4R2QA

Wilms tumor protein (wt1) zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2qA00
2ENCA 4R2CA 2EMLA 2YSOA 2EOQA 4X9JA 2DGCA 1A1LA 4IJDA 5KL7A 2MKNA 2LV2A 2EN7A 4R2DA 2DLQA 5KL5A 1X6FA 1Z1BA 1ZR9A 5KL2A 1DGCA 2ELYA 1TF3A 1TN9A 2EL5A 5KL4A 2JPAA 3MHHC 2WBSA 2EN2A 2YTNA 2EOEA 5KL3A 4R2EA 2EMFA 2EMKA 3EPKA 1WJPA 2EPCA 3EPJA 2PRTA 1AAYA 2DRPA 2EL6A 2YTFA 2EOZA 2GHFA 2EOIA 2YTIA 1G2FC 2EPRA 4R2PA 1UBDC 1ZU1A 2EN1A 2M9AA 2EQ1A 2LO3A 3M99B 1A1KA 2EMCA 2WCC3 3MHSC 2BB8A 1MEYC 2EL4A 2EN3A 2EM6A 2EQ0A 2YSPA 2YTOA 4R2QA 1LLMC 1X5WA 4F2JC 1A1JA 2YTEA 1UN6B 1A1HA 2EM0A 2DLKA 2EP3A 2EQ3A 4WSGA 4GZNC 4FK5C 2JP9A 2EN8A 1YUIA 2ENHA 2LVHA 1F2IG 2NABA 2YRKA 2YTPA 3VHTB 2EPZA 2EMBA 1TF6A 1JK2A 1X6EA 2EMHA 2ADRA 2EM2A 4R2SA 1B69A 2YRHA 5KL6A 2CTDA 2EOSA 2EOHA 2LCEA 4R2AA 2ENAA 2EPXA 4M9VC 2EM8A 2CSHA 4R2RA 1A1FA 1YSAC 1G2DC 2EOYA 2EMGA 2YTGA 2EOXA 2D9HA 2J7JA 2EMWA 2EMXA 2HGHA 4IS1C 2MKDA 2EPUA 2EJ4A 2EMYA 2VRDA 3EPHA 2EMZA 2YRMA 1A1IA 2YTQA 1ZAAC 1RMDA 3EPLA 1P47A 1KJKA 2EM3A 2EOOA 2LT7A 1JK1A 2EOFA 2R1FA 2YTDA 2EPPA 2EOMA 2A25A 2RPCA 2E72A 1BB8A 2ELZA 2EMAA 2EN6A 4F6NA 2EE8A 2YTJA 1YUJA 2YU8A 1NCSA 1A1GA 2CT1A 2EM4A 2I13A 2RSIA 2EM5A 2YU5A 1X3CA 2EN4A 2MDGA 2EM9A 2DMIA 2EPAA 2WBTA 2EM7A 1X6HA 1BBOA 3UK3C 2GLIA 4F6MA 2EMIA 2EORA 2WBUA 2EOJA
chains in the Genus database with same CATH superfamily
2B7TA 2DSYA 1N34E 2EOQA 2DGCA 1A1LA 1YYWA 3ADIA 2BBGA 2N8XA 2LV2A 2HHHE 3HPZA 2DLQA 4BC7A 1X6FA 5KL5A 1Z1BA 5AC4A 1DGCA 2ELYA 3MHHC 2JVAA 4LF8E 4NXNE 4YY3E 4ZYHA 5LLQA 1N36E 5A6JA 1DQ3A 4WYQB 4RHBB 2EPCA 1AAYA 2YTFA 2LUPB 2EPNA 1XMOE 3P1XA 2LBSB 2GHFA 4TUIA 1ZBQA 4X64E 3ADJA 4LF4E 2EN1A 2LO3A 1GZ6A 2WCC3 2YT4A 3MHSC 4N4RB 1MEYC 2EL4A 2EQ0A 4MLQA 4R2QA 4F2JC 4OOGC 1IQOA 5IT9C 4WPYA 2EP3A 2JP9A 3J7AG 2DIXA 2EN8A 1YUIA 3QG5C 2B3TB 2V86A 2L92A 4LFAE 4R8OA 3BBGA 2F4VE 3TQMA 5BR8E 2ADRA 1XNRE 5KL6A 2KOUA 4GEQB 4MLVA 2EOHA 1X48A 2LCEA 3J81C 3LLHA 2EM8A 4R2RA 1A1FA 1G2DC 2V83A 2WZOA 3JAMC 2J7JA 2HGHA 4JI0E 2MKDA 3RMPA 2EPUA 3MSWA 1UILA 5IXMB 3JU0A 4LU9A 3ADLA 3ZOQB 1YZ9A 1T39A 1IMUA 3EPLA 2VQFE 4I8OA 1KJKA 2LT7A 1JK1A 2DMYA 1IQSA 2YPNA 4KZSA 2L33A 2VF1A 2KHXA 2EOMA 3C6MA 2A25A 2RPCA 2E72A 4LF7E 2LTSA 3THNA 3LMLA 2JYAA 2YU8A 4DR3E 4KHPE 4LTYA 5LMNE 4DR1E 1T4NA 4JI7E 2EM5A 2YU5A 4NHRA 1X3CA 2EN4A 2EM9A 3C6KA 4L8NA 4B3RE 1L4SA 1WRJA 2E1MA 2UU9E 3F6GA 2YWQA 4DUYE 4R2CA 2EMLA 2UUCE 4X9JA 1YPNA 4F54A 5KL7A 4DV1E 2MKNA 2FTXB 1NEIA 3T1YE 3AUZA 4ZYGA 2R76A 5KL2A 4X62E 1TF3A 5KL4A 2YTNA 4HEIA 2EZ6A 2DB2A 2VE7C 4JV5E 1ZBTA 2RS6A 3KWRA 1HNWE 4DKKA 1G2FC 2F8BA 1UBDC 2M9AA 3M99B 3K6QA 1A1KA 4WXDA 1IBME 2FV4B 1UHZA 2BB8A 2YTOA 2YSPA 1A1JA 4DV0E 3J80C 3C4TA 1A1HA 2EM0A 1QU6A 2H36X 4M2ZA 1F2IG 5AE1A 3VHTB 4BC9A 2EPZA 2LE2A 1TF6A 1X6EA 2ODRC 4DV4E 2CTDA 1FJGE 4F9CB 4AQYE 4LFBE 2K7IA 1PDAA 2EPXA 4R2AA 4P78A 4M9VC 4O5GA 1HNZE 3HTXA 3VYXA 2YTGA 1FKAE 5TSEA 1N33E 4X66E 2EJ4A 2VRDA 1EKZA 1YFHA 1A1IA 2YTQA 2CPNA 2L2KB 1RC7A 2LMZA 3BIDA 2EM3A 2LJUA 3F6HA 1N3GA 2EOFA 2ODRD 3L00A 2JOBA 3DJWA 2UUAE 2MC5A 4P7DA 2V85A 1EH7A 1QNTA 1HR0E 2EMAA 3IWCA 3VYYA 2KONA 2NUFA 2EE8A 4DV2E 4JI4E 4DR4E 5A6KA 1A1GA 1SR9A 4OX9E 1WXRA 2LTRA 3T1HE 2MDGA 2DMIA 2EPAA 2JR1A 4DUZE 2EPLX 4JI3E 3BGHA 3KZZA 1X6HA 4HTGA 3UK3C 5A2QC 2I9IA 1DI2A 3OMLA 1IBLE 2YSOA 4WX9A 2LRSA 2EWLA 2JY9A 3IWDA 5IV8B 2JPAA 2NA2A 1WHNA 2HC5A 2EL5A 4O43A 2EN2A 2JXPA 2EOEA 5KL3A 4BHCA 4R2EA 5FLXC 2EMFA 2EMKA 2VQEE 4BMJA 3EPKA 5IWAE 3EPJA 2EPMX 5AC5A 2EOZA 3HQ1A 2L2NA 2M7QA 2RQLA 4R2PA 4NZVA 4DR6E 1ZU1A 1EH8A 2EQ1A 4DV7E 2EN3A 2EM6A 1X49A 4X8WA 1PJSA 2N3GA 4K0KE 1IBKE 2EQ3A 4WSGA 4GZNC 4GKKE 4DV3E 2NUEA 5F3WA 4DR7E 4LF9E 2L6MA 2IHR1 2YTPA 3THOB 2EMBA 5A69A 1JK2A 2M1SA 1B69A 3H09A 4BS9A 4B3TE 2EOSA 4DR5E 2ENAA 2CSHA 1YSAC 2EOYA 3ADGA 3HXLA 4ZYEA 1EH6A 4JYAE 2B9DA 2D9HA 4DR2E 2EMXA 4DV6E 3HPSA 4IS1C 4O24A 3ECRA 2L3JA 2EMYA 4LF5E 5AE3A 2V87A 3EPHA 4DV5E 4M0VA 1T4LB 1ZAAC 2MDRA 2EOOA 3EQ1A 2LJHA 2R1FA 4WSPA 3C4BA 1I94E 2EPPA 4Q28A 4YHHE 2ELZA 2EN6A 2MC6A 4J8ZA 1N32E 2YTJA 1YUJA 4JI5E 4TUGA 2UXBE 1GQEA 1J5EE 4L5NC 3IWBA 4O4KA 2RSIA 2YZTA 4KWYA 3J7Yp 2FGGA 2WBTA 2EM7A 3BF2A 2RSMA 2ZM6E 2RS7A 2JWOA 2GLIA 2EORA 2WBUA 2EOJA 1YYKA 5T6JA 1XMQE 2ENCA 5A6BA 2B7VA 2EPOA 5AASA 1PJQA 5CFFE 4DMIA 3VK6A 2L2MA 4IJDA 4BCAA 2EN7A 4R2DA 4JI1E 1KYQA 4GKJE 2UXDE 2E5LE 1X47A 4ZYDA 1T4OA 1ZR9A 1TN9A 4WFTA 2WBSA 3DF6A 1PJTA 4WXCA 4B3SE 2M4IA 1WJPA 2V89A 2PRTA 1SFEA 2DRPA 2EL6A 3JTZA 4RH8A 2EOIA 2YTIA 2L3CA 2EPRA 2L8TA 2UUBE 5A6BD 2EMCA 3KZYA 1HNXE 1LLMC 1X5WA 2YTEA 1UN6B 5DNYA 2DLKA 4F9AB 4NXME 1GTKA 4FK5C 2K4VA 2N3HA 2ENHA 5A6AA 2LVHA 1RQ0A 2NABA 2YRKA 4JI8E 2EMHA 2EM2A 4R2SA 2YRHA 1XNQE 2Q8UA 4Q35B 2V88A 4B3ME 2EMGA 2HJJA 1BBGA 4X65E 2EOXA 4F9BB 2EMWA 1T38A 1YYOA 2LUQA 2JOXA 5ADZA 2EMZA 2YRMA 5LMUE 3AV0A 1RMDA 1P47A 4BHBA 4BBYA 3OTOE 5AE2A 4LFCE 2YTDA 1J26A 1BB8A 4F6NA 1PKPA 1STUA 4JI6E 4R03A 1NCSA 5LL6R 1AH5A 2CT1A 2NUGA 2V8QB 1O0WA 2EPKX 2EM4A 2I13A 2UXCE 2G7HA 1WHQA 2RTXA 1MGTA 2GPIA 1BBOA 4M30A 4JI2E 4F6MA 2EMIA 4LF6E 3FIGA
chains in the Genus database with same CATH topology
2ENCA 4R2CA 2EMLA 2YSOA 2EOQA 4X9JA 2DGCA 1A1LA 4IJDA 5KL7A 2MKNA 2LV2A 2EN7A 4R2DA 2DLQA 5KL5A 1X6FA 1Z1BA 1ZR9A 5KL2A 1DGCA 2ELYA 1TF3A 1TN9A 2EL5A 5KL4A 2JPAA 3MHHC 2WBSA 2EN2A 2YTNA 2EOEA 5KL3A 4R2EA 2EMFA 2EMKA 3EPKA 1WJPA 2EPCA 3EPJA 2PRTA 1AAYA 2DRPA 2EL6A 2YTFA 2EOZA 2GHFA 2EOIA 2YTIA 1G2FC 2EPRA 4R2PA 1UBDC 1ZU1A 2EN1A 2M9AA 2EQ1A 2LO3A 3M99B 1A1KA 2EMCA 2WCC3 3MHSC 2BB8A 1MEYC 2EL4A 2EN3A 2EM6A 2EQ0A 2YSPA 2YTOA 4R2QA 1LLMC 1X5WA 4F2JC 1A1JA 2YTEA 1UN6B 1A1HA 2EM0A 2DLKA 2EP3A 2EQ3A 4WSGA 4GZNC 4FK5C 2JP9A 2EN8A 1YUIA 2ENHA 2LVHA 1F2IG 2NABA 2YRKA 2YTPA 3VHTB 2EPZA 2EMBA 1TF6A 1JK2A 1X6EA 2EMHA 2ADRA 2EM2A 4R2SA 1B69A 2YRHA 5KL6A 2CTDA 2EOSA 2EOHA 2LCEA 4R2AA 2ENAA 2EPXA 4M9VC 2EM8A 2CSHA 4R2RA 1A1FA 1YSAC 1G2DC 2EOYA 2EMGA 2YTGA 2EOXA 2D9HA 2J7JA 2EMWA 2EMXA 2HGHA 4IS1C 2MKDA 2EPUA 2EJ4A 2EMYA 2VRDA 3EPHA 2EMZA 2YRMA 1A1IA 2YTQA 1ZAAC 1RMDA 3EPLA 1P47A 1KJKA 2EM3A 2EOOA 2LT7A 1JK1A 2EOFA 2R1FA 2YTDA 2EPPA 2EOMA 2A25A 2RPCA 2E72A 1BB8A 2ELZA 2EMAA 2EN6A 4F6NA 2EE8A 2YTJA 1YUJA 2YU8A 1NCSA 1A1GA 2CT1A 2EM4A 2I13A 2RSIA 2EM5A 2YU5A 1X3CA 2EN4A 2MDGA 2EM9A 2DMIA 2EPAA 2WBTA 2EM7A 1X6HA 1BBOA 3UK3C 2GLIA 4F6MA 2EMIA 2EORA 2WBUA 2EOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENC A;  4R2C A;  2EML A;  2YSO A;  2EOQ A;  4X9J A;  2DGC A;  1A1L A;  4IJD A;  5KL7 A;  2MKN A;  2LV2 A;  2EN7 A;  4R2D A;  2DLQ A;  5KL5 A;  1X6F A;  1Z1B A;  1ZR9 A;  5KL2 A;  1DGC A;  2ELY A;  1TF3 A;  1TN9 A;  2EL5 A;  5KL4 A;  2JPA A;  3MHH C;  2WBS A;  2EN2 A;  2YTN A;  2EOE A;  5KL3 A;  4R2E A;  2EMF A;  2EMK A;  3EPK A;  1WJP A;  2EPC A;  3EPJ A;  2PRT A;  1AAY A;  2DRP A;  2EL6 A;  2YTF A;  2EOZ A;  2GHF A;  2EOI A;  2YTI A;  1G2F C;  2EPR A;  4R2P A;  1UBD C;  1ZU1 A;  2EN1 A;  2M9A A;  2EQ1 A;  2LO3 A;  3M99 B;  1A1K A;  2EMC A;  2WCC 3;  3MHS C;  2BB8 A;  1MEY C;  2EL4 A;  2EN3 A;  2EM6 A;  2EQ0 A;  2YSP A;  2YTO A;  4R2Q A;  1LLM C;  1X5W A;  4F2J C;  1A1J A;  2YTE A;  1UN6 B;  1A1H A;  2EM0 A;  2DLK A;  2EP3 A;  2EQ3 A;  4WSG A;  4GZN C;  4FK5 C;  2JP9 A;  2EN8 A;  1YUI A;  2ENH A;  2LVH A;  1F2I G;  2NAB A;  2YRK A;  2YTP A;  3VHT B;  2EPZ A;  2EMB A;  1TF6 A;  1JK2 A;  1X6E A;  2EMH A;  2ADR A;  2EM2 A;  4R2S A;  1B69 A;  2YRH A;  5KL6 A;  2CTD A;  2EOS A;  2EOH A;  2LCE A;  4R2A A;  2ENA A;  2EPX A;  4M9V C;  2EM8 A;  2CSH A;  4R2R A;  1A1F A;  1YSA C;  1G2D C;  2EOY A;  2EMG A;  2YTG A;  2EOX A;  2D9H A;  2J7J A;  2EMW A;  2EMX A;  2HGH A;  4IS1 C;  2MKD A;  2EPU A;  2EJ4 A;  2EMY A;  2VRD A;  3EPH A;  2EMZ A;  2YRM A;  1A1I A;  2YTQ A;  1ZAA C;  1RMD A;  3EPL A;  1P47 A;  1KJK A;  2EM3 A;  2EOO A;  2LT7 A;  1JK1 A;  2EOF A;  2R1F A;  2YTD A;  2EPP A;  2EOM A;  2A25 A;  2RPC A;  2E72 A;  1BB8 A;  2ELZ A;  2EMA A;  2EN6 A;  4F6N A;  2EE8 A;  2YTJ A;  1YUJ A;  2YU8 A;  1NCS A;  1A1G A;  2CT1 A;  2EM4 A;  2I13 A;  2RSI A;  2EM5 A;  2YU5 A;  1X3C A;  2EN4 A;  2MDG A;  2EM9 A;  2DMI A;  2EPA A;  2WBT A;  2EM7 A;  1X6H A;  1BBO A;  3UK3 C;  2GLI A;  4F6M A;  2EMI A;  2EOR A;  2WBU A;  2EOJ A; 
#chains in the Genus database with same CATH topology
 2B7T A;  2DSY A;  1N34 E;  2EOQ A;  2DGC A;  1A1L A;  1YYW A;  3ADI A;  2BBG A;  2N8X A;  2LV2 A;  2HHH E;  3HPZ A;  2DLQ A;  4BC7 A;  1X6F A;  5KL5 A;  1Z1B A;  5AC4 A;  1DGC A;  2ELY A;  3MHH C;  2JVA A;  4LF8 E;  4NXN E;  4YY3 E;  4ZYH A;  5LLQ A;  1N36 E;  5A6J A;  1DQ3 A;  4WYQ B;  4RHB B;  2EPC A;  1AAY A;  2YTF A;  2LUP B;  2EPN A;  1XMO E;  3P1X A;  2LBS B;  2GHF A;  4TUI A;  1ZBQ A;  4X64 E;  3ADJ A;  4LF4 E;  2EN1 A;  2LO3 A;  1GZ6 A;  2WCC 3;  2YT4 A;  3MHS C;  4N4R B;  1MEY C;  2EL4 A;  2EQ0 A;  4MLQ A;  4R2Q A;  4F2J C;  4OOG C;  1IQO A;  5IT9 C;  4WPY A;  2EP3 A;  2JP9 A;  3J7A G;  2DIX A;  2EN8 A;  1YUI A;  3QG5 C;  2B3T B;  2V86 A;  2L92 A;  4LFA E;  4R8O A;  3BBG A;  2F4V E;  3TQM A;  5BR8 E;  2ADR A;  1XNR E;  5KL6 A;  2KOU A;  4GEQ B;  4MLV A;  2EOH A;  1X48 A;  2LCE A;  3J81 C;  3LLH A;  2EM8 A;  4R2R A;  1A1F A;  1G2D C;  2V83 A;  2WZO A;  3JAM C;  2J7J A;  2HGH A;  4JI0 E;  2MKD A;  3RMP A;  2EPU A;  3MSW A;  1UIL A;  5IXM B;  3JU0 A;  4LU9 A;  3ADL A;  3ZOQ B;  1YZ9 A;  1T39 A;  1IMU A;  3EPL A;  2VQF E;  4I8O A;  1KJK A;  2LT7 A;  1JK1 A;  2DMY A;  1IQS A;  2YPN A;  4KZS A;  2L33 A;  2VF1 A;  2KHX A;  2EOM A;  3C6M A;  2A25 A;  2RPC A;  2E72 A;  4LF7 E;  2LTS A;  3THN A;  3LML A;  2JYA A;  2YU8 A;  4DR3 E;  4KHP E;  4LTY A;  5LMN E;  4DR1 E;  1T4N A;  4JI7 E;  2EM5 A;  2YU5 A;  4NHR A;  1X3C A;  2EN4 A;  2EM9 A;  3C6K A;  4L8N A;  4B3R E;  1L4S A;  1WRJ A;  2E1M A;  2UU9 E;  3F6G A;  2YWQ A;  4DUY E;  4R2C A;  2EML A;  2UUC E;  4X9J A;  1YPN A;  4F54 A;  5KL7 A;  4DV1 E;  2MKN A;  2FTX B;  1NEI A;  3T1Y E;  3AUZ A;  4ZYG A;  2R76 A;  5KL2 A;  4X62 E;  1TF3 A;  5KL4 A;  2YTN A;  4HEI A;  2EZ6 A;  2DB2 A;  2VE7 C;  4JV5 E;  1ZBT A;  2RS6 A;  3KWR A;  1HNW E;  4DKK A;  1G2F C;  2F8B A;  1UBD C;  2M9A A;  3M99 B;  3K6Q A;  1A1K A;  4WXD A;  1IBM E;  2FV4 B;  1UHZ A;  2BB8 A;  2YTO A;  2YSP A;  1A1J A;  4DV0 E;  3J80 C;  3C4T A;  1A1H A;  2EM0 A;  1QU6 A;  2H36 X;  4M2Z A;  1F2I G;  5AE1 A;  3VHT B;  4BC9 A;  2EPZ A;  2LE2 A;  1TF6 A;  1X6E A;  2ODR C;  4DV4 E;  2CTD A;  1FJG E;  4F9C B;  4AQY E;  4LFB E;  2K7I A;  1PDA A;  2EPX A;  4R2A A;  4P78 A;  4M9V C;  4O5G A;  1HNZ E;  3HTX A;  3VYX A;  2YTG A;  1FKA E;  5TSE A;  1N33 E;  4X66 E;  2EJ4 A;  2VRD A;  1EKZ A;  1YFH A;  1A1I A;  2YTQ A;  2CPN A;  2L2K B;  1RC7 A;  2LMZ A;  3BID A;  2EM3 A;  2LJU A;  3F6H A;  1N3G A;  2EOF A;  2ODR D;  3L00 A;  2JOB A;  3DJW A;  2UUA E;  2MC5 A;  4P7D A;  2V85 A;  1EH7 A;  1QNT A;  1HR0 E;  2EMA A;  3IWC A;  3VYY A;  2KON A;  2NUF A;  2EE8 A;  4DV2 E;  4JI4 E;  4DR4 E;  5A6K A;  1A1G A;  1SR9 A;  4OX9 E;  1WXR A;  2LTR A;  3T1H E;  2MDG A;  2DMI A;  2EPA A;  2JR1 A;  4DUZ E;  2EPL X;  4JI3 E;  3BGH A;  3KZZ A;  1X6H A;  4HTG A;  3UK3 C;  5A2Q C;  2I9I A;  1DI2 A;  3OML A;  1IBL E;  2YSO A;  4WX9 A;  2LRS A;  2EWL A;  2JY9 A;  3IWD A;  5IV8 B;  2JPA A;  2NA2 A;  1WHN A;  2HC5 A;  2EL5 A;  4O43 A;  2EN2 A;  2JXP A;  2EOE A;  5KL3 A;  4BHC A;  4R2E A;  5FLX C;  2EMF A;  2EMK A;  2VQE E;  4BMJ A;  3EPK A;  5IWA E;  3EPJ A;  2EPM X;  5AC5 A;  2EOZ A;  3HQ1 A;  2L2N A;  2M7Q A;  2RQL A;  4R2P A;  4NZV A;  4DR6 E;  1ZU1 A;  1EH8 A;  2EQ1 A;  4DV7 E;  2EN3 A;  2EM6 A;  1X49 A;  4X8W A;  1PJS A;  2N3G A;  4K0K E;  1IBK E;  2EQ3 A;  4WSG A;  4GZN C;  4GKK E;  4DV3 E;  2NUE A;  5F3W A;  4DR7 E;  4LF9 E;  2L6M A;  2IHR 1;  2YTP A;  3THO B;  2EMB A;  5A69 A;  1JK2 A;  2M1S A;  1B69 A;  3H09 A;  4BS9 A;  4B3T E;  2EOS A;  4DR5 E;  2ENA A;  2CSH A;  1YSA C;  2EOY A;  3ADG A;  3HXL A;  4ZYE A;  1EH6 A;  4JYA E;  2B9D A;  2D9H A;  4DR2 E;  2EMX A;  4DV6 E;  3HPS A;  4IS1 C;  4O24 A;  3ECR A;  2L3J A;  2EMY A;  4LF5 E;  5AE3 A;  2V87 A;  3EPH A;  4DV5 E;  4M0V A;  1T4L B;  1ZAA C;  2MDR A;  2EOO A;  3EQ1 A;  2LJH A;  2R1F A;  4WSP A;  3C4B A;  1I94 E;  2EPP A;  4Q28 A;  4YHH E;  2ELZ A;  2EN6 A;  2MC6 A;  4J8Z A;  1N32 E;  2YTJ A;  1YUJ A;  4JI5 E;  4TUG A;  2UXB E;  1GQE A;  1J5E E;  4L5N C;  3IWB A;  4O4K A;  2RSI A;  2YZT A;  4KWY A;  3J7Y p;  2FGG A;  2WBT A;  2EM7 A;  3BF2 A;  2RSM A;  2ZM6 E;  2RS7 A;  2JWO A;  2GLI A;  2EOR A;  2WBU A;  2EOJ A;  1YYK A;  5T6J A;  1XMQ E;  2ENC A;  5A6B A;  2B7V A;  2EPO A;  5AAS A;  1PJQ A;  5CFF E;  4DMI A;  3VK6 A;  2L2M A;  4IJD A;  4BCA A;  2EN7 A;  4R2D A;  4JI1 E;  1KYQ A;  4GKJ E;  2UXD E;  2E5L E;  1X47 A;  4ZYD A;  1T4O A;  1ZR9 A;  1TN9 A;  4WFT A;  2WBS A;  3DF6 A;  1PJT A;  4WXC A;  4B3S E;  2M4I A;  1WJP A;  2V89 A;  2PRT A;  1SFE A;  2DRP A;  2EL6 A;  3JTZ A;  4RH8 A;  2EOI A;  2YTI A;  2L3C A;  2EPR A;  2L8T A;  2UUB E;  5A6B D;  2EMC A;  3KZY A;  1HNX E;  1LLM C;  1X5W A;  2YTE A;  1UN6 B;  5DNY A;  2DLK A;  4F9A B;  4NXM E;  1GTK A;  4FK5 C;  2K4V A;  2N3H A;  2ENH A;  5A6A A;  2LVH A;  1RQ0 A;  2NAB A;  2YRK A;  4JI8 E;  2EMH A;  2EM2 A;  4R2S A;  2YRH A;  1XNQ E;  2Q8U A;  4Q35 B;  2V88 A;  4B3M E;  2EMG A;  2HJJ A;  1BBG A;  4X65 E;  2EOX A;  4F9B B;  2EMW A;  1T38 A;  1YYO A;  2LUQ A;  2JOX A;  5ADZ A;  2EMZ A;  2YRM A;  5LMU E;  3AV0 A;  1RMD A;  1P47 A;  4BHB A;  4BBY A;  3OTO E;  5AE2 A;  4LFC E;  2YTD A;  1J26 A;  1BB8 A;  4F6N A;  1PKP A;  1STU A;  4JI6 E;  4R03 A;  1NCS A;  5LL6 R;  1AH5 A;  2CT1 A;  2NUG A;  2V8Q B;  1O0W A;  2EPK X;  2EM4 A;  2I13 A;  2UXC E;  2G7H A;  1WHQ A;  2RTX A;  1MGT A;  2GPI A;  1BBO A;  4M30 A;  4JI2 E;  4F6M A;  2EMI A;  4LF6 E;  3FIG A; 
#chains in the Genus database with same CATH homology
 2ENC A;  4R2C A;  2EML A;  2YSO A;  2EOQ A;  4X9J A;  2DGC A;  1A1L A;  4IJD A;  5KL7 A;  2MKN A;  2LV2 A;  2EN7 A;  4R2D A;  2DLQ A;  5KL5 A;  1X6F A;  1Z1B A;  1ZR9 A;  5KL2 A;  1DGC A;  2ELY A;  1TF3 A;  1TN9 A;  2EL5 A;  5KL4 A;  2JPA A;  3MHH C;  2WBS A;  2EN2 A;  2YTN A;  2EOE A;  5KL3 A;  4R2E A;  2EMF A;  2EMK A;  3EPK A;  1WJP A;  2EPC A;  3EPJ A;  2PRT A;  1AAY A;  2DRP A;  2EL6 A;  2YTF A;  2EOZ A;  2GHF A;  2EOI A;  2YTI A;  1G2F C;  2EPR A;  4R2P A;  1UBD C;  1ZU1 A;  2EN1 A;  2M9A A;  2EQ1 A;  2LO3 A;  3M99 B;  1A1K A;  2EMC A;  2WCC 3;  3MHS C;  2BB8 A;  1MEY C;  2EL4 A;  2EN3 A;  2EM6 A;  2EQ0 A;  2YSP A;  2YTO A;  4R2Q A;  1LLM C;  1X5W A;  4F2J C;  1A1J A;  2YTE A;  1UN6 B;  1A1H A;  2EM0 A;  2DLK A;  2EP3 A;  2EQ3 A;  4WSG A;  4GZN C;  4FK5 C;  2JP9 A;  2EN8 A;  1YUI A;  2ENH A;  2LVH A;  1F2I G;  2NAB A;  2YRK A;  2YTP A;  3VHT B;  2EPZ A;  2EMB A;  1TF6 A;  1JK2 A;  1X6E A;  2EMH A;  2ADR A;  2EM2 A;  4R2S A;  1B69 A;  2YRH A;  5KL6 A;  2CTD A;  2EOS A;  2EOH A;  2LCE A;  4R2A A;  2ENA A;  2EPX A;  4M9V C;  2EM8 A;  2CSH A;  4R2R A;  1A1F A;  1YSA C;  1G2D C;  2EOY A;  2EMG A;  2YTG A;  2EOX A;  2D9H A;  2J7J A;  2EMW A;  2EMX A;  2HGH A;  4IS1 C;  2MKD A;  2EPU A;  2EJ4 A;  2EMY A;  2VRD A;  3EPH A;  2EMZ A;  2YRM A;  1A1I A;  2YTQ A;  1ZAA C;  1RMD A;  3EPL A;  1P47 A;  1KJK A;  2EM3 A;  2EOO A;  2LT7 A;  1JK1 A;  2EOF A;  2R1F A;  2YTD A;  2EPP A;  2EOM A;  2A25 A;  2RPC A;  2E72 A;  1BB8 A;  2ELZ A;  2EMA A;  2EN6 A;  4F6N A;  2EE8 A;  2YTJ A;  1YUJ A;  2YU8 A;  1NCS A;  1A1G A;  2CT1 A;  2EM4 A;  2I13 A;  2RSI A;  2EM5 A;  2YU5 A;  1X3C A;  2EN4 A;  2MDG A;  2EM9 A;  2DMI A;  2EPA A;  2WBT A;  2EM7 A;  1X6H A;  1BBO A;  3UK3 C;  2GLI A;  4F6M A;  2EMI A;  2EOR A;  2WBU A;  2EOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...