2EPC A;  4R2C A;  5IWA E;  1YYW A;  4F6N A;  2EOJ A;  4B3R E;  2L33 A;  1UBD C;  2JVA A;  2ENH A;  2N8X A;  2HHH E;  2V88 A;  5AC5 A;  2LMZ A;  2EOH A;  2A25 A;  2L2K B;  2LV2 A;  4KWY A;  1PJT A;  1X6F A;  1DQ3 A;  4BS9 A;  2E72 A;  2F8B A;  4R8O A;  3KZZ A;  4DV6 E;  5A2Q C;  4MLQ A;  3MHS C;  2DSY A;  2EMH A;  3TQM A;  1N34 E;  2RQL A;  5BR8 E;  1XMQ E;  2EP3 A;  4JI8 E;  1BB8 A;  2LVH A;  4M0V A;  3OTO E;  2FTX B;  2EN1 A;  1X49 A;  2EMY A;  4LF9 E;  4R2P A;  1XNQ E;  2ADR A;  4JI4 E;  1AH5 A;  5KL6 A;  2KOU A;  3JU0 A;  1PJQ A;  4X62 E;  2EPN A;  2YT4 A;  1HNZ E;  4JV5 E;  2CSH A;  2K7I A;  2I13 A;  2RTX A;  4J8Z A;  2B7T A;  5FLX C;  3QG5 C;  2YTO A;  2EN6 A;  2EM9 A;  2L92 A;  2EMC A;  2YU8 A;  1ZR9 A;  5KL2 A;  4WSG A;  5A69 A;  4R2S A;  2RS7 A;  4LTY A;  4OX9 E;  4R2A A;  2L8T A;  4WPY A;  4LFC E;  3ADI A;  2YTJ A;  3EQ1 A;  4R2Q A;  1WHN A;  4M9V C;  2M1S A;  2EZ6 A;  3HPS A;  5DNY A;  1UHZ A;  3DJW A;  2R1F A;  1WXR A;  2LTR A;  4HTG A;  2VQF E;  2BBG A;  4ZYG A;  5LLQ A;  2EPP A;  4RHB B;  4DR5 E;  2EOQ A;  2BB8 A;  2CT1 A;  4MLV A;  1A1G A;  4X8W A;  4X9J A;  4P7D A;  1X47 A;  2DMI A;  2JR1 A;  2EL6 A;  3K6Q A;  4F54 A;  1EH6 A;  4WXC A;  4GKK E;  2EM0 A;  2EOZ A;  2LCE A;  2YRH A;  2EL4 A;  3KWR A;  1YYK A;  2R76 A;  2YTF A;  2EWL A;  3IWD A;  2EMZ A;  2L2M A;  1IQO A;  4KZS A;  4LFA E;  1EH7 A;  3T1H E;  1L4S A;  3UK3 C;  2JYA A;  2EOS A;  1N36 E;  1A1I A;  5IXM B;  2YSP A;  4WSP A;  1FJG E;  2G7H A;  1A1J A;  4B3M E;  1G2D C;  4IS1 C;  2M4I A;  3F6H A;  4NXN E;  3L00 A;  2K4V A;  2D9H A;  2UU9 E; 
#chains in the Genus database with same CATH homology
 1UN6 B;  1JK1 A;  2YTP A;  2EN1 A;  1JK2 A;  2EMY A;  1BBO A;  4R2P A;  2EMX A;  2J7J A;  4F2J C;  2EMA A;  2ADR A;  1WJP A;  2RSI A;  2JPA A;  5KL6 A;  1YSA C;  2YTE A;  2WBS A;  3EPL A;  1ZAA C;  2EMB A;  1KJK A;  2EJ4 A;  3MHH C;  2EOM A;  1AAY A;  1YUI A;  2EPA A;  2WBU A;  2EOF A;  2CSH A;  2I13 A;  1ZU1 A;  2DGC A;  1TF6 A;  2YTO A;  1A1F A;  3M99 B;  2EMF A;  2EN8 A;  2EN6 A;  2DLQ A;  2EM9 A;  2EQ0 A;  2EMC A;  3EPH A;  2EOR A;  1F2I G;  2YU8 A;  2YTQ A;  1ZR9 A;  5KL2 A;  1A1H A;  1BB8 A;  2EMK A;  2EN7 A;  4WSG A;  4R2S A;  2EM5 A;  2NAB A;  2EPR A;  1NCS A;  2EQ1 A;  5KL4 A;  2EOE A;  2EMG A;  2EE8 A;  4R2A A;  2EPX A;  2DRP A;  2YTJ A;  2EOI A;  4R2Q A;  2YTG A;  1YUJ A;  4M9V C;  2GHF A;  4F6M A;  2JP9 A;  1X6E A;  2EM6 A;  2YSO A;  2EM3 A;  2PRT A;  1A1L A;  5KL7 A;  2R1F A;  1A1K A;  2VRD A;  2EPP A;  2M9A A;  2EOQ A;  2BB8 A;  2EN3 A;  2YRM A;  1X3C A;  2YRK A;  2WCC 3;  1G2F C;  2EML A;  2ENA A;  1LLM C;  2CT1 A;  2EMW A;  2EN2 A;  1X5W A;  2EL5 A;  2LT7 A;  1A1G A;  1X6H A;  4X9J A;  3EPK A;  2RPC A;  4IJD A;  2YTI A;  2EM4 A;  2DMI A;  1Z1B A;  2HGH A;  2WBT A;  4R2E A;  4R2R A;  3EPJ A;  3VHT B;  2EPZ A;  5KL3 A;  2ENC A;  2EN4 A;  2EL6 A;  2EOX A;  4GZN C;  1TN9 A;  2EOY A;  2DLK A;  2EM0 A;  2EOZ A;  2LCE A;  2YRH A;  1P47 A;  2EL4 A;  2MKN A;  2EPC A;  2GLI A;  4R2C A;  5KL5 A;  2YTF A;  2EOJ A;  4F6N A;  2EM7 A;  2EMZ A;  2YU5 A;  1UBD C;  4R2D A;  2ENH A;  2MDG A;  1TF3 A;  2MKD A;  1DGC A;  3UK3 C;  2EOH A;  2A25 A;  2CTD A;  2LV2 A;  2EOS A;  1X6F A;  1A1I A;  2ELZ A;  2E72 A;  2YSP A;  2EM8 A;  3MHS C;  1A1J A;  2ELY A;  2EMH A;  2YTN A;  2EM2 A;  2EPU A;  2YTD A;  4FK5 C;  1B69 A;  2EMI A;  1G2D C;  1MEY C;  2EQ3 A;  2EP3 A;  4IS1 C;  2EOO A;  2LO3 A;  1RMD A;  2LVH A;  2D9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...