4R2QA

Wilms tumor protein (wt1) zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2qA00
4R2DA 2ENAA 5KL2A 5KL6A 4X9JA 2LCEA 2DLKA 2EOYA 4F6MA 2D9HA 2YSOA 2EMIA 3VHTB 3EPKA 1Z1BA 1AAYA 2YSPA 2EN7A 2J7JA 2EOJA 1A1LA 2EOSA 2EL5A 2WCC3 1YSAC 2CTDA 1YUJA 1NCSA 2YRMA 2YTPA 2EOOA 1ZR9A 2EOMA 2ENHA 2YTEA 4R2RA 2WBSA 2YRHA 2R1FA 2EQ0A 2RPCA 1UBDC 2ELZA 4WSGA 2HGHA 2EMZA 2EM3A 2YRKA 5KL7A 5KL3A 1P47A 2EPAA 2LO3A 2LVHA 4R2SA 2YTFA 2EMLA 2EMXA 2EORA 2EMBA 2M9AA 5KL5A 2YTNA 1MEYC 3MHHC 5KL4A 1A1HA 2EL6A 2EMFA 2EOQA 1X3CA 3UK3C 2CSHA 1ZU1A 2E72A 1BB8A 2EJ4A 1X6EA 2EPXA 2YTOA 2EQ1A 2EM5A 2EN8A 1X6FA 2EMGA 2EN1A 4F2JC 2EM2A 2DLQA 4R2AA 2EL4A 2YTJA 2ADRA 1A1IA 2EM7A 1YUIA 3EPHA 2EPRA 1DGCA 2NABA 2EE8A 2MDGA 3MHSC 2MKNA 2MKDA 2EM6A 2YU8A 1A1KA 2VRDA 4FK5C 2LV2A 3EPLA 1RMDA 2EOFA 1UN6B 3M99B 1KJKA 2EOHA 1ZAAC 2EPUA 2GLIA 2ENCA 4R2QA 1X6HA 2YTIA 4GZNC 1A1GA 2EOXA 1TN9A 2JP9A 1F2IG 2EN3A 1JK1A 2I13A 2EMAA 2EPPA 2WBUA 2DGCA 2CT1A 2EMKA 2EPZA 2EOIA 4R2EA 1G2DC 2EOZA 2ELYA 1LLMC 2GHFA 2YU5A 1G2FC 1X5WA 2EN2A 2DRPA 2EM9A 1TF3A 2EM4A 2YTDA 2EMWA 2EMHA 1A1FA 4M9VC 2EMCA 1JK2A 2RSIA 1BBOA 2LT7A 2EN6A 1TF6A 3EPJA 2PRTA 4IS1C 4R2CA 1A1JA 2EPCA 2JPAA 2EOEA 2YTQA 4F6NA 2EMYA 2EP3A 2EQ3A 2A25A 2WBTA 2DMIA 2EN4A 2BB8A 2EM0A 1B69A 1WJPA 2EM8A 4R2PA 4IJDA 2YTGA
chains in the Genus database with same CATH superfamily
1N3GA 2ENAA 2LCEA 2DLKA 1IBLE 4ZYDA 1AAYA 2EN7A 2J7JA 1RC7A 1A1LA 1YFHA 4JI8E 2L2NA 1UHZA 2HJJA 2Q8UA 4R8OA 2JR1A 2WCC3 1YSAC 1NCSA 1WHNA 2YTPA 2EOOA 2RSMA 1YYWA 4O24A 1EH7A 1IBKE 2ENHA 2I9IA 2RPCA 4DR3E 2ELZA 4RH8A 4WSGA 4F9AB 2E5LE 2HGHA 4BBYA 2LVHA 2L2MA 2EMXA 2EORA 2EMBA 4LFBE 2UXBE 4MLQA 5KL5A 4L5NC 5KL4A 4ZYHA 2KOUA 4DV6E 3VYYA 3VYXA 2L3JA 2EJ4A 2N8XA 2EM5A 2EN8A 2FGGA 2EM2A 4R2AA 4P7DA 4DR7E 1A1IA 3VK6A 2DB2A 2EPRA 3J80C 4LF7E 2NABA 2EE8A 4JI2E 4TUIA 1N34E 2V88A 1A1KA 3EPLA 1RMDA 4LTYA 5LLQA 1WRJA 3AV0A 5LMUE 3FIGA 4WSPA 2EOXA 4DV5E 5A6BA 4B3TE 1YYKA 2E1MA 1TN9A 4DV7E 2JP9A 2EMAA 2NUEA 4B3ME 2WBUA 2DGCA 2EOIA 2L2KB 1QU6A 1G2FC 2LTSA 1TF3A 4HEIA 4LFCE 2EMWA 3IWBA 4DV3E 4M0VA 2JWOA 2B9DA 2V8QB 1TF6A 3EPJA 4DR4E 3IWCA 4WXCA 2EPCA 5AC4A 2EQ3A 2L3CA 2WBTA 4LF9E 4AQYE 1X49A 1YPNA 3RMPA 4KHPE 4DMIA 2EOYA 3KZZA 3IWDA 2YSOA 1DI2A 4DR2E 3HXLA 3JTZA 4KZSA 1MGTA 2EOSA 3BF2A 2EL5A 5FLXC 2K4VA 2CTDA 2YRMA 2L92A 2ODRD 3QG5C 3HTXA 4O5GA 2HHHE 2JY9A 2VQEE 4DR6E 4R2RA 2R1FA 2EQ0A 5TSEA 1T4OA 1N33E 2MC5A 2EM3A 2EMZA 3KWRA 1P47A 2EPAA 2LO3A 1KYQA 2EMLA 2JVAA 1HNZE 1UILA 1XMOE 2YTNA 1MEYC 4JI7E 2EMFA 1STUA 3UK3C 2LRSA 2CSHA 1BB8A 3LLHA 4NXNE 1AH5A 1X6FA 1PJTA 5IWAE 2ADRA 2F8BA 5DNYA 5IXMB 1DGCA 1WXRA 3ADGA 4JI5E 1N32E 4O4KA 2MKNA 2MKDA 1HNWE 2EM6A 3AUZA 2YU8A 4R03A 2GPIA 4FK5C 3F6HA 4LF6E 3THOB 2RS7A 3M99B 4LF8E 4HTGA 4JI4E 2EOHA 3THNA 1HR0E 2YZTA 2NA2A 3JU0A 4I8OA 1X6HA 2YTIA 3TQMA 4BS9A 4GZNC 5AC5A 4X62E 5F3WA 3ADIA 1JK1A 2I13A 2LE2A 2M4IA 4X66E 4WX9A 2M1SA 2EPZA 1G2DC 2EOZA 2YU5A 4JI3E 1X5WA 3DF6A 2DRPA 2DSYA 2DMYA 2EM4A 2YTDA 4WFTA 2EMHA 4BC7A 4L8NA 2RSIA 2LT7A 4DV2E 3T1HE 2H36X 3ECRA 1BBGA 4BMJA 2B7TA 4R2CA 1O0WA 4X64E 4F6NA 2ODRC 5CFFE 4F54A 3C6KA 1IBME 3LMLA 4NHRA 2EM8A 4R2PA 1XNQE 2EPOA 4IJDA 2YTGA 5A6BD 4DUZE 4RHBB 4X9JA 1DQ3A 2EPNA 3BBGA 5A69A 4F6MA 2D9HA 1T39A 2EMIA 3VHTB 2L6MA 3ADJA 3EPKA 2YSPA 4Q28A 4YY3E 1FJGE 2EOJA 1T4LB 3BIDA 1RQ0A 2BBGA 3C6MA 1YUJA 4GKKE 5A2QC 1ZR9A 2JOBA 2EOMA 4Q35B 2MDRA 2YTEA 3HPSA 2WBSA 2YRHA 2V83A 1UBDC 1YZ9A 5KL7A 2YRKA 5KL3A 2WZOA 1ZBQA 2LJUA 3KZYA 2FTXB 4ZYEA 2M9AA 3OTOE 2VQFE 1A1HA 1X3CA 4F9BB 2R76A 4BHBA 1ZU1A 1QNTA 1X6EA 2EPXA 2EQ1A 2EPKX 2EMGA 3MSWA 4DR1E 2EN1A 4B3SE 2DLQA 2EL4A 1WHQA 2LJHA 4DV0E 2VE7C 4WXDA 1XNRE 1YUIA 3EPHA 2CPNA 5IV8B 1N36E 3MHSC 2VRDA 1IQSA 2EOFA 1UN6B 1EKZA 2KONA 1KJKA 4DV1E 3HQ1A 1ZAAC 1I94E 2EPUA 4GKJE 1A1GA 2LUQA 5AASA 2DIXA 4KWYA 1T4NA 1GTKA 2V89A 2YWQA 2EN3A 5AE2A 2EMKA 4R2EA 5LMNE 2B3TB 1IQOA 4NZVA 4WYQB 2YPNA 1SFEA 2EM9A 3ADLA 2UUBE 2UXDE 5A6JA 1J5EE 1L4SA 1NEIA 4P78A 2EMCA 3J7Yp 1IMUA 4JI6E 2EN6A 2LTRA 4LF5E 2UUAE 2K7IA 1A1JA 1ZBTA 1XMQE 2JPAA 2UU9E 1YYOA 2EOEA 2YTQA 2EMYA 4DUYE 4LU9A 1X47A 2DMIA 2EN4A 5ADZA 1B69A 2B7VA 1WJPA 5LL6R 1EH6A 4R2DA 5KL6A 5KL2A 1T38A 1Z1BA 5BR8E 2YT4A 4B3RE 2HC5A 3K6QA 2V87A 2V85A 4M2ZA 4BHCA 4TUGA 2EPMX 2EPLX 1GQEA 4GEQB 1GZ6A 2NUFA 1PJQA 4JV5E 4BCAA 3J81C 2EZ6A 1X48A 5IT9C 4YHHE 2F4VE 4R2SA 2YTFA 5A6AA 3EQ1A 3MHHC 2EL6A 2EOQA 2E72A 3ZOQB 5AE3A 4OOGC 4K0KE 2UXCE 4DKKA 2YTOA 5AE1A 4JI1E 4F2JC 3T1YE 3BGHA 3HPZA 4BC9A 2YTJA 2NUGA 2M7QA 1PDAA 4X8WA 2EM7A 4LF4E 4LFAE 4OX9E 2FV4B 2MDGA 2JYAA 2KHXA 1EH8A 2L8TA 4J8ZA 5A6KA 1FKAE 4F9CB 2LV2A 4DR5E 2G7HA 4O43A 2IHR1 2JXPA 2RQLA 2ENCA 4R2QA 2RTXA 3DJWA 4MLVA 2LMZA 1PJSA 4WPYA 2L33A 1PKPA 1F2IG 2EPPA 2MC6A 2UUCE 2V86A 2CT1A 3H09A 3C4TA 4DV4E 3P1XA 1SR9A 2ELYA 1LLMC 4JI0E 2GHFA 3OMLA 2EN2A 4X65E 5T6JA 4M30A 2N3HA 3C4BA 1A1FA 2RS6A 2EWLA 4M9VC 1BBOA 1JK2A 2LUPB 1J26A 4N4RB 1HNXE 2N3GA 3F6GA 4ZYGA 2PRTA 2JOXA 4IS1C 2LBSB 2VF1A 2ZM6E 4NXME 3J7AG 3L00A 2EP3A 2A25A 4JYAE 2BB8A 3JAMC 2EM0A 2GLIA
chains in the Genus database with same CATH topology
4R2DA 2ENAA 5KL2A 5KL6A 4X9JA 2LCEA 2DLKA 2EOYA 4F6MA 2D9HA 2YSOA 2EMIA 3VHTB 3EPKA 1Z1BA 1AAYA 2YSPA 2EN7A 2J7JA 2EOJA 1A1LA 2EOSA 2EL5A 2WCC3 1YSAC 2CTDA 1YUJA 1NCSA 2YRMA 2YTPA 2EOOA 1ZR9A 2EOMA 2ENHA 2YTEA 4R2RA 2WBSA 2YRHA 2R1FA 2EQ0A 2RPCA 1UBDC 2ELZA 4WSGA 2HGHA 2EMZA 2EM3A 2YRKA 5KL7A 5KL3A 1P47A 2EPAA 2LO3A 2LVHA 4R2SA 2YTFA 2EMLA 2EMXA 2EORA 2EMBA 2M9AA 5KL5A 2YTNA 1MEYC 3MHHC 5KL4A 1A1HA 2EL6A 2EMFA 2EOQA 1X3CA 3UK3C 2CSHA 1ZU1A 2E72A 1BB8A 2EJ4A 1X6EA 2EPXA 2YTOA 2EQ1A 2EM5A 2EN8A 1X6FA 2EMGA 2EN1A 4F2JC 2EM2A 2DLQA 4R2AA 2EL4A 2YTJA 2ADRA 1A1IA 2EM7A 1YUIA 3EPHA 2EPRA 1DGCA 2NABA 2EE8A 2MDGA 3MHSC 2MKNA 2MKDA 2EM6A 2YU8A 1A1KA 2VRDA 4FK5C 2LV2A 3EPLA 1RMDA 2EOFA 1UN6B 3M99B 1KJKA 2EOHA 1ZAAC 2EPUA 2GLIA 2ENCA 4R2QA 1X6HA 2YTIA 4GZNC 1A1GA 2EOXA 1TN9A 2JP9A 1F2IG 2EN3A 1JK1A 2I13A 2EMAA 2EPPA 2WBUA 2DGCA 2CT1A 2EMKA 2EPZA 2EOIA 4R2EA 1G2DC 2EOZA 2ELYA 1LLMC 2GHFA 2YU5A 1G2FC 1X5WA 2EN2A 2DRPA 2EM9A 1TF3A 2EM4A 2YTDA 2EMWA 2EMHA 1A1FA 4M9VC 2EMCA 1JK2A 2RSIA 1BBOA 2LT7A 2EN6A 1TF6A 3EPJA 2PRTA 4IS1C 4R2CA 1A1JA 2EPCA 2JPAA 2EOEA 2YTQA 4F6NA 2EMYA 2EP3A 2EQ3A 2A25A 2WBTA 2DMIA 2EN4A 2BB8A 2EM0A 1B69A 1WJPA 2EM8A 4R2PA 4IJDA 2YTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2D A;  2ENA A;  5KL2 A;  5KL6 A;  4X9J A;  2LCE A;  2DLK A;  2EOY A;  4F6M A;  2D9H A;  2YSO A;  2EMI A;  3VHT B;  3EPK A;  1Z1B A;  1AAY A;  2YSP A;  2EN7 A;  2J7J A;  2EOJ A;  1A1L A;  2EOS A;  2EL5 A;  2WCC 3;  1YSA C;  2CTD A;  1YUJ A;  1NCS A;  2YRM A;  2YTP A;  2EOO A;  1ZR9 A;  2EOM A;  2ENH A;  2YTE A;  4R2R A;  2WBS A;  2YRH A;  2R1F A;  2EQ0 A;  2RPC A;  1UBD C;  2ELZ A;  4WSG A;  2HGH A;  2EMZ A;  2EM3 A;  2YRK A;  5KL7 A;  5KL3 A;  1P47 A;  2EPA A;  2LO3 A;  2LVH A;  4R2S A;  2YTF A;  2EML A;  2EMX A;  2EOR A;  2EMB A;  2M9A A;  5KL5 A;  2YTN A;  1MEY C;  3MHH C;  5KL4 A;  1A1H A;  2EL6 A;  2EMF A;  2EOQ A;  1X3C A;  3UK3 C;  2CSH A;  1ZU1 A;  2E72 A;  1BB8 A;  2EJ4 A;  1X6E A;  2EPX A;  2YTO A;  2EQ1 A;  2EM5 A;  2EN8 A;  1X6F A;  2EMG A;  2EN1 A;  4F2J C;  2EM2 A;  2DLQ A;  4R2A A;  2EL4 A;  2YTJ A;  2ADR A;  1A1I A;  2EM7 A;  1YUI A;  3EPH A;  2EPR A;  1DGC A;  2NAB A;  2EE8 A;  2MDG A;  3MHS C;  2MKN A;  2MKD A;  2EM6 A;  2YU8 A;  1A1K A;  2VRD A;  4FK5 C;  2LV2 A;  3EPL A;  1RMD A;  2EOF A;  1UN6 B;  3M99 B;  1KJK A;  2EOH A;  1ZAA C;  2EPU A;  2GLI A;  2ENC A;  4R2Q A;  1X6H A;  2YTI A;  4GZN C;  1A1G A;  2EOX A;  1TN9 A;  2JP9 A;  1F2I G;  2EN3 A;  1JK1 A;  2I13 A;  2EMA A;  2EPP A;  2WBU A;  2DGC A;  2CT1 A;  2EMK A;  2EPZ A;  2EOI A;  4R2E A;  1G2D C;  2EOZ A;  2ELY A;  1LLM C;  2GHF A;  2YU5 A;  1G2F C;  1X5W A;  2EN2 A;  2DRP A;  2EM9 A;  1TF3 A;  2EM4 A;  2YTD A;  2EMW A;  2EMH A;  1A1F A;  4M9V C;  2EMC A;  1JK2 A;  2RSI A;  1BBO A;  2LT7 A;  2EN6 A;  1TF6 A;  3EPJ A;  2PRT A;  4IS1 C;  4R2C A;  1A1J A;  2EPC A;  2JPA A;  2EOE A;  2YTQ A;  4F6N A;  2EMY A;  2EP3 A;  2EQ3 A;  2A25 A;  2WBT A;  2DMI A;  2EN4 A;  2BB8 A;  2EM0 A;  1B69 A;  1WJP A;  2EM8 A;  4R2P A;  4IJD A;  2YTG A; 
#chains in the Genus database with same CATH topology
 1N3G A;  2ENA A;  2LCE A;  2DLK A;  1IBL E;  4ZYD A;  1AAY A;  2EN7 A;  2J7J A;  1RC7 A;  1A1L A;  1YFH A;  4JI8 E;  2L2N A;  1UHZ A;  2HJJ A;  2Q8U A;  4R8O A;  2JR1 A;  2WCC 3;  1YSA C;  1NCS A;  1WHN A;  2YTP A;  2EOO A;  2RSM A;  1YYW A;  4O24 A;  1EH7 A;  1IBK E;  2ENH A;  2I9I A;  2RPC A;  4DR3 E;  2ELZ A;  4RH8 A;  4WSG A;  4F9A B;  2E5L E;  2HGH A;  4BBY A;  2LVH A;  2L2M A;  2EMX A;  2EOR A;  2EMB A;  4LFB E;  2UXB E;  4MLQ A;  5KL5 A;  4L5N C;  5KL4 A;  4ZYH A;  2KOU A;  4DV6 E;  3VYY A;  3VYX A;  2L3J A;  2EJ4 A;  2N8X A;  2EM5 A;  2EN8 A;  2FGG A;  2EM2 A;  4R2A A;  4P7D A;  4DR7 E;  1A1I A;  3VK6 A;  2DB2 A;  2EPR A;  3J80 C;  4LF7 E;  2NAB A;  2EE8 A;  4JI2 E;  4TUI A;  1N34 E;  2V88 A;  1A1K A;  3EPL A;  1RMD A;  4LTY A;  5LLQ A;  1WRJ A;  3AV0 A;  5LMU E;  3FIG A;  4WSP A;  2EOX A;  4DV5 E;  5A6B A;  4B3T E;  1YYK A;  2E1M A;  1TN9 A;  4DV7 E;  2JP9 A;  2EMA A;  2NUE A;  4B3M E;  2WBU A;  2DGC A;  2EOI A;  2L2K B;  1QU6 A;  1G2F C;  2LTS A;  1TF3 A;  4HEI A;  4LFC E;  2EMW A;  3IWB A;  4DV3 E;  4M0V A;  2JWO A;  2B9D A;  2V8Q B;  1TF6 A;  3EPJ A;  4DR4 E;  3IWC A;  4WXC A;  2EPC A;  5AC4 A;  2EQ3 A;  2L3C A;  2WBT A;  4LF9 E;  4AQY E;  1X49 A;  1YPN A;  3RMP A;  4KHP E;  4DMI A;  2EOY A;  3KZZ A;  3IWD A;  2YSO A;  1DI2 A;  4DR2 E;  3HXL A;  3JTZ A;  4KZS A;  1MGT A;  2EOS A;  3BF2 A;  2EL5 A;  5FLX C;  2K4V A;  2CTD A;  2YRM A;  2L92 A;  2ODR D;  3QG5 C;  3HTX A;  4O5G A;  2HHH E;  2JY9 A;  2VQE E;  4DR6 E;  4R2R A;  2R1F A;  2EQ0 A;  5TSE A;  1T4O A;  1N33 E;  2MC5 A;  2EM3 A;  2EMZ A;  3KWR A;  1P47 A;  2EPA A;  2LO3 A;  1KYQ A;  2EML A;  2JVA A;  1HNZ E;  1UIL A;  1XMO E;  2YTN A;  1MEY C;  4JI7 E;  2EMF A;  1STU A;  3UK3 C;  2LRS A;  2CSH A;  1BB8 A;  3LLH A;  4NXN E;  1AH5 A;  1X6F A;  1PJT A;  5IWA E;  2ADR A;  2F8B A;  5DNY A;  5IXM B;  1DGC A;  1WXR A;  3ADG A;  4JI5 E;  1N32 E;  4O4K A;  2MKN A;  2MKD A;  1HNW E;  2EM6 A;  3AUZ A;  2YU8 A;  4R03 A;  2GPI A;  4FK5 C;  3F6H A;  4LF6 E;  3THO B;  2RS7 A;  3M99 B;  4LF8 E;  4HTG A;  4JI4 E;  2EOH A;  3THN A;  1HR0 E;  2YZT A;  2NA2 A;  3JU0 A;  4I8O A;  1X6H A;  2YTI A;  3TQM A;  4BS9 A;  4GZN C;  5AC5 A;  4X62 E;  5F3W A;  3ADI A;  1JK1 A;  2I13 A;  2LE2 A;  2M4I A;  4X66 E;  4WX9 A;  2M1S A;  2EPZ A;  1G2D C;  2EOZ A;  2YU5 A;  4JI3 E;  1X5W A;  3DF6 A;  2DRP A;  2DSY A;  2DMY A;  2EM4 A;  2YTD A;  4WFT A;  2EMH A;  4BC7 A;  4L8N A;  2RSI A;  2LT7 A;  4DV2 E;  3T1H E;  2H36 X;  3ECR A;  1BBG A;  4BMJ A;  2B7T A;  4R2C A;  1O0W A;  4X64 E;  4F6N A;  2ODR C;  5CFF E;  4F54 A;  3C6K A;  1IBM E;  3LML A;  4NHR A;  2EM8 A;  4R2P A;  1XNQ E;  2EPO A;  4IJD A;  2YTG A;  5A6B D;  4DUZ E;  4RHB B;  4X9J A;  1DQ3 A;  2EPN A;  3BBG A;  5A69 A;  4F6M A;  2D9H A;  1T39 A;  2EMI A;  3VHT B;  2L6M A;  3ADJ A;  3EPK A;  2YSP A;  4Q28 A;  4YY3 E;  1FJG E;  2EOJ A;  1T4L B;  3BID A;  1RQ0 A;  2BBG A;  3C6M A;  1YUJ A;  4GKK E;  5A2Q C;  1ZR9 A;  2JOB A;  2EOM A;  4Q35 B;  2MDR A;  2YTE A;  3HPS A;  2WBS A;  2YRH A;  2V83 A;  1UBD C;  1YZ9 A;  5KL7 A;  2YRK A;  5KL3 A;  2WZO A;  1ZBQ A;  2LJU A;  3KZY A;  2FTX B;  4ZYE A;  2M9A A;  3OTO E;  2VQF E;  1A1H A;  1X3C A;  4F9B B;  2R76 A;  4BHB A;  1ZU1 A;  1QNT A;  1X6E A;  2EPX A;  2EQ1 A;  2EPK X;  2EMG A;  3MSW A;  4DR1 E;  2EN1 A;  4B3S E;  2DLQ A;  2EL4 A;  1WHQ A;  2LJH A;  4DV0 E;  2VE7 C;  4WXD A;  1XNR E;  1YUI A;  3EPH A;  2CPN A;  5IV8 B;  1N36 E;  3MHS C;  2VRD A;  1IQS A;  2EOF A;  1UN6 B;  1EKZ A;  2KON A;  1KJK A;  4DV1 E;  3HQ1 A;  1ZAA C;  1I94 E;  2EPU A;  4GKJ E;  1A1G A;  2LUQ A;  5AAS A;  2DIX A;  4KWY A;  1T4N A;  1GTK A;  2V89 A;  2YWQ A;  2EN3 A;  5AE2 A;  2EMK A;  4R2E A;  5LMN E;  2B3T B;  1IQO A;  4NZV A;  4WYQ B;  2YPN A;  1SFE A;  2EM9 A;  3ADL A;  2UUB E;  2UXD E;  5A6J A;  1J5E E;  1L4S A;  1NEI A;  4P78 A;  2EMC A;  3J7Y p;  1IMU A;  4JI6 E;  2EN6 A;  2LTR A;  4LF5 E;  2UUA E;  2K7I A;  1A1J A;  1ZBT A;  1XMQ E;  2JPA A;  2UU9 E;  1YYO A;  2EOE A;  2YTQ A;  2EMY A;  4DUY E;  4LU9 A;  1X47 A;  2DMI A;  2EN4 A;  5ADZ A;  1B69 A;  2B7V A;  1WJP A;  5LL6 R;  1EH6 A;  4R2D A;  5KL6 A;  5KL2 A;  1T38 A;  1Z1B A;  5BR8 E;  2YT4 A;  4B3R E;  2HC5 A;  3K6Q A;  2V87 A;  2V85 A;  4M2Z A;  4BHC A;  4TUG A;  2EPM X;  2EPL X;  1GQE A;  4GEQ B;  1GZ6 A;  2NUF A;  1PJQ A;  4JV5 E;  4BCA A;  3J81 C;  2EZ6 A;  1X48 A;  5IT9 C;  4YHH E;  2F4V E;  4R2S A;  2YTF A;  5A6A A;  3EQ1 A;  3MHH C;  2EL6 A;  2EOQ A;  2E72 A;  3ZOQ B;  5AE3 A;  4OOG C;  4K0K E;  2UXC E;  4DKK A;  2YTO A;  5AE1 A;  4JI1 E;  4F2J C;  3T1Y E;  3BGH A;  3HPZ A;  4BC9 A;  2YTJ A;  2NUG A;  2M7Q A;  1PDA A;  4X8W A;  2EM7 A;  4LF4 E;  4LFA E;  4OX9 E;  2FV4 B;  2MDG A;  2JYA A;  2KHX A;  1EH8 A;  2L8T A;  4J8Z A;  5A6K A;  1FKA E;  4F9C B;  2LV2 A;  4DR5 E;  2G7H A;  4O43 A;  2IHR 1;  2JXP A;  2RQL A;  2ENC A;  4R2Q A;  2RTX A;  3DJW A;  4MLV A;  2LMZ A;  1PJS A;  4WPY A;  2L33 A;  1PKP A;  1F2I G;  2EPP A;  2MC6 A;  2UUC E;  2V86 A;  2CT1 A;  3H09 A;  3C4T A;  4DV4 E;  3P1X A;  1SR9 A;  2ELY A;  1LLM C;  4JI0 E;  2GHF A;  3OML A;  2EN2 A;  4X65 E;  5T6J A;  4M30 A;  2N3H A;  3C4B A;  1A1F A;  2RS6 A;  2EWL A;  4M9V C;  1BBO A;  1JK2 A;  2LUP B;  1J26 A;  4N4R B;  1HNX E;  2N3G A;  3F6G A;  4ZYG A;  2PRT A;  2JOX A;  4IS1 C;  2LBS B;  2VF1 A;  2ZM6 E;  4NXM E;  3J7A G;  3L00 A;  2EP3 A;  2A25 A;  4JYA E;  2BB8 A;  3JAM C;  2EM0 A;  2GLI A; 
#chains in the Genus database with same CATH homology
 4R2D A;  2ENA A;  5KL2 A;  5KL6 A;  4X9J A;  2LCE A;  2DLK A;  2EOY A;  4F6M A;  2D9H A;  2YSO A;  2EMI A;  3VHT B;  3EPK A;  1Z1B A;  1AAY A;  2YSP A;  2EN7 A;  2J7J A;  2EOJ A;  1A1L A;  2EOS A;  2EL5 A;  2WCC 3;  1YSA C;  2CTD A;  1YUJ A;  1NCS A;  2YRM A;  2YTP A;  2EOO A;  1ZR9 A;  2EOM A;  2ENH A;  2YTE A;  4R2R A;  2WBS A;  2YRH A;  2R1F A;  2EQ0 A;  2RPC A;  1UBD C;  2ELZ A;  4WSG A;  2HGH A;  2EMZ A;  2EM3 A;  2YRK A;  5KL7 A;  5KL3 A;  1P47 A;  2EPA A;  2LO3 A;  2LVH A;  4R2S A;  2YTF A;  2EML A;  2EMX A;  2EOR A;  2EMB A;  2M9A A;  5KL5 A;  2YTN A;  1MEY C;  3MHH C;  5KL4 A;  1A1H A;  2EL6 A;  2EMF A;  2EOQ A;  1X3C A;  3UK3 C;  2CSH A;  1ZU1 A;  2E72 A;  1BB8 A;  2EJ4 A;  1X6E A;  2EPX A;  2YTO A;  2EQ1 A;  2EM5 A;  2EN8 A;  1X6F A;  2EMG A;  2EN1 A;  4F2J C;  2EM2 A;  2DLQ A;  4R2A A;  2EL4 A;  2YTJ A;  2ADR A;  1A1I A;  2EM7 A;  1YUI A;  3EPH A;  2EPR A;  1DGC A;  2NAB A;  2EE8 A;  2MDG A;  3MHS C;  2MKN A;  2MKD A;  2EM6 A;  2YU8 A;  1A1K A;  2VRD A;  4FK5 C;  2LV2 A;  3EPL A;  1RMD A;  2EOF A;  1UN6 B;  3M99 B;  1KJK A;  2EOH A;  1ZAA C;  2EPU A;  2GLI A;  2ENC A;  4R2Q A;  1X6H A;  2YTI A;  4GZN C;  1A1G A;  2EOX A;  1TN9 A;  2JP9 A;  1F2I G;  2EN3 A;  1JK1 A;  2I13 A;  2EMA A;  2EPP A;  2WBU A;  2DGC A;  2CT1 A;  2EMK A;  2EPZ A;  2EOI A;  4R2E A;  1G2D C;  2EOZ A;  2ELY A;  1LLM C;  2GHF A;  2YU5 A;  1G2F C;  1X5W A;  2EN2 A;  2DRP A;  2EM9 A;  1TF3 A;  2EM4 A;  2YTD A;  2EMW A;  2EMH A;  1A1F A;  4M9V C;  2EMC A;  1JK2 A;  2RSI A;  1BBO A;  2LT7 A;  2EN6 A;  1TF6 A;  3EPJ A;  2PRT A;  4IS1 C;  4R2C A;  1A1J A;  2EPC A;  2JPA A;  2EOE A;  2YTQ A;  4F6N A;  2EMY A;  2EP3 A;  2EQ3 A;  2A25 A;  2WBT A;  2DMI A;  2EN4 A;  2BB8 A;  2EM0 A;  1B69 A;  1WJP A;  2EM8 A;  4R2P A;  4IJD A;  2YTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...