4R2QA

Wilms tumor protein (wt1) zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2qA00
2EE8A 5KL3A 4R2RA 2CT1A 4F6MA 1TF3A 2VRDA 2EM8A 2EOMA 2YTFA 1A1GA 2EMXA 2D9HA 2M9AA 2EM4A 1TN9A 5KL2A 2WBSA 1UN6B 2ELZA 2EMBA 3EPHA 2EMKA 3MHHC 2MKDA 4R2AA 4WSGA 2YTOA 2DLKA 1G2FC 2EOHA 3MHSC 2ELYA 2EOYA 3M99B 1YSAC 2EMZA 4IS1C 4R2PA 2EM9A 2EJ4A 2EN7A 2LO3A 4F2JC 2EOJA 2YTIA 4R2DA 2HGHA 1UBDC 2EN6A 2EQ0A 2EPCA 2EPZA 3EPKA 1Z1BA 2RSIA 3EPJA 2EMAA 2YTGA 2R1FA 2LCEA 1JK1A 2MKNA 2EQ3A 2YTDA 1ZAAC 2EM0A 2EOQA 2ENCA 2EOXA 2ENAA 2J7JA 3UK3C 2YSOA 2EP3A 2EPAA 1LLMC 1ZU1A 2BB8A 2EN2A 1BBOA 2EMFA 2RPCA 3EPLA 1RMDA 4R2QA 2EMWA 1A1LA 2YTNA 2EL5A 1A1FA 2EM3A 1A1IA 2EPRA 2DMIA 2EM5A 2EOZA 4R2EA 1JK2A 1BB8A 2WBUA 2EM7A 1AAYA 4IJDA 1A1JA 1G2DC 2GLIA 2PRTA 2WBTA 2EN3A 2YTEA 1P47A 2CTDA 2ENHA 2EPPA 2YTPA 2EN8A 2DRPA 2ADRA 2I13A 2EN4A 4R2SA 2YU8A 2JP9A 1F2IG 2EL4A 1B69A 1X3CA 1DGCA 5KL6A 2LVHA 2A25A 2EMCA 2EOSA 2DGCA 2JPAA 2YRHA 2EMHA 2EQ1A 4R2CA 2EOEA 1YUIA 1X5WA 5KL7A 2NABA 2EM6A 2YRMA 2YU5A 4GZNC 4M9VC 2EMLA 2CSHA 1X6FA 2EL6A 1TF6A 1X6EA 2DLQA 2EOIA 2EOOA 2EORA 2YTJA 3VHTB 5KL4A 2EM2A 2EMGA 2EN1A 2E72A 2EMYA 1X6HA 2LT7A 1MEYC 2YRKA 2WCC3 4FK5C 2YSPA 1A1HA 2EPXA 4X9JA 2EOFA 2GHFA 2EMIA 4F6NA 2YTQA 2LV2A 1NCSA 2MDGA 1ZR9A 1A1KA 1KJKA 1YUJA 2EPUA 1WJPA 5KL5A
chains in the Genus database with same CATH superfamily
2V85A 3ECRA 4F6MA 4F9CB 2FGGA 4KHPE 2B9DA 2EOMA 1A1GA 3ZOQB 3T1YE 2EM4A 4B3ME 2WBSA 2ELZA 2M7QA 2VQFE 1RC7A 2EMKA 2MKDA 3IWDA 4R2AA 2RS7A 5A6AA 1YYWA 2EOHA 4DV1E 2EMZA 1XNRE 2EPNA 4HEIA 1FKAE 1UILA 2LJHA 4N4RB 2KHXA 3EPKA 1AH5A 4O43A 3EPJA 4R03A 2YTGA 2R1FA 4O24A 4BHBA 2L92A 4X62E 1O0WA 2EOXA 1QNTA 4X65E 2J7JA 3UK3C 2YSOA 2EP3A 4MLVA 2K7IA 2NUGA 3C6KA 4LF8E 3RMPA 1QU6A 2BBGA 3EPLA 1PJSA 1ZBQA 4R2QA 2EL5A 2DSYA 1A1FA 2B3TB 3HXLA 1A1IA 1JK2A 2WBUA 1G2DC 4JV5E 4DR1E 2L8TA 2WBTA 2EN3A 4MLQA 2EWLA 2EPPA 2ODRD 2ADRA 4P7DA 5AE1A 3J81C 3P1XA 4R2SA 2JP9A 1F2IG 4DMIA 3ADJA 5A6BD 2A25A 2JOXA 4LFAE 5IXMB 3LLHA 4GKKE 5A6JA 2EQ1A 2EOEA 1X5WA 4WXCA 3HTXA 5KL7A 3KZZA 2EM6A 5CFFE 4GZNC 2EMLA 2RQLA 3KWRA 2DLQA 1X48A 2EOOA 3VHTB 4K0KE 2EMGA 4L5NC 2RSMA 4LU9A 2EN1A 4DR5E 1EH7A 5A6KA 2YRKA 4FK5C 5A6BA 4X66E 2EPXA 3IWCA 3VK6A 4JI1E 2YTQA 3QG5C 2LV2A 1NCSA 2E1MA 3HQ1A 3F6HA 2LRSA 2GPIA 3ADIA 2EE8A 2UU9E 1DI2A 1IMUA 3EQ1A 1TF3A 2EM8A 1YFHA 2EMXA 1PDAA 1UN6B 3J7AG 4X64E 2FTXB 4BBYA 2EMBA 1N3GA 2LTRA 1YYKA 2EOYA 4IS1C 4DV7E 2EJ4A 4F54A 5DNYA 4L8NA 4BC7A 2KONA 4Q28A 3TQMA 2IHR1 1X49A 2N3HA 2LCEA 2YTDA 3OMLA 2EM0A 2EOQA 1IBME 1NEIA 2EPAA 2YZTA 1LLMC 4DV3E 2JY9A 2BB8A 1N32E 1BBOA 4WFTA 2RPCA 5IWAE 4DR4E 1GZ6A 1A1LA 2V88A 2YTNA 4I8OA 4GKJE 2EPRA 4X8WA 1BB8A 2NUFA 2LE2A 4OOGC 4ZYEA 4GEQB 2VQEE 3JAMC 2CPNA 4O4KA 2PRTA 2GLIA 3JU0A 1EH6A 3ADGA 4NXNE 2DRPA 2DMYA 2LUQA 4ZYHA 1B69A 2EL4A 1X3CA 2MDRA 2DGCA 3THNA 2JPAA 4M0VA 2EMHA 4DKKA 4RHBB 4DV4E 4M9VC 2DIXA 1X6EA 1SR9A 2EPKX 1N34E 2B7TA 4P78A 5IV8B 5AC4A 1XNQE 4NZVA 2EMYA 1X6HA 3JTZA 2UUBE 1A1HA 5AASA 2EMIA 1X47A 1GTKA 1YUJA 2RTXA 4RH8A 2V86A 5LMUE 1BBGA 5KL3A 3ADLA 2CT1A 2JVAA 3BF2A 2VRDA 1XMQE 2Q8UA 2D9HA 4WXDA 5KL2A 4O5GA 5BR8E 1J26A 1STUA 5A2QC 2UXBE 1WHNA 4WSPA 4WSGA 1IQOA 2DLKA 2FV4B 3MHSC 2ELYA 1UHZA 3M99B 3HPZA 1T38A 4R2PA 2V87A 1EH8A 4BS9A 1HNZE 2EN7A 4JI2E 5AE3A 5TSEA 4F2JC 2YTIA 4TUGA 1XMOE 4R2DA 2HGHA 2LTSA 2EN6A 4DR2E 2EPCA 2EPZA 1Z1BA 2RSIA 2EMAA 5T6JA 4R8OA 3C4TA 1JK1A 4ZYGA 1T4NA 4DV2E 2HC5A 4DR3E 2ENAA 1L4SA 4JI4E 2EPOA 2E5LE 1ZU1A 3C4BA 2KOUA 4JI5E 2V8QB 2EMFA 2JR1A 1HR0E 4JI6E 1RMDA 1KYQA 1IBKE 1N33E 2EMWA 2NA2A 2VF1A 2EM3A 2DMIA 2EOZA 2L6MA 2LBSB 2EM7A 1AAYA 4IJDA 2F8BA 2V83A 4JI0E 4BMJA 2YTEA 3T1HE 2N3GA 1SFEA 2ENHA 3H09A 2EPLX 2EN8A 2YTPA 1PJQA 3J7Yp 2JYAA 1YZ9A 2I13A 2EN4A 2YPNA 2M1SA 1DGCA 1MGTA 5KL6A 1PJTA 2EOSA 4BHCA 2YRHA 3FIGA 4R2CA 2JXPA 1HNXE 2YRMA 4YY3E 4LF7E 2EZ6A 2EL6A 2WZOA 2EOIA 3C6MA 5KL4A 4WYQB 3BGHA 4JI8E 1T4LB 2G7HA 4DV0E 1HNWE 2L2KB 2WCC3 1YPNA 3VYYA 2YSPA 4Q35B 2LMZA 2YWQA 4X9JA 2EOFA 4B3RE 4HTGA 1I94E 4NXME 2DB2A 4BC9A 1ZR9A 1WJPA 2R76A 5KL5A 4R2RA 5LL6R 3MSWA 2F4VE 2YTFA 2K4VA 2M9AA 1TN9A 2ZM6E 4BCAA 4DUZE 4M30A 4LFBE 2UXDE 1PKPA 4JI3E 4DR7E 4LF9E 1EKZA 1IBLE 3EPHA 3MHHC 5F3WA 2YT4A 4B3TE 2YTOA 2HJJA 5A69A 1G2FC 1YSAC 3DF6A 3VYXA 2EM9A 2MC5A 4WPYA 2LO3A 5FLXC 5AE2A 2EOJA 2ODRC 1UBDC 2EQ0A 2VE7C 4TUIA 2L3JA 4LFCE 2MKNA 2EQ3A 1ZAAC 1WXRA 2ENCA 2H36X 4DV5E 4YHHE 4LF5E 2L2NA 5LMNE 2L3CA 2EN2A 1GQEA 2UUCE 4M2ZA 2LUPB 4WX9A 4JI7E 4ZYDA 3J80C 2EM5A 4R2EA 1T4OA 2LJUA 4DR6E 2B7VA 4B3SE 4DV6E 1A1JA 4F9AB 2I9IA 2UXCE 4KZSA 2V89A 3THOB 1J5EE 1P47A 2CTDA 2L2MA 4NHRA 1WRJA 2UUAE 2JWOA 3BIDA 2YU8A 1YYOA 4F9BB 5IT9C 3BBGA 2LVHA 2N8XA 2EMCA 2M4IA 2NUEA 3DJWA 2L33A 1YUIA 5AC5A 2NABA 2YU5A 1RQ0A 3F6GA 2CSHA 1X6FA 3OTOE 4AQYE 1TF6A 3AV0A 1FJGE 2EORA 2YTJA 3K6QA 1WHQA 1T39A 3KZYA 2EPMX 4OX9E 3LMLA 3L00A 2HHHE 2EM2A 2MC6A 2RS6A 1ZBTA 1IQSA 2E72A 5ADZA 2LT7A 3HPSA 1MEYC 3IWBA 4DUYE 4LF4E 4LF6E 2JOBA 4JYAE 1N36E 1DQ3A 4F6NA 2GHFA 3AUZA 4LTYA 4J8ZA 5LLQA 2MDGA 1A1KA 1KJKA 2EPUA 4KWYA
chains in the Genus database with same CATH topology
2EE8A 5KL3A 4R2RA 2CT1A 4F6MA 1TF3A 2VRDA 2EM8A 2EOMA 2YTFA 1A1GA 2EMXA 2D9HA 2M9AA 2EM4A 1TN9A 5KL2A 2WBSA 1UN6B 2ELZA 2EMBA 3EPHA 2EMKA 3MHHC 2MKDA 4R2AA 4WSGA 2YTOA 2DLKA 1G2FC 2EOHA 3MHSC 2ELYA 2EOYA 3M99B 1YSAC 2EMZA 4IS1C 4R2PA 2EM9A 2EJ4A 2EN7A 2LO3A 4F2JC 2EOJA 2YTIA 4R2DA 2HGHA 1UBDC 2EN6A 2EQ0A 2EPCA 2EPZA 3EPKA 1Z1BA 2RSIA 3EPJA 2EMAA 2YTGA 2R1FA 2LCEA 1JK1A 2MKNA 2EQ3A 2YTDA 1ZAAC 2EM0A 2EOQA 2ENCA 2EOXA 2ENAA 2J7JA 3UK3C 2YSOA 2EP3A 2EPAA 1LLMC 1ZU1A 2BB8A 2EN2A 1BBOA 2EMFA 2RPCA 3EPLA 1RMDA 4R2QA 2EMWA 1A1LA 2YTNA 2EL5A 1A1FA 2EM3A 1A1IA 2EPRA 2DMIA 2EM5A 2EOZA 4R2EA 1JK2A 1BB8A 2WBUA 2EM7A 1AAYA 4IJDA 1A1JA 1G2DC 2GLIA 2PRTA 2WBTA 2EN3A 2YTEA 1P47A 2CTDA 2ENHA 2EPPA 2YTPA 2EN8A 2DRPA 2ADRA 2I13A 2EN4A 4R2SA 2YU8A 2JP9A 1F2IG 2EL4A 1B69A 1X3CA 1DGCA 5KL6A 2LVHA 2A25A 2EMCA 2EOSA 2DGCA 2JPAA 2YRHA 2EMHA 2EQ1A 4R2CA 2EOEA 1YUIA 1X5WA 5KL7A 2NABA 2EM6A 2YRMA 2YU5A 4GZNC 4M9VC 2EMLA 2CSHA 1X6FA 2EL6A 1TF6A 1X6EA 2DLQA 2EOIA 2EOOA 2EORA 2YTJA 3VHTB 5KL4A 2EM2A 2EMGA 2EN1A 2E72A 2EMYA 1X6HA 2LT7A 1MEYC 2YRKA 2WCC3 4FK5C 2YSPA 1A1HA 2EPXA 4X9JA 2EOFA 2GHFA 2EMIA 4F6NA 2YTQA 2LV2A 1NCSA 2MDGA 1ZR9A 1A1KA 1KJKA 1YUJA 2EPUA 1WJPA 5KL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EE8 A;  5KL3 A;  4R2R A;  2CT1 A;  4F6M A;  1TF3 A;  2VRD A;  2EM8 A;  2EOM A;  2YTF A;  1A1G A;  2EMX A;  2D9H A;  2M9A A;  2EM4 A;  1TN9 A;  5KL2 A;  2WBS A;  1UN6 B;  2ELZ A;  2EMB A;  3EPH A;  2EMK A;  3MHH C;  2MKD A;  4R2A A;  4WSG A;  2YTO A;  2DLK A;  1G2F C;  2EOH A;  3MHS C;  2ELY A;  2EOY A;  3M99 B;  1YSA C;  2EMZ A;  4IS1 C;  4R2P A;  2EM9 A;  2EJ4 A;  2EN7 A;  2LO3 A;  4F2J C;  2EOJ A;  2YTI A;  4R2D A;  2HGH A;  1UBD C;  2EN6 A;  2EQ0 A;  2EPC A;  2EPZ A;  3EPK A;  1Z1B A;  2RSI A;  3EPJ A;  2EMA A;  2YTG A;  2R1F A;  2LCE A;  1JK1 A;  2MKN A;  2EQ3 A;  2YTD A;  1ZAA C;  2EM0 A;  2EOQ A;  2ENC A;  2EOX A;  2ENA A;  2J7J A;  3UK3 C;  2YSO A;  2EP3 A;  2EPA A;  1LLM C;  1ZU1 A;  2BB8 A;  2EN2 A;  1BBO A;  2EMF A;  2RPC A;  3EPL A;  1RMD A;  4R2Q A;  2EMW A;  1A1L A;  2YTN A;  2EL5 A;  1A1F A;  2EM3 A;  1A1I A;  2EPR A;  2DMI A;  2EM5 A;  2EOZ A;  4R2E A;  1JK2 A;  1BB8 A;  2WBU A;  2EM7 A;  1AAY A;  4IJD A;  1A1J A;  1G2D C;  2GLI A;  2PRT A;  2WBT A;  2EN3 A;  2YTE A;  1P47 A;  2CTD A;  2ENH A;  2EPP A;  2YTP A;  2EN8 A;  2DRP A;  2ADR A;  2I13 A;  2EN4 A;  4R2S A;  2YU8 A;  2JP9 A;  1F2I G;  2EL4 A;  1B69 A;  1X3C A;  1DGC A;  5KL6 A;  2LVH A;  2A25 A;  2EMC A;  2EOS A;  2DGC A;  2JPA A;  2YRH A;  2EMH A;  2EQ1 A;  4R2C A;  2EOE A;  1YUI A;  1X5W A;  5KL7 A;  2NAB A;  2EM6 A;  2YRM A;  2YU5 A;  4GZN C;  4M9V C;  2EML A;  2CSH A;  1X6F A;  2EL6 A;  1TF6 A;  1X6E A;  2DLQ A;  2EOI A;  2EOO A;  2EOR A;  2YTJ A;  3VHT B;  5KL4 A;  2EM2 A;  2EMG A;  2EN1 A;  2E72 A;  2EMY A;  1X6H A;  2LT7 A;  1MEY C;  2YRK A;  2WCC 3;  4FK5 C;  2YSP A;  1A1H A;  2EPX A;  4X9J A;  2EOF A;  2GHF A;  2EMI A;  4F6N A;  2YTQ A;  2LV2 A;  1NCS A;  2MDG A;  1ZR9 A;  1A1K A;  1KJK A;  1YUJ A;  2EPU A;  1WJP A;  5KL5 A; 
#chains in the Genus database with same CATH topology
 2V85 A;  3ECR A;  4F6M A;  4F9C B;  2FGG A;  4KHP E;  2B9D A;  2EOM A;  1A1G A;  3ZOQ B;  3T1Y E;  2EM4 A;  4B3M E;  2WBS A;  2ELZ A;  2M7Q A;  2VQF E;  1RC7 A;  2EMK A;  2MKD A;  3IWD A;  4R2A A;  2RS7 A;  5A6A A;  1YYW A;  2EOH A;  4DV1 E;  2EMZ A;  1XNR E;  2EPN A;  4HEI A;  1FKA E;  1UIL A;  2LJH A;  4N4R B;  2KHX A;  3EPK A;  1AH5 A;  4O43 A;  3EPJ A;  4R03 A;  2YTG A;  2R1F A;  4O24 A;  4BHB A;  2L92 A;  4X62 E;  1O0W A;  2EOX A;  1QNT A;  4X65 E;  2J7J A;  3UK3 C;  2YSO A;  2EP3 A;  4MLV A;  2K7I A;  2NUG A;  3C6K A;  4LF8 E;  3RMP A;  1QU6 A;  2BBG A;  3EPL A;  1PJS A;  1ZBQ A;  4R2Q A;  2EL5 A;  2DSY A;  1A1F A;  2B3T B;  3HXL A;  1A1I A;  1JK2 A;  2WBU A;  1G2D C;  4JV5 E;  4DR1 E;  2L8T A;  2WBT A;  2EN3 A;  4MLQ A;  2EWL A;  2EPP A;  2ODR D;  2ADR A;  4P7D A;  5AE1 A;  3J81 C;  3P1X A;  4R2S A;  2JP9 A;  1F2I G;  4DMI A;  3ADJ A;  5A6B D;  2A25 A;  2JOX A;  4LFA E;  5IXM B;  3LLH A;  4GKK E;  5A6J A;  2EQ1 A;  2EOE A;  1X5W A;  4WXC A;  3HTX A;  5KL7 A;  3KZZ A;  2EM6 A;  5CFF E;  4GZN C;  2EML A;  2RQL A;  3KWR A;  2DLQ A;  1X48 A;  2EOO A;  3VHT B;  4K0K E;  2EMG A;  4L5N C;  2RSM A;  4LU9 A;  2EN1 A;  4DR5 E;  1EH7 A;  5A6K A;  2YRK A;  4FK5 C;  5A6B A;  4X66 E;  2EPX A;  3IWC A;  3VK6 A;  4JI1 E;  2YTQ A;  3QG5 C;  2LV2 A;  1NCS A;  2E1M A;  3HQ1 A;  3F6H A;  2LRS A;  2GPI A;  3ADI A;  2EE8 A;  2UU9 E;  1DI2 A;  1IMU A;  3EQ1 A;  1TF3 A;  2EM8 A;  1YFH A;  2EMX A;  1PDA A;  1UN6 B;  3J7A G;  4X64 E;  2FTX B;  4BBY A;  2EMB A;  1N3G A;  2LTR A;  1YYK A;  2EOY A;  4IS1 C;  4DV7 E;  2EJ4 A;  4F54 A;  5DNY A;  4L8N A;  4BC7 A;  2KON A;  4Q28 A;  3TQM A;  2IHR 1;  1X49 A;  2N3H A;  2LCE A;  2YTD A;  3OML A;  2EM0 A;  2EOQ A;  1IBM E;  1NEI A;  2EPA A;  2YZT A;  1LLM C;  4DV3 E;  2JY9 A;  2BB8 A;  1N32 E;  1BBO A;  4WFT A;  2RPC A;  5IWA E;  4DR4 E;  1GZ6 A;  1A1L A;  2V88 A;  2YTN A;  4I8O A;  4GKJ E;  2EPR A;  4X8W A;  1BB8 A;  2NUF A;  2LE2 A;  4OOG C;  4ZYE A;  4GEQ B;  2VQE E;  3JAM C;  2CPN A;  4O4K A;  2PRT A;  2GLI A;  3JU0 A;  1EH6 A;  3ADG A;  4NXN E;  2DRP A;  2DMY A;  2LUQ A;  4ZYH A;  1B69 A;  2EL4 A;  1X3C A;  2MDR A;  2DGC A;  3THN A;  2JPA A;  4M0V A;  2EMH A;  4DKK A;  4RHB B;  4DV4 E;  4M9V C;  2DIX A;  1X6E A;  1SR9 A;  2EPK X;  1N34 E;  2B7T A;  4P78 A;  5IV8 B;  5AC4 A;  1XNQ E;  4NZV A;  2EMY A;  1X6H A;  3JTZ A;  2UUB E;  1A1H A;  5AAS A;  2EMI A;  1X47 A;  1GTK A;  1YUJ A;  2RTX A;  4RH8 A;  2V86 A;  5LMU E;  1BBG A;  5KL3 A;  3ADL A;  2CT1 A;  2JVA A;  3BF2 A;  2VRD A;  1XMQ E;  2Q8U A;  2D9H A;  4WXD A;  5KL2 A;  4O5G A;  5BR8 E;  1J26 A;  1STU A;  5A2Q C;  2UXB E;  1WHN A;  4WSP A;  4WSG A;  1IQO A;  2DLK A;  2FV4 B;  3MHS C;  2ELY A;  1UHZ A;  3M99 B;  3HPZ A;  1T38 A;  4R2P A;  2V87 A;  1EH8 A;  4BS9 A;  1HNZ E;  2EN7 A;  4JI2 E;  5AE3 A;  5TSE A;  4F2J C;  2YTI A;  4TUG A;  1XMO E;  4R2D A;  2HGH A;  2LTS A;  2EN6 A;  4DR2 E;  2EPC A;  2EPZ A;  1Z1B A;  2RSI A;  2EMA A;  5T6J A;  4R8O A;  3C4T A;  1JK1 A;  4ZYG A;  1T4N A;  4DV2 E;  2HC5 A;  4DR3 E;  2ENA A;  1L4S A;  4JI4 E;  2EPO A;  2E5L E;  1ZU1 A;  3C4B A;  2KOU A;  4JI5 E;  2V8Q B;  2EMF A;  2JR1 A;  1HR0 E;  4JI6 E;  1RMD A;  1KYQ A;  1IBK E;  1N33 E;  2EMW A;  2NA2 A;  2VF1 A;  2EM3 A;  2DMI A;  2EOZ A;  2L6M A;  2LBS B;  2EM7 A;  1AAY A;  4IJD A;  2F8B A;  2V83 A;  4JI0 E;  4BMJ A;  2YTE A;  3T1H E;  2N3G A;  1SFE A;  2ENH A;  3H09 A;  2EPL X;  2EN8 A;  2YTP A;  1PJQ A;  3J7Y p;  2JYA A;  1YZ9 A;  2I13 A;  2EN4 A;  2YPN A;  2M1S A;  1DGC A;  1MGT A;  5KL6 A;  1PJT A;  2EOS A;  4BHC A;  2YRH A;  3FIG A;  4R2C A;  2JXP A;  1HNX E;  2YRM A;  4YY3 E;  4LF7 E;  2EZ6 A;  2EL6 A;  2WZO A;  2EOI A;  3C6M A;  5KL4 A;  4WYQ B;  3BGH A;  4JI8 E;  1T4L B;  2G7H A;  4DV0 E;  1HNW E;  2L2K B;  2WCC 3;  1YPN A;  3VYY A;  2YSP A;  4Q35 B;  2LMZ A;  2YWQ A;  4X9J A;  2EOF A;  4B3R E;  4HTG A;  1I94 E;  4NXM E;  2DB2 A;  4BC9 A;  1ZR9 A;  1WJP A;  2R76 A;  5KL5 A;  4R2R A;  5LL6 R;  3MSW A;  2F4V E;  2YTF A;  2K4V A;  2M9A A;  1TN9 A;  2ZM6 E;  4BCA A;  4DUZ E;  4M30 A;  4LFB E;  2UXD E;  1PKP A;  4JI3 E;  4DR7 E;  4LF9 E;  1EKZ A;  1IBL E;  3EPH A;  3MHH C;  5F3W A;  2YT4 A;  4B3T E;  2YTO A;  2HJJ A;  5A69 A;  1G2F C;  1YSA C;  3DF6 A;  3VYX A;  2EM9 A;  2MC5 A;  4WPY A;  2LO3 A;  5FLX C;  5AE2 A;  2EOJ A;  2ODR C;  1UBD C;  2EQ0 A;  2VE7 C;  4TUI A;  2L3J A;  4LFC E;  2MKN A;  2EQ3 A;  1ZAA C;  1WXR A;  2ENC A;  2H36 X;  4DV5 E;  4YHH E;  4LF5 E;  2L2N A;  5LMN E;  2L3C A;  2EN2 A;  1GQE A;  2UUC E;  4M2Z A;  2LUP B;  4WX9 A;  4JI7 E;  4ZYD A;  3J80 C;  2EM5 A;  4R2E A;  1T4O A;  2LJU A;  4DR6 E;  2B7V A;  4B3S E;  4DV6 E;  1A1J A;  4F9A B;  2I9I A;  2UXC E;  4KZS A;  2V89 A;  3THO B;  1J5E E;  1P47 A;  2CTD A;  2L2M A;  4NHR A;  1WRJ A;  2UUA E;  2JWO A;  3BID A;  2YU8 A;  1YYO A;  4F9B B;  5IT9 C;  3BBG A;  2LVH A;  2N8X A;  2EMC A;  2M4I A;  2NUE A;  3DJW A;  2L33 A;  1YUI A;  5AC5 A;  2NAB A;  2YU5 A;  1RQ0 A;  3F6G A;  2CSH A;  1X6F A;  3OTO E;  4AQY E;  1TF6 A;  3AV0 A;  1FJG E;  2EOR A;  2YTJ A;  3K6Q A;  1WHQ A;  1T39 A;  3KZY A;  2EPM X;  4OX9 E;  3LML A;  3L00 A;  2HHH E;  2EM2 A;  2MC6 A;  2RS6 A;  1ZBT A;  1IQS A;  2E72 A;  5ADZ A;  2LT7 A;  3HPS A;  1MEY C;  3IWB A;  4DUY E;  4LF4 E;  4LF6 E;  2JOB A;  4JYA E;  1N36 E;  1DQ3 A;  4F6N A;  2GHF A;  3AUZ A;  4LTY A;  4J8Z A;  5LLQ A;  2MDG A;  1A1K A;  1KJK A;  2EPU A;  4KWY A; 
#chains in the Genus database with same CATH homology
 2EE8 A;  5KL3 A;  4R2R A;  2CT1 A;  4F6M A;  1TF3 A;  2VRD A;  2EM8 A;  2EOM A;  2YTF A;  1A1G A;  2EMX A;  2D9H A;  2M9A A;  2EM4 A;  1TN9 A;  5KL2 A;  2WBS A;  1UN6 B;  2ELZ A;  2EMB A;  3EPH A;  2EMK A;  3MHH C;  2MKD A;  4R2A A;  4WSG A;  2YTO A;  2DLK A;  1G2F C;  2EOH A;  3MHS C;  2ELY A;  2EOY A;  3M99 B;  1YSA C;  2EMZ A;  4IS1 C;  4R2P A;  2EM9 A;  2EJ4 A;  2EN7 A;  2LO3 A;  4F2J C;  2EOJ A;  2YTI A;  4R2D A;  2HGH A;  1UBD C;  2EN6 A;  2EQ0 A;  2EPC A;  2EPZ A;  3EPK A;  1Z1B A;  2RSI A;  3EPJ A;  2EMA A;  2YTG A;  2R1F A;  2LCE A;  1JK1 A;  2MKN A;  2EQ3 A;  2YTD A;  1ZAA C;  2EM0 A;  2EOQ A;  2ENC A;  2EOX A;  2ENA A;  2J7J A;  3UK3 C;  2YSO A;  2EP3 A;  2EPA A;  1LLM C;  1ZU1 A;  2BB8 A;  2EN2 A;  1BBO A;  2EMF A;  2RPC A;  3EPL A;  1RMD A;  4R2Q A;  2EMW A;  1A1L A;  2YTN A;  2EL5 A;  1A1F A;  2EM3 A;  1A1I A;  2EPR A;  2DMI A;  2EM5 A;  2EOZ A;  4R2E A;  1JK2 A;  1BB8 A;  2WBU A;  2EM7 A;  1AAY A;  4IJD A;  1A1J A;  1G2D C;  2GLI A;  2PRT A;  2WBT A;  2EN3 A;  2YTE A;  1P47 A;  2CTD A;  2ENH A;  2EPP A;  2YTP A;  2EN8 A;  2DRP A;  2ADR A;  2I13 A;  2EN4 A;  4R2S A;  2YU8 A;  2JP9 A;  1F2I G;  2EL4 A;  1B69 A;  1X3C A;  1DGC A;  5KL6 A;  2LVH A;  2A25 A;  2EMC A;  2EOS A;  2DGC A;  2JPA A;  2YRH A;  2EMH A;  2EQ1 A;  4R2C A;  2EOE A;  1YUI A;  1X5W A;  5KL7 A;  2NAB A;  2EM6 A;  2YRM A;  2YU5 A;  4GZN C;  4M9V C;  2EML A;  2CSH A;  1X6F A;  2EL6 A;  1TF6 A;  1X6E A;  2DLQ A;  2EOI A;  2EOO A;  2EOR A;  2YTJ A;  3VHT B;  5KL4 A;  2EM2 A;  2EMG A;  2EN1 A;  2E72 A;  2EMY A;  1X6H A;  2LT7 A;  1MEY C;  2YRK A;  2WCC 3;  4FK5 C;  2YSP A;  1A1H A;  2EPX A;  4X9J A;  2EOF A;  2GHF A;  2EMI A;  4F6N A;  2YTQ A;  2LV2 A;  1NCS A;  2MDG A;  1ZR9 A;  1A1K A;  1KJK A;  1YUJ A;  2EPU A;  1WJP A;  5KL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...