2VRDA

The structure of the zinc finger from the human spliceosomal protein u1c
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure and Biochemical Properties of the Human Spliceosomal Protein U1C
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN C
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06220 zf-U1 U1 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2vrdA00
2WCC3 2YRKA 2M9AA 2YTGA 1X6EA 2YTQA 5KL2A 2EQ3A 2EE8A 4X9JA 4R2SA 1A1HA 2EM6A 1F2IG 2YTOA 1ZR9A 2DMIA 2ENCA 2LVHA 3MHHC 2LCEA 2RPCA 2EMYA 3EPKA 2EM5A 1TF3A 2D9HA 2EP3A 3EPHA 2CTDA 2JP9A 2CT1A 1A1GA 2EMCA 1RMDA 2EPRA 2EMWA 1G2DC 2NABA 1UBDC 2EM3A 1BBOA 2EQ1A 2YTPA 1YUJA 1A1FA 2DGCA 2EPZA 2GLIA 2EM2A 4R2DA 2PRTA 4R2CA 2EJ4A 4R2EA 5KL4A 1P47A 3EPJA 1X3CA 2R1FA 2EM8A 2RSIA 4F2JC 2YU5A 1YSAC 4WSGA 2EN1A 2YRHA 1B69A 2YTFA 1MEYC 1NCSA 2EOSA 2EM0A 2EMBA 1AAYA 2EPXA 2EOIA 2ENHA 2VRDA 5KL6A 2LO3A 1ZAAC 2EQ0A 2EOXA 4F6MA 2EMKA 2EMFA 4IS1C 1UN6B 2ELZA 4GZNC 2EN4A 2YSPA 2MKDA 2WBUA 2EMXA 2EM9A 1YUIA 1ZU1A 2EL4A 3MHSC 2EOZA 1JK1A 2LV2A 4F6NA 3M99B 4R2AA 4M9VC 2YSOA 1BB8A 1A1LA 2YTJA 1A1JA 4IJDA 2EN6A 2EOMA 1DGCA 2WBSA 2ENAA 4R2PA 2EPUA 1X5WA 2ELYA 2CSHA 1JK2A 2EPCA 2EORA 2EMHA 1X6HA 2EM7A 2JPAA 2EOOA 2EN3A 2DRPA 2EOHA 2EL6A 3VHTB 2ADRA 2EN7A 1TF6A 1TN9A 2EN2A 5KL5A 2YTNA 2EN8A 3EPLA 5KL7A 1A1KA 2YU8A 2YTEA 1G2FC 2EMAA 2MDGA 2EOEA 2EOFA 2YTIA 2EL5A 2EM4A 5KL3A 2WBTA 2LT7A 2I13A 2E72A 2EPAA 4R2RA 1Z1BA 2DLQA 1KJKA 2GHFA 2J7JA 2MKNA 2EMZA 2A25A 1X6FA 2EOYA 1A1IA 4FK5C 2BB8A 2EMLA 3UK3C 2EMGA 4R2QA 2DLKA 2YTDA 1WJPA 2EOQA 1LLMC 2HGHA 2EOJA 2EPPA 2YRMA 2EMIA
chains in the Genus database with same CATH superfamily
4ZYHA 2YRKA 4JI5E 2YTQA 5KL2A 2EE8A 4X9JA 2V83A 2ZM6E 2FV4B 2YTOA 3MHHC 2DMIA 4HEIA 2LE2A 3EPKA 3H09A 2D9HA 1QU6A 2EP3A 4DR2E 2CT1A 3ADJA 3LMLA 2EMWA 1RMDA 3DF6A 1G2DC 2NA2A 3HPSA 5A6JA 2GLIA 2L2NA 4R2CA 2EJ4A 4M30A 4BMJA 1PJTA 5KL4A 3MSWA 2PRTA 1P47A 4RH8A 4WFTA 2RSIA 3VYYA 2LMZA 2YU5A 5F3WA 1EH6A 5A6BA 2EN1A 2LRSA 5LLQA 2YRHA 2YTFA 2LUPB 4Q35B 2EOSA 4X64E 2B9DA 1AAYA 3ADLA 2EPXA 2DIXA 2ENHA 2JVAA 1PJQA 2VRDA 5KL6A 1XMOE 2LO3A 5IT9C 1ZAAC 1N3GA 2V8QB 1XNQE 1UILA 5DNYA 2EMFA 4X65E 4IS1C 1N32E 1UN6B 2V88A 1YYOA 3J81C 2EM9A 1WXRA 4DV5E 2EL4A 2K4VA 4KZSA 5AE1A 2LJUA 3HPZA 2LV2A 2JOBA 2LUQA 3M99B 1T4NA 4M9VC 1BB8A 2I9IA 3JAMC 3AV0A 1HNXE 3J80C 2ENAA 3VYXA 5A6AA 2VQEE 2L2MA 2CSHA 2ODRC 4JI2E 2EMHA 1X6HA 1GZ6A 1N36E 2JPAA 2EN3A 2EOOA 2DRPA 2EL6A 1TF6A 2KONA 4J8ZA 1J5EE 2EN2A 1XMQE 4B3ME 2L8TA 2EN8A 3EPLA 5KL7A 1YYWA 2YU8A 2YTEA 2EMAA 3DJWA 4JI0E 2DSYA 2LT7A 1SR9A 2EL5A 2EPNA 5KL3A 2UXDE 1IMUA 2EPAA 4LU9A 5IV8B 4R2RA 1L4SA 2VE7C 4YHHE 4R03A 3C6KA 4LF5E 4DUZE 1X6FA 1A1IA 2BB8A 3UK3C 4WXCA 3KWRA 4DV2E 2YTDA 5AE3A 4GKKE 2M4IA 1BBGA 2EPPA 1IBME 2E5LE 2YRMA 2EMIA 1PJSA 2WCC3 2LBSB 2ODRD 1RC7A 2GPIA 3THNA 2EM6A 1F2IG 2BBGA 4BCAA 4P7DA 3IWDA 2MDRA 2FGGA 1KYQA 4DR7E 2EMYA 1TF3A 1WRJA 4DV3E 3EPHA 3T1YE 1A1GA 2EPRA 2NABA 2DB2A 1RQ0A 1FKAE 2CPNA 2UUCE 4DR6E 5AE2A 3VK6A 2M1SA 4F2JC 2LTSA 4MLVA 4WSGA 2IHR1 1YSAC 4BC9A 1QNTA 2K7IA 4BHCA 4DUYE 3IWBA 4NZVA 1IBLE 1YZ9A 1WHQA 2JR1A 4O24A 2F8BA 2EOXA 1O0WA 4LFCE 2EN4A 2WBUA 2EMXA 4LF8E 1EH8A 1ZU1A 4DKKA 1GTKA 2EOZA 4WX9A 1JK1A 4BS9A 3C6MA 4R2AA 2YSOA 4RHBB 2LJHA 4F9BB 2YTJA 4BC7A 4IJDA 4LF9E 2EN6A 2EOMA 2HJJA 1DGCA 4F54A 2L3JA 1X5WA 2ELYA 1T39A 5AASA 4JI6E 4NXME 1X49A 4HTGA 3VHTB 2G7HA 1TN9A 2ADRA 4AQYE 2L33A 2UUAE 5KL5A 4X8WA 4KHPE 3BGHA 2HHHE 2E1MA 2F4VE 2EOEA 2EOFA 1IQOA 2E72A 5IXMB 1Z1BA 4L5NC 3C4TA 3F6GA 1KJKA 1YYKA 2YWQA 2GHFA 2J7JA 3IWCA 2VF1A 4ZYDA 1N34E 2Q8UA 2A25A 5A6BD 4L8NA 4B3TE 2EMGA 1YPNA 4TUGA 1UHZA 4DV7E 2HGHA 5TSEA 3T1HE 4ZYGA 2L2KB 4OX9E 1XNRE 2B3TB 1FJGE 1SFEA 3TQMA 2M9AA 4M2ZA 1X6EA 2HC5A 4R2SA 4O4KA 2V89A 3J7AG 1MGTA 1ZR9A 4LFAE 2LCEA 2RPCA 2CTDA 2JP9A 3ADGA 4DV1E 1HNWE 1IBKE 1UBDC 2EM3A 3K6QA 2YTPA 3HQ1A 1T38A 1A1FA 1J26A 2UXCE 2B7TA 2EM2A 4R2EA 3EPJA 1X3CA 1EKZA 5LMUE 4NHRA 4DMIA 5AC5A 5LMNE 3KZZA 4F9AB 1B69A 1MEYC 1NCSA 3BBGA 5T6JA 2EOIA 4KWYA 3RMPA 2RTXA 4F6MA 2JWOA 1HNZE 3ECRA 2ELZA 2MKDA 2N8XA 4YY3E 5A6KA 3MHSC 2M7QA 1DQ3A 4NXNE 4DR1E 2UU9E 5LL6R 3JTZA 5IWAE 4LTYA 4N4RB 2RS6A 2EPUA 4OOGC 4JI3E 1N33E 2EPCA 2EORA 2L92A 2EM7A 2RSMA 4DR3E 4JV5E 4WYQB 1DI2A 2DMYA 2YTNA 2UXBE 1GQEA 4F9CB 3EQ1A 2JYAA 1PDAA 4WXDA 1G2FC 2EPOA 2WBTA 2I13A 2YT4A 2NUFA 2DLQA 2N3HA 3HXLA 4JYAE 2H36X 3F6HA 3P1XA 2MKNA 2MC6A 5ADZA 2UUBE 1X48A 2WZOA 4R2QA 2EZ6A 1WJPA 4B3RE 1LLMC 3HTXA 2NUEA 1ZBQA 2EOJA 5CFFE 4WPYA 2NUGA 4DV0E 3ZOQB 3KZYA 4LF4E 1HR0E 1T4OA 2YTGA 4BHBA 2EQ3A 4JI7E 1A1HA 4I8OA 3THOB 4DV6E 4O5GA 3OTOE 2LVHA 2ENCA 2KHXA 4JI1E 3J7Yp 2EM5A 2EPMX 1NEIA 2L3CA 1ZBTA 2JOXA 2EMCA 2LTRA 1BBOA 2EQ1A 1YUJA 4B3SE 2DGCA 2EPZA 4O43A 2V87A 3BIDA 4R2DA 2R1FA 2JY9A 1X47A 4X62E 2EM8A 4LF7E 4BBYA 2L6MA 4LF6E 4DR5E 4TUIA 4ZYEA 2VQFE 2N3GA 3ADIA 2EM0A 2EWLA 2EMBA 1WHNA 1EH7A 2EQ0A 2EPLX 2V86A 5A2QC 2EMKA 1T4LB 3AUZA 3FIGA 4GZNC 2YSPA 1YUIA 5AC4A 3LLHA 2MC5A 4F6NA 2EPKX 1A1LA 4Q28A 4M0VA 1A1JA 3BF2A 2WBSA 1I94E 1PKPA 2RQLA 4MLQA 4R2PA 1JK2A 1YFHA 4WSPA 4X66E 4LFBE 2V85A 2EOHA 2EN7A 4P78A 2YPNA 4JI4E 5BR8E 5FLXC 4DR4E 4DV4E 1A1KA 2RS7A 2YTIA 2MDGA 2EM4A 1STUA 2B7VA 4R8OA 4K0KE 2JXPA 5A69A 1AH5A 4JI8E 3QG5C 3L00A 2YZTA 2EMZA 2KOUA 3C4BA 3OMLA 2EOYA 4FK5C 2EMLA 2FTXB 4GEQB 2DLKA 2EOQA 2R76A 1IQSA 3JU0A 4GKJE
chains in the Genus database with same CATH topology
2WCC3 2YRKA 2M9AA 2YTGA 1X6EA 2YTQA 5KL2A 2EQ3A 2EE8A 4X9JA 4R2SA 1A1HA 2EM6A 1F2IG 2YTOA 1ZR9A 2DMIA 2ENCA 2LVHA 3MHHC 2LCEA 2RPCA 2EMYA 3EPKA 2EM5A 1TF3A 2D9HA 2EP3A 3EPHA 2CTDA 2JP9A 2CT1A 1A1GA 2EMCA 1RMDA 2EPRA 2EMWA 1G2DC 2NABA 1UBDC 2EM3A 1BBOA 2EQ1A 2YTPA 1YUJA 1A1FA 2DGCA 2EPZA 2GLIA 2EM2A 4R2DA 2PRTA 4R2CA 2EJ4A 4R2EA 5KL4A 1P47A 3EPJA 1X3CA 2R1FA 2EM8A 2RSIA 4F2JC 2YU5A 1YSAC 4WSGA 2EN1A 2YRHA 1B69A 2YTFA 1MEYC 1NCSA 2EOSA 2EM0A 2EMBA 1AAYA 2EPXA 2EOIA 2ENHA 2VRDA 5KL6A 2LO3A 1ZAAC 2EQ0A 2EOXA 4F6MA 2EMKA 2EMFA 4IS1C 1UN6B 2ELZA 4GZNC 2EN4A 2YSPA 2MKDA 2WBUA 2EMXA 2EM9A 1YUIA 1ZU1A 2EL4A 3MHSC 2EOZA 1JK1A 2LV2A 4F6NA 3M99B 4R2AA 4M9VC 2YSOA 1BB8A 1A1LA 2YTJA 1A1JA 4IJDA 2EN6A 2EOMA 1DGCA 2WBSA 2ENAA 4R2PA 2EPUA 1X5WA 2ELYA 2CSHA 1JK2A 2EPCA 2EORA 2EMHA 1X6HA 2EM7A 2JPAA 2EOOA 2EN3A 2DRPA 2EOHA 2EL6A 3VHTB 2ADRA 2EN7A 1TF6A 1TN9A 2EN2A 5KL5A 2YTNA 2EN8A 3EPLA 5KL7A 1A1KA 2YU8A 2YTEA 1G2FC 2EMAA 2MDGA 2EOEA 2EOFA 2YTIA 2EL5A 2EM4A 5KL3A 2WBTA 2LT7A 2I13A 2E72A 2EPAA 4R2RA 1Z1BA 2DLQA 1KJKA 2GHFA 2J7JA 2MKNA 2EMZA 2A25A 1X6FA 2EOYA 1A1IA 4FK5C 2BB8A 2EMLA 3UK3C 2EMGA 4R2QA 2DLKA 2YTDA 1WJPA 2EOQA 1LLMC 2HGHA 2EOJA 2EPPA 2YRMA 2EMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCC 3;  2YRK A;  2M9A A;  2YTG A;  1X6E A;  2YTQ A;  5KL2 A;  2EQ3 A;  2EE8 A;  4X9J A;  4R2S A;  1A1H A;  2EM6 A;  1F2I G;  2YTO A;  1ZR9 A;  2DMI A;  2ENC A;  2LVH A;  3MHH C;  2LCE A;  2RPC A;  2EMY A;  3EPK A;  2EM5 A;  1TF3 A;  2D9H A;  2EP3 A;  3EPH A;  2CTD A;  2JP9 A;  2CT1 A;  1A1G A;  2EMC A;  1RMD A;  2EPR A;  2EMW A;  1G2D C;  2NAB A;  1UBD C;  2EM3 A;  1BBO A;  2EQ1 A;  2YTP A;  1YUJ A;  1A1F A;  2DGC A;  2EPZ A;  2GLI A;  2EM2 A;  4R2D A;  2PRT A;  4R2C A;  2EJ4 A;  4R2E A;  5KL4 A;  1P47 A;  3EPJ A;  1X3C A;  2R1F A;  2EM8 A;  2RSI A;  4F2J C;  2YU5 A;  1YSA C;  4WSG A;  2EN1 A;  2YRH A;  1B69 A;  2YTF A;  1MEY C;  1NCS A;  2EOS A;  2EM0 A;  2EMB A;  1AAY A;  2EPX A;  2EOI A;  2ENH A;  2VRD A;  5KL6 A;  2LO3 A;  1ZAA C;  2EQ0 A;  2EOX A;  4F6M A;  2EMK A;  2EMF A;  4IS1 C;  1UN6 B;  2ELZ A;  4GZN C;  2EN4 A;  2YSP A;  2MKD A;  2WBU A;  2EMX A;  2EM9 A;  1YUI A;  1ZU1 A;  2EL4 A;  3MHS C;  2EOZ A;  1JK1 A;  2LV2 A;  4F6N A;  3M99 B;  4R2A A;  4M9V C;  2YSO A;  1BB8 A;  1A1L A;  2YTJ A;  1A1J A;  4IJD A;  2EN6 A;  2EOM A;  1DGC A;  2WBS A;  2ENA A;  4R2P A;  2EPU A;  1X5W A;  2ELY A;  2CSH A;  1JK2 A;  2EPC A;  2EOR A;  2EMH A;  1X6H A;  2EM7 A;  2JPA A;  2EOO A;  2EN3 A;  2DRP A;  2EOH A;  2EL6 A;  3VHT B;  2ADR A;  2EN7 A;  1TF6 A;  1TN9 A;  2EN2 A;  5KL5 A;  2YTN A;  2EN8 A;  3EPL A;  5KL7 A;  1A1K A;  2YU8 A;  2YTE A;  1G2F C;  2EMA A;  2MDG A;  2EOE A;  2EOF A;  2YTI A;  2EL5 A;  2EM4 A;  5KL3 A;  2WBT A;  2LT7 A;  2I13 A;  2E72 A;  2EPA A;  4R2R A;  1Z1B A;  2DLQ A;  1KJK A;  2GHF A;  2J7J A;  2MKN A;  2EMZ A;  2A25 A;  1X6F A;  2EOY A;  1A1I A;  4FK5 C;  2BB8 A;  2EML A;  3UK3 C;  2EMG A;  4R2Q A;  2DLK A;  2YTD A;  1WJP A;  2EOQ A;  1LLM C;  2HGH A;  2EOJ A;  2EPP A;  2YRM A;  2EMI A; 
#chains in the Genus database with same CATH topology
 4ZYH A;  2YRK A;  4JI5 E;  2YTQ A;  5KL2 A;  2EE8 A;  4X9J A;  2V83 A;  2ZM6 E;  2FV4 B;  2YTO A;  3MHH C;  2DMI A;  4HEI A;  2LE2 A;  3EPK A;  3H09 A;  2D9H A;  1QU6 A;  2EP3 A;  4DR2 E;  2CT1 A;  3ADJ A;  3LML A;  2EMW A;  1RMD A;  3DF6 A;  1G2D C;  2NA2 A;  3HPS A;  5A6J A;  2GLI A;  2L2N A;  4R2C A;  2EJ4 A;  4M30 A;  4BMJ A;  1PJT A;  5KL4 A;  3MSW A;  2PRT A;  1P47 A;  4RH8 A;  4WFT A;  2RSI A;  3VYY A;  2LMZ A;  2YU5 A;  5F3W A;  1EH6 A;  5A6B A;  2EN1 A;  2LRS A;  5LLQ A;  2YRH A;  2YTF A;  2LUP B;  4Q35 B;  2EOS A;  4X64 E;  2B9D A;  1AAY A;  3ADL A;  2EPX A;  2DIX A;  2ENH A;  2JVA A;  1PJQ A;  2VRD A;  5KL6 A;  1XMO E;  2LO3 A;  5IT9 C;  1ZAA C;  1N3G A;  2V8Q B;  1XNQ E;  1UIL A;  5DNY A;  2EMF A;  4X65 E;  4IS1 C;  1N32 E;  1UN6 B;  2V88 A;  1YYO A;  3J81 C;  2EM9 A;  1WXR A;  4DV5 E;  2EL4 A;  2K4V A;  4KZS A;  5AE1 A;  2LJU A;  3HPZ A;  2LV2 A;  2JOB A;  2LUQ A;  3M99 B;  1T4N A;  4M9V C;  1BB8 A;  2I9I A;  3JAM C;  3AV0 A;  1HNX E;  3J80 C;  2ENA A;  3VYX A;  5A6A A;  2VQE E;  2L2M A;  2CSH A;  2ODR C;  4JI2 E;  2EMH A;  1X6H A;  1GZ6 A;  1N36 E;  2JPA A;  2EN3 A;  2EOO A;  2DRP A;  2EL6 A;  1TF6 A;  2KON A;  4J8Z A;  1J5E E;  2EN2 A;  1XMQ E;  4B3M E;  2L8T A;  2EN8 A;  3EPL A;  5KL7 A;  1YYW A;  2YU8 A;  2YTE A;  2EMA A;  3DJW A;  4JI0 E;  2DSY A;  2LT7 A;  1SR9 A;  2EL5 A;  2EPN A;  5KL3 A;  2UXD E;  1IMU A;  2EPA A;  4LU9 A;  5IV8 B;  4R2R A;  1L4S A;  2VE7 C;  4YHH E;  4R03 A;  3C6K A;  4LF5 E;  4DUZ E;  1X6F A;  1A1I A;  2BB8 A;  3UK3 C;  4WXC A;  3KWR A;  4DV2 E;  2YTD A;  5AE3 A;  4GKK E;  2M4I A;  1BBG A;  2EPP A;  1IBM E;  2E5L E;  2YRM A;  2EMI A;  1PJS A;  2WCC 3;  2LBS B;  2ODR D;  1RC7 A;  2GPI A;  3THN A;  2EM6 A;  1F2I G;  2BBG A;  4BCA A;  4P7D A;  3IWD A;  2MDR A;  2FGG A;  1KYQ A;  4DR7 E;  2EMY A;  1TF3 A;  1WRJ A;  4DV3 E;  3EPH A;  3T1Y E;  1A1G A;  2EPR A;  2NAB A;  2DB2 A;  1RQ0 A;  1FKA E;  2CPN A;  2UUC E;  4DR6 E;  5AE2 A;  3VK6 A;  2M1S A;  4F2J C;  2LTS A;  4MLV A;  4WSG A;  2IHR 1;  1YSA C;  4BC9 A;  1QNT A;  2K7I A;  4BHC A;  4DUY E;  3IWB A;  4NZV A;  1IBL E;  1YZ9 A;  1WHQ A;  2JR1 A;  4O24 A;  2F8B A;  2EOX A;  1O0W A;  4LFC E;  2EN4 A;  2WBU A;  2EMX A;  4LF8 E;  1EH8 A;  1ZU1 A;  4DKK A;  1GTK A;  2EOZ A;  4WX9 A;  1JK1 A;  4BS9 A;  3C6M A;  4R2A A;  2YSO A;  4RHB B;  2LJH A;  4F9B B;  2YTJ A;  4BC7 A;  4IJD A;  4LF9 E;  2EN6 A;  2EOM A;  2HJJ A;  1DGC A;  4F54 A;  2L3J A;  1X5W A;  2ELY A;  1T39 A;  5AAS A;  4JI6 E;  4NXM E;  1X49 A;  4HTG A;  3VHT B;  2G7H A;  1TN9 A;  2ADR A;  4AQY E;  2L33 A;  2UUA E;  5KL5 A;  4X8W A;  4KHP E;  3BGH A;  2HHH E;  2E1M A;  2F4V E;  2EOE A;  2EOF A;  1IQO A;  2E72 A;  5IXM B;  1Z1B A;  4L5N C;  3C4T A;  3F6G A;  1KJK A;  1YYK A;  2YWQ A;  2GHF A;  2J7J A;  3IWC A;  2VF1 A;  4ZYD A;  1N34 E;  2Q8U A;  2A25 A;  5A6B D;  4L8N A;  4B3T E;  2EMG A;  1YPN A;  4TUG A;  1UHZ A;  4DV7 E;  2HGH A;  5TSE A;  3T1H E;  4ZYG A;  2L2K B;  4OX9 E;  1XNR E;  2B3T B;  1FJG E;  1SFE A;  3TQM A;  2M9A A;  4M2Z A;  1X6E A;  2HC5 A;  4R2S A;  4O4K A;  2V89 A;  3J7A G;  1MGT A;  1ZR9 A;  4LFA E;  2LCE A;  2RPC A;  2CTD A;  2JP9 A;  3ADG A;  4DV1 E;  1HNW E;  1IBK E;  1UBD C;  2EM3 A;  3K6Q A;  2YTP A;  3HQ1 A;  1T38 A;  1A1F A;  1J26 A;  2UXC E;  2B7T A;  2EM2 A;  4R2E A;  3EPJ A;  1X3C A;  1EKZ A;  5LMU E;  4NHR A;  4DMI A;  5AC5 A;  5LMN E;  3KZZ A;  4F9A B;  1B69 A;  1MEY C;  1NCS A;  3BBG A;  5T6J A;  2EOI A;  4KWY A;  3RMP A;  2RTX A;  4F6M A;  2JWO A;  1HNZ E;  3ECR A;  2ELZ A;  2MKD A;  2N8X A;  4YY3 E;  5A6K A;  3MHS C;  2M7Q A;  1DQ3 A;  4NXN E;  4DR1 E;  2UU9 E;  5LL6 R;  3JTZ A;  5IWA E;  4LTY A;  4N4R B;  2RS6 A;  2EPU A;  4OOG C;  4JI3 E;  1N33 E;  2EPC A;  2EOR A;  2L92 A;  2EM7 A;  2RSM A;  4DR3 E;  4JV5 E;  4WYQ B;  1DI2 A;  2DMY A;  2YTN A;  2UXB E;  1GQE A;  4F9C B;  3EQ1 A;  2JYA A;  1PDA A;  4WXD A;  1G2F C;  2EPO A;  2WBT A;  2I13 A;  2YT4 A;  2NUF A;  2DLQ A;  2N3H A;  3HXL A;  4JYA E;  2H36 X;  3F6H A;  3P1X A;  2MKN A;  2MC6 A;  5ADZ A;  2UUB E;  1X48 A;  2WZO A;  4R2Q A;  2EZ6 A;  1WJP A;  4B3R E;  1LLM C;  3HTX A;  2NUE A;  1ZBQ A;  2EOJ A;  5CFF E;  4WPY A;  2NUG A;  4DV0 E;  3ZOQ B;  3KZY A;  4LF4 E;  1HR0 E;  1T4O A;  2YTG A;  4BHB A;  2EQ3 A;  4JI7 E;  1A1H A;  4I8O A;  3THO B;  4DV6 E;  4O5G A;  3OTO E;  2LVH A;  2ENC A;  2KHX A;  4JI1 E;  3J7Y p;  2EM5 A;  2EPM X;  1NEI A;  2L3C A;  1ZBT A;  2JOX A;  2EMC A;  2LTR A;  1BBO A;  2EQ1 A;  1YUJ A;  4B3S E;  2DGC A;  2EPZ A;  4O43 A;  2V87 A;  3BID A;  4R2D A;  2R1F A;  2JY9 A;  1X47 A;  4X62 E;  2EM8 A;  4LF7 E;  4BBY A;  2L6M A;  4LF6 E;  4DR5 E;  4TUI A;  4ZYE A;  2VQF E;  2N3G A;  3ADI A;  2EM0 A;  2EWL A;  2EMB A;  1WHN A;  1EH7 A;  2EQ0 A;  2EPL X;  2V86 A;  5A2Q C;  2EMK A;  1T4L B;  3AUZ A;  3FIG A;  4GZN C;  2YSP A;  1YUI A;  5AC4 A;  3LLH A;  2MC5 A;  4F6N A;  2EPK X;  1A1L A;  4Q28 A;  4M0V A;  1A1J A;  3BF2 A;  2WBS A;  1I94 E;  1PKP A;  2RQL A;  4MLQ A;  4R2P A;  1JK2 A;  1YFH A;  4WSP A;  4X66 E;  4LFB E;  2V85 A;  2EOH A;  2EN7 A;  4P78 A;  2YPN A;  4JI4 E;  5BR8 E;  5FLX C;  4DR4 E;  4DV4 E;  1A1K A;  2RS7 A;  2YTI A;  2MDG A;  2EM4 A;  1STU A;  2B7V A;  4R8O A;  4K0K E;  2JXP A;  5A69 A;  1AH5 A;  4JI8 E;  3QG5 C;  3L00 A;  2YZT A;  2EMZ A;  2KOU A;  3C4B A;  3OML A;  2EOY A;  4FK5 C;  2EML A;  2FTX B;  4GEQ B;  2DLK A;  2EOQ A;  2R76 A;  1IQS A;  3JU0 A;  4GKJ E; 
#chains in the Genus database with same CATH homology
 2WCC 3;  2YRK A;  2M9A A;  2YTG A;  1X6E A;  2YTQ A;  5KL2 A;  2EQ3 A;  2EE8 A;  4X9J A;  4R2S A;  1A1H A;  2EM6 A;  1F2I G;  2YTO A;  1ZR9 A;  2DMI A;  2ENC A;  2LVH A;  3MHH C;  2LCE A;  2RPC A;  2EMY A;  3EPK A;  2EM5 A;  1TF3 A;  2D9H A;  2EP3 A;  3EPH A;  2CTD A;  2JP9 A;  2CT1 A;  1A1G A;  2EMC A;  1RMD A;  2EPR A;  2EMW A;  1G2D C;  2NAB A;  1UBD C;  2EM3 A;  1BBO A;  2EQ1 A;  2YTP A;  1YUJ A;  1A1F A;  2DGC A;  2EPZ A;  2GLI A;  2EM2 A;  4R2D A;  2PRT A;  4R2C A;  2EJ4 A;  4R2E A;  5KL4 A;  1P47 A;  3EPJ A;  1X3C A;  2R1F A;  2EM8 A;  2RSI A;  4F2J C;  2YU5 A;  1YSA C;  4WSG A;  2EN1 A;  2YRH A;  1B69 A;  2YTF A;  1MEY C;  1NCS A;  2EOS A;  2EM0 A;  2EMB A;  1AAY A;  2EPX A;  2EOI A;  2ENH A;  2VRD A;  5KL6 A;  2LO3 A;  1ZAA C;  2EQ0 A;  2EOX A;  4F6M A;  2EMK A;  2EMF A;  4IS1 C;  1UN6 B;  2ELZ A;  4GZN C;  2EN4 A;  2YSP A;  2MKD A;  2WBU A;  2EMX A;  2EM9 A;  1YUI A;  1ZU1 A;  2EL4 A;  3MHS C;  2EOZ A;  1JK1 A;  2LV2 A;  4F6N A;  3M99 B;  4R2A A;  4M9V C;  2YSO A;  1BB8 A;  1A1L A;  2YTJ A;  1A1J A;  4IJD A;  2EN6 A;  2EOM A;  1DGC A;  2WBS A;  2ENA A;  4R2P A;  2EPU A;  1X5W A;  2ELY A;  2CSH A;  1JK2 A;  2EPC A;  2EOR A;  2EMH A;  1X6H A;  2EM7 A;  2JPA A;  2EOO A;  2EN3 A;  2DRP A;  2EOH A;  2EL6 A;  3VHT B;  2ADR A;  2EN7 A;  1TF6 A;  1TN9 A;  2EN2 A;  5KL5 A;  2YTN A;  2EN8 A;  3EPL A;  5KL7 A;  1A1K A;  2YU8 A;  2YTE A;  1G2F C;  2EMA A;  2MDG A;  2EOE A;  2EOF A;  2YTI A;  2EL5 A;  2EM4 A;  5KL3 A;  2WBT A;  2LT7 A;  2I13 A;  2E72 A;  2EPA A;  4R2R A;  1Z1B A;  2DLQ A;  1KJK A;  2GHF A;  2J7J A;  2MKN A;  2EMZ A;  2A25 A;  1X6F A;  2EOY A;  1A1I A;  4FK5 C;  2BB8 A;  2EML A;  3UK3 C;  2EMG A;  4R2Q A;  2DLK A;  2YTD A;  1WJP A;  2EOQ A;  1LLM C;  2HGH A;  2EOJ A;  2EPP A;  2YRM A;  2EMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...