2VRDA

The structure of the zinc finger from the human spliceosomal protein u1c
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure and Biochemical Properties of the Human Spliceosomal Protein U1C
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN C
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06220 zf-U1 U1 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2vrdA00
1X3CA 2HGHA 1JK1A 2LCEA 2EQ0A 2DGCA 2GLIA 2EMGA 2EMBA 3M99B 1KJKA 4GZNC 2EQ3A 2WBSA 2DRPA 1A1IA 1BB8A 1ZR9A 2LT7A 2EM3A 2ENAA 2YSPA 1TF3A 1A1FA 2GHFA 2EM9A 1Z1BA 1B69A 5KL4A 2R1FA 3MHHC 2DLQA 2LO3A 2EN6A 1G2FC 2JPAA 1A1HA 1NCSA 2JP9A 1ZAAC 2VRDA 2EL4A 2NABA 1YSAC 1ZU1A 2YU5A 4WSGA 4M9VC 1UN6B 2YTOA 2MKNA 2EPCA 1LLMC 2EN8A 2CSHA 2EMFA 2YRMA 1X6EA 2DLKA 2EPPA 2YTDA 2YTEA 2PRTA 4IJDA 2EMLA 2EMZA 2YU8A 2DMIA 3EPLA 2CTDA 2YRKA 2LVHA 2YTGA 1TN9A 1X6HA 1A1LA 2EN1A 3EPKA 1DGCA 4FK5C 2EE8A 2EN4A 1YUIA 2EPAA 2YTQA 2EMKA 2EM2A 2EM6A 1MEYC 1UBDC 2EOQA 4R2QA 4R2EA 1A1JA 3UK3C 2ELYA 2EPUA 1G2DC 2EMYA 2LV2A 2EMWA 4R2CA 2WBUA 2EMXA 1F2IG 2YSOA 1JK2A 2EOIA 1BBOA 4R2RA 2EPXA 2EN7A 4R2AA 4R2DA 2MKDA 2EMIA 1YUJA 2EM8A 2YTFA 2EORA 2ENCA 2RSIA 4R2PA 2WCC3 4IS1C 3EPHA 2EMHA 2EL5A 1X6FA 2EPRA 1WJPA 3VHTB 2YTPA 5KL2A 4F2JC 2I13A 2EL6A 2YTJA 2M9AA 4F6NA 2EOJA 5KL6A 2EOSA 2A25A 5KL5A 5KL7A 2EOFA 2MDGA 2E72A 2EM0A 3EPJA 2BB8A 2EJ4A 1X5WA 2EOYA 2EPZA 2RPCA 2EN2A 2EOHA 2WBTA 2EM5A 3MHSC 4F6MA 2EOMA 1A1GA 2EN3A 1RMDA 1A1KA 2D9HA 2ELZA 2ADRA 4R2SA 2EM4A 2J7JA 1TF6A 2EOOA 5KL3A 2YTNA 1AAYA 2EOXA 2EQ1A 2EMAA 2EM7A 2EOEA 2ENHA 2EOZA 2EP3A 4X9JA 1P47A 2YRHA 2CT1A 2EMCA 2YTIA
chains in the Genus database with same CATH superfamily
1X3CA 3DJWA 1WHQA 1AH5A 2EQ0A 5A6BD 5AASA 4DR1E 1RC7A 5AC5A 2MC6A 1YFHA 1XMOE 1N33E 2L33A 1KJKA 5AC4A 4WX9A 1EKZA 2DRPA 4LF6E 1YPNA 2VQEE 1BB8A 1ZR9A 2EM3A 1WXRA 2ENAA 1IQSA 1IBLE 1WRJA 3ADIA 2DLQA 2EN6A 2L92A 2L2NA 4JI7E 4JI2E 4WXDA 1ZAAC 2V86A 2M7QA 4KWYA 2EPKX 4N4RB 4JI0E 1YSAC 1QU6A 2YU5A 4WSGA 4I8OA 2NUGA 3IWDA 2JXPA 1DI2A 4BMJA 1X6EA 2EPPA 2YTEA 2YTDA 4WSPA 4IJDA 4WPYA 1N32E 1N36E 4O24A 1YZ9A 2LTRA 2K7IA 2VE7C 2YTGA 2UUCE 3OTOE 4MLVA 4YHHE 2L3JA 3J7AG 4B3ME 2EN4A 1X48A 4RH8A 4L8NA 2EPAA 1UBDC 2EMKA 2EM6A 5LMNE 2EOQA 3EQ1A 2ELYA 4X65E 2LV2A 2JR1A 4WFTA 2RSMA 1XMQE 4BHBA 2DIXA 4B3RE 2LMZA 4LF4E 3F6HA 2B7VA 1XNRE 1EH7A 3BBGA 4R2RA 4DMIA 2VQFE 5A6KA 3C6KA 2LUQA 2EMIA 3J81C 2EPNA 2N8XA 1YUJA 2EZ6A 2R76A 2NUEA 4HEIA 2HHHE 4LF9E 2I13A 1WJPA 2YTPA 5KL2A 5TSEA 2YWQA 2DSYA 2M9AA 2EOJA 5KL6A 5KL5A 5FLXC 2E72A 2K4VA 2EM0A 2V88A 1IQOA 1X5WA 2FGGA 2EPZA 3RMPA 2EOHA 2L6MA 1YYKA 5A6AA 3T1YE 3J80C 1HNZE 2EM4A 4GKJE 2EQ1A 2EM7A 4OOGC 2ENHA 4X9JA 1N34E 2CT1A 2YTIA 3KZYA 5A6JA 4OX9E 1YYOA 1QNTA 2JYAA 5IT9C 4MLQA 5LLQA 1X49A 2GLIA 2EMBA 2V8QB 1GQEA 2YPNA 2WBSA 1UILA 2FV4B 3AV0A 4DR7E 2LT7A 3JU0A 4X66E 1TF3A 5KL4A 1RQ0A 3MHHC 2LO3A 1FJGE 1A1HA 4X64E 4LTYA 3C6MA 2NA2A 2VRDA 4AQYE 4DV4E 2EPOA 2F8BA 2NABA 3HXLA 4M9VC 2YTOA 5A2QC 4DV7E 1LLMC 1XNQE 3VYYA 4ZYDA 2CSHA 2ODRD 2L2MA 1ZBQA 2YRMA 2JOBA 2EMLA 2YU8A 2H36X 2CTDA 3LMLA 1X6HA 5CFFE 1YYWA 3BIDA 1I94E 3ZOQB 5AE3A 2UXCE 4LU9A 3J7Yp 1DGCA 3K6QA 2EE8A 4JI6E 1YUIA 1MEYC 2EPUA 2EMYA 2M1SA 3BGHA 4BCAA 1T4OA 5IV8B 2YSOA 1IBKE 2EOIA 4LFCE 2LRSA 2HC5A 4R2AA 2RS6A 2RQLA 2MKDA 4DUYE 4DKKA 1L4SA 3P1XA 2EM8A 2YTFA 2EORA 2RSIA 4IS1C 3EPHA 2EMHA 4J8ZA 2EOSA 2A25A 2V87A 1PKPA 5KL7A 2MDGA 1ZBTA 2EJ4A 2Q8UA 5A6BA 2N3HA 4R03A 1FKAE 2EN2A 1A1GA 4LF8E 4F6MA 2I9IA 2D9HA 2ELZA 2ADRA 3H09A 4R2SA 1SR9A 1J5EE 2EPMX 4TUGA 2EOZA 2LJHA 2EP3A 1P47A 2JWOA 2EMCA 4BC9A 1NEIA 1SFEA 1STUA 2HGHA 2LCEA 4ZYEA 1MGTA 2VF1A 2DGCA 4JI4E 4JI8E 2V89A 4P78A 3HPZA 1GTKA 3M99B 2EWLA 5BR8E 2UU9E 4GZNC 4JYAE 2EQ3A 2M4IA 4NZVA 4ZYGA 4LFBE 1PDAA 2V83A 4X62E 2YSPA 4WXCA 2MDRA 1PJSA 1A1FA 1G2FC 2JPAA 1T39A 3VYXA 1KYQA 4GEQB 4JI3E 2G7HA 2EL4A 2NUFA 2UUBE 1ZU1A 2MKNA 2EPCA 2EN8A 2ODRC 2EMFA 3FIGA 2E1MA 2PRTA 2DLKA 3HTXA 1PJQA 2EMZA 4NXME 5ADZA 2UUAE 4GKKE 4F9AB 2BBGA 1TN9A 1J26A 1A1LA 2L2KB 4P7DA 2RS7A 2V85A 1PJTA 1IMUA 1BBGA 2YTQA 4R2QA 4L5NC 1G2DC 2GPIA 2EMWA 5A69A 4NXNE 2MC5A 2HJJA 4BBYA 1F2IG 1JK2A 2B3TB 3QG5C 3T1HE 4O43A 3IWBA 1BBOA 2LBSB 2EN7A 4YY3E 1N3GA 2E5LE 3C4TA 2FTXB 2WCC3 2KONA 3C4BA 2EPRA 3VHTB 4F2JC 3IWCA 4F6NA 4DR4E 2KOUA 1DQ3A 4LF5E 4HTGA 2BB8A 4M2ZA 4RHBB 2EOYA 2IHR1 4DV0E 4DV3E 2RPCA 3JTZA 5IXMB 5LMUE 2EM5A 2L8TA 2LTSA 2EN3A 4LFAE 1WHNA 4X8WA 3TQMA 3HQ1A 2J7JA 3LLHA 4LF7E 2F4VE 2EOOA 4DR2E 2YTNA 4DV6E 4K0KE 2EOEA 4NHRA 4JI1E 2YRHA 3AUZA 4BS9A 3HPSA 1JK1A 2RTXA 4O4KA 3BF2A 2EMGA 2JY9A 1EH6A 4DV5E 1A1IA 3KZZA 1T4NA 4B3TE 3THOB 2GHFA 2EM9A 1Z1BA 4F9BB 1B69A 2R1FA 4KHPE 2UXDE 5LL6R 1T38A 1NCSA 3ADJA 2KHXA 3F6GA 5T6JA 4DR5E 2JP9A 3L00A 2LJUA 4BC7A 4F54A 2L3CA 4DV1E 4O5GA 1UN6B 2JVAA 4Q35B 1UHZA 2DMYA 5F3WA 4DV2E 2LE2A 2N3GA 2DMIA 4R8OA 3EPLA 2YRKA 2LVHA 1GZ6A 4M0VA 1X47A 1HNXE 2EN1A 3EPKA 2YT4A 2DB2A 5AE2A 1T4LB 3DF6A 4FK5C 2EM2A 1A1JA 4R2EA 2WZOA 3THNA 3UK3C 2LUPB 4R2CA 2WBUA 4DUZE 2EMXA 5DNYA 3ADGA 4TUIA 1IBME 3JAMC 4ZYHA 2CPNA 3MSWA 2UXBE 3ECRA 2EPXA 4R2DA 1HNWE 2EPLX 4DR3E 2ENCA 4R2PA 2B7TA 2EL5A 1EH8A 1X6FA 3VK6A 2EL6A 4WYQB 2YTJA 4JI5E 2B9DA 4F9CB 5IWAE 3OMLA 3ADLA 2EOFA 4B3SE 4BHCA 4Q28A 5AE1A 3EPJA 1HR0E 1O0WA 4KZSA 2WBTA 3MHSC 2EOMA 1A1KA 4M30A 1RMDA 3KWRA 1TF6A 5KL3A 4JV5E 1AAYA 2EOXA 2YZTA 2EMAA 2ZM6E 2JOXA 4DR6E
chains in the Genus database with same CATH topology
1X3CA 2HGHA 1JK1A 2LCEA 2EQ0A 2DGCA 2GLIA 2EMGA 2EMBA 3M99B 1KJKA 4GZNC 2EQ3A 2WBSA 2DRPA 1A1IA 1BB8A 1ZR9A 2LT7A 2EM3A 2ENAA 2YSPA 1TF3A 1A1FA 2GHFA 2EM9A 1Z1BA 1B69A 5KL4A 2R1FA 3MHHC 2DLQA 2LO3A 2EN6A 1G2FC 2JPAA 1A1HA 1NCSA 2JP9A 1ZAAC 2VRDA 2EL4A 2NABA 1YSAC 1ZU1A 2YU5A 4WSGA 4M9VC 1UN6B 2YTOA 2MKNA 2EPCA 1LLMC 2EN8A 2CSHA 2EMFA 2YRMA 1X6EA 2DLKA 2EPPA 2YTDA 2YTEA 2PRTA 4IJDA 2EMLA 2EMZA 2YU8A 2DMIA 3EPLA 2CTDA 2YRKA 2LVHA 2YTGA 1TN9A 1X6HA 1A1LA 2EN1A 3EPKA 1DGCA 4FK5C 2EE8A 2EN4A 1YUIA 2EPAA 2YTQA 2EMKA 2EM2A 2EM6A 1MEYC 1UBDC 2EOQA 4R2QA 4R2EA 1A1JA 3UK3C 2ELYA 2EPUA 1G2DC 2EMYA 2LV2A 2EMWA 4R2CA 2WBUA 2EMXA 1F2IG 2YSOA 1JK2A 2EOIA 1BBOA 4R2RA 2EPXA 2EN7A 4R2AA 4R2DA 2MKDA 2EMIA 1YUJA 2EM8A 2YTFA 2EORA 2ENCA 2RSIA 4R2PA 2WCC3 4IS1C 3EPHA 2EMHA 2EL5A 1X6FA 2EPRA 1WJPA 3VHTB 2YTPA 5KL2A 4F2JC 2I13A 2EL6A 2YTJA 2M9AA 4F6NA 2EOJA 5KL6A 2EOSA 2A25A 5KL5A 5KL7A 2EOFA 2MDGA 2E72A 2EM0A 3EPJA 2BB8A 2EJ4A 1X5WA 2EOYA 2EPZA 2RPCA 2EN2A 2EOHA 2WBTA 2EM5A 3MHSC 4F6MA 2EOMA 1A1GA 2EN3A 1RMDA 1A1KA 2D9HA 2ELZA 2ADRA 4R2SA 2EM4A 2J7JA 1TF6A 2EOOA 5KL3A 2YTNA 1AAYA 2EOXA 2EQ1A 2EMAA 2EM7A 2EOEA 2ENHA 2EOZA 2EP3A 4X9JA 1P47A 2YRHA 2CT1A 2EMCA 2YTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3C A;  2HGH A;  1JK1 A;  2LCE A;  2EQ0 A;  2DGC A;  2GLI A;  2EMG A;  2EMB A;  3M99 B;  1KJK A;  4GZN C;  2EQ3 A;  2WBS A;  2DRP A;  1A1I A;  1BB8 A;  1ZR9 A;  2LT7 A;  2EM3 A;  2ENA A;  2YSP A;  1TF3 A;  1A1F A;  2GHF A;  2EM9 A;  1Z1B A;  1B69 A;  5KL4 A;  2R1F A;  3MHH C;  2DLQ A;  2LO3 A;  2EN6 A;  1G2F C;  2JPA A;  1A1H A;  1NCS A;  2JP9 A;  1ZAA C;  2VRD A;  2EL4 A;  2NAB A;  1YSA C;  1ZU1 A;  2YU5 A;  4WSG A;  4M9V C;  1UN6 B;  2YTO A;  2MKN A;  2EPC A;  1LLM C;  2EN8 A;  2CSH A;  2EMF A;  2YRM A;  1X6E A;  2DLK A;  2EPP A;  2YTD A;  2YTE A;  2PRT A;  4IJD A;  2EML A;  2EMZ A;  2YU8 A;  2DMI A;  3EPL A;  2CTD A;  2YRK A;  2LVH A;  2YTG A;  1TN9 A;  1X6H A;  1A1L A;  2EN1 A;  3EPK A;  1DGC A;  4FK5 C;  2EE8 A;  2EN4 A;  1YUI A;  2EPA A;  2YTQ A;  2EMK A;  2EM2 A;  2EM6 A;  1MEY C;  1UBD C;  2EOQ A;  4R2Q A;  4R2E A;  1A1J A;  3UK3 C;  2ELY A;  2EPU A;  1G2D C;  2EMY A;  2LV2 A;  2EMW A;  4R2C A;  2WBU A;  2EMX A;  1F2I G;  2YSO A;  1JK2 A;  2EOI A;  1BBO A;  4R2R A;  2EPX A;  2EN7 A;  4R2A A;  4R2D A;  2MKD A;  2EMI A;  1YUJ A;  2EM8 A;  2YTF A;  2EOR A;  2ENC A;  2RSI A;  4R2P A;  2WCC 3;  4IS1 C;  3EPH A;  2EMH A;  2EL5 A;  1X6F A;  2EPR A;  1WJP A;  3VHT B;  2YTP A;  5KL2 A;  4F2J C;  2I13 A;  2EL6 A;  2YTJ A;  2M9A A;  4F6N A;  2EOJ A;  5KL6 A;  2EOS A;  2A25 A;  5KL5 A;  5KL7 A;  2EOF A;  2MDG A;  2E72 A;  2EM0 A;  3EPJ A;  2BB8 A;  2EJ4 A;  1X5W A;  2EOY A;  2EPZ A;  2RPC A;  2EN2 A;  2EOH A;  2WBT A;  2EM5 A;  3MHS C;  4F6M A;  2EOM A;  1A1G A;  2EN3 A;  1RMD A;  1A1K A;  2D9H A;  2ELZ A;  2ADR A;  4R2S A;  2EM4 A;  2J7J A;  1TF6 A;  2EOO A;  5KL3 A;  2YTN A;  1AAY A;  2EOX A;  2EQ1 A;  2EMA A;  2EM7 A;  2EOE A;  2ENH A;  2EOZ A;  2EP3 A;  4X9J A;  1P47 A;  2YRH A;  2CT1 A;  2EMC A;  2YTI A; 
#chains in the Genus database with same CATH topology
 1X3C A;  3DJW A;  1WHQ A;  1AH5 A;  2EQ0 A;  5A6B D;  5AAS A;  4DR1 E;  1RC7 A;  5AC5 A;  2MC6 A;  1YFH A;  1XMO E;  1N33 E;  2L33 A;  1KJK A;  5AC4 A;  4WX9 A;  1EKZ A;  2DRP A;  4LF6 E;  1YPN A;  2VQE E;  1BB8 A;  1ZR9 A;  2EM3 A;  1WXR A;  2ENA A;  1IQS A;  1IBL E;  1WRJ A;  3ADI A;  2DLQ A;  2EN6 A;  2L92 A;  2L2N A;  4JI7 E;  4JI2 E;  4WXD A;  1ZAA C;  2V86 A;  2M7Q A;  4KWY A;  2EPK X;  4N4R B;  4JI0 E;  1YSA C;  1QU6 A;  2YU5 A;  4WSG A;  4I8O A;  2NUG A;  3IWD A;  2JXP A;  1DI2 A;  4BMJ A;  1X6E A;  2EPP A;  2YTE A;  2YTD A;  4WSP A;  4IJD A;  4WPY A;  1N32 E;  1N36 E;  4O24 A;  1YZ9 A;  2LTR A;  2K7I A;  2VE7 C;  2YTG A;  2UUC E;  3OTO E;  4MLV A;  4YHH E;  2L3J A;  3J7A G;  4B3M E;  2EN4 A;  1X48 A;  4RH8 A;  4L8N A;  2EPA A;  1UBD C;  2EMK A;  2EM6 A;  5LMN E;  2EOQ A;  3EQ1 A;  2ELY A;  4X65 E;  2LV2 A;  2JR1 A;  4WFT A;  2RSM A;  1XMQ E;  4BHB A;  2DIX A;  4B3R E;  2LMZ A;  4LF4 E;  3F6H A;  2B7V A;  1XNR E;  1EH7 A;  3BBG A;  4R2R A;  4DMI A;  2VQF E;  5A6K A;  3C6K A;  2LUQ A;  2EMI A;  3J81 C;  2EPN A;  2N8X A;  1YUJ A;  2EZ6 A;  2R76 A;  2NUE A;  4HEI A;  2HHH E;  4LF9 E;  2I13 A;  1WJP A;  2YTP A;  5KL2 A;  5TSE A;  2YWQ A;  2DSY A;  2M9A A;  2EOJ A;  5KL6 A;  5KL5 A;  5FLX C;  2E72 A;  2K4V A;  2EM0 A;  2V88 A;  1IQO A;  1X5W A;  2FGG A;  2EPZ A;  3RMP A;  2EOH A;  2L6M A;  1YYK A;  5A6A A;  3T1Y E;  3J80 C;  1HNZ E;  2EM4 A;  4GKJ E;  2EQ1 A;  2EM7 A;  4OOG C;  2ENH A;  4X9J A;  1N34 E;  2CT1 A;  2YTI A;  3KZY A;  5A6J A;  4OX9 E;  1YYO A;  1QNT A;  2JYA A;  5IT9 C;  4MLQ A;  5LLQ A;  1X49 A;  2GLI A;  2EMB A;  2V8Q B;  1GQE A;  2YPN A;  2WBS A;  1UIL A;  2FV4 B;  3AV0 A;  4DR7 E;  2LT7 A;  3JU0 A;  4X66 E;  1TF3 A;  5KL4 A;  1RQ0 A;  3MHH C;  2LO3 A;  1FJG E;  1A1H A;  4X64 E;  4LTY A;  3C6M A;  2NA2 A;  2VRD A;  4AQY E;  4DV4 E;  2EPO A;  2F8B A;  2NAB A;  3HXL A;  4M9V C;  2YTO A;  5A2Q C;  4DV7 E;  1LLM C;  1XNQ E;  3VYY A;  4ZYD A;  2CSH A;  2ODR D;  2L2M A;  1ZBQ A;  2YRM A;  2JOB A;  2EML A;  2YU8 A;  2H36 X;  2CTD A;  3LML A;  1X6H A;  5CFF E;  1YYW A;  3BID A;  1I94 E;  3ZOQ B;  5AE3 A;  2UXC E;  4LU9 A;  3J7Y p;  1DGC A;  3K6Q A;  2EE8 A;  4JI6 E;  1YUI A;  1MEY C;  2EPU A;  2EMY A;  2M1S A;  3BGH A;  4BCA A;  1T4O A;  5IV8 B;  2YSO A;  1IBK E;  2EOI A;  4LFC E;  2LRS A;  2HC5 A;  4R2A A;  2RS6 A;  2RQL A;  2MKD A;  4DUY E;  4DKK A;  1L4S A;  3P1X A;  2EM8 A;  2YTF A;  2EOR A;  2RSI A;  4IS1 C;  3EPH A;  2EMH A;  4J8Z A;  2EOS A;  2A25 A;  2V87 A;  1PKP A;  5KL7 A;  2MDG A;  1ZBT A;  2EJ4 A;  2Q8U A;  5A6B A;  2N3H A;  4R03 A;  1FKA E;  2EN2 A;  1A1G A;  4LF8 E;  4F6M A;  2I9I A;  2D9H A;  2ELZ A;  2ADR A;  3H09 A;  4R2S A;  1SR9 A;  1J5E E;  2EPM X;  4TUG A;  2EOZ A;  2LJH A;  2EP3 A;  1P47 A;  2JWO A;  2EMC A;  4BC9 A;  1NEI A;  1SFE A;  1STU A;  2HGH A;  2LCE A;  4ZYE A;  1MGT A;  2VF1 A;  2DGC A;  4JI4 E;  4JI8 E;  2V89 A;  4P78 A;  3HPZ A;  1GTK A;  3M99 B;  2EWL A;  5BR8 E;  2UU9 E;  4GZN C;  4JYA E;  2EQ3 A;  2M4I A;  4NZV A;  4ZYG A;  4LFB E;  1PDA A;  2V83 A;  4X62 E;  2YSP A;  4WXC A;  2MDR A;  1PJS A;  1A1F A;  1G2F C;  2JPA A;  1T39 A;  3VYX A;  1KYQ A;  4GEQ B;  4JI3 E;  2G7H A;  2EL4 A;  2NUF A;  2UUB E;  1ZU1 A;  2MKN A;  2EPC A;  2EN8 A;  2ODR C;  2EMF A;  3FIG A;  2E1M A;  2PRT A;  2DLK A;  3HTX A;  1PJQ A;  2EMZ A;  4NXM E;  5ADZ A;  2UUA E;  4GKK E;  4F9A B;  2BBG A;  1TN9 A;  1J26 A;  1A1L A;  2L2K B;  4P7D A;  2RS7 A;  2V85 A;  1PJT A;  1IMU A;  1BBG A;  2YTQ A;  4R2Q A;  4L5N C;  1G2D C;  2GPI A;  2EMW A;  5A69 A;  4NXN E;  2MC5 A;  2HJJ A;  4BBY A;  1F2I G;  1JK2 A;  2B3T B;  3QG5 C;  3T1H E;  4O43 A;  3IWB A;  1BBO A;  2LBS B;  2EN7 A;  4YY3 E;  1N3G A;  2E5L E;  3C4T A;  2FTX B;  2WCC 3;  2KON A;  3C4B A;  2EPR A;  3VHT B;  4F2J C;  3IWC A;  4F6N A;  4DR4 E;  2KOU A;  1DQ3 A;  4LF5 E;  4HTG A;  2BB8 A;  4M2Z A;  4RHB B;  2EOY A;  2IHR 1;  4DV0 E;  4DV3 E;  2RPC A;  3JTZ A;  5IXM B;  5LMU E;  2EM5 A;  2L8T A;  2LTS A;  2EN3 A;  4LFA E;  1WHN A;  4X8W A;  3TQM A;  3HQ1 A;  2J7J A;  3LLH A;  4LF7 E;  2F4V E;  2EOO A;  4DR2 E;  2YTN A;  4DV6 E;  4K0K E;  2EOE A;  4NHR A;  4JI1 E;  2YRH A;  3AUZ A;  4BS9 A;  3HPS A;  1JK1 A;  2RTX A;  4O4K A;  3BF2 A;  2EMG A;  2JY9 A;  1EH6 A;  4DV5 E;  1A1I A;  3KZZ A;  1T4N A;  4B3T E;  3THO B;  2GHF A;  2EM9 A;  1Z1B A;  4F9B B;  1B69 A;  2R1F A;  4KHP E;  2UXD E;  5LL6 R;  1T38 A;  1NCS A;  3ADJ A;  2KHX A;  3F6G A;  5T6J A;  4DR5 E;  2JP9 A;  3L00 A;  2LJU A;  4BC7 A;  4F54 A;  2L3C A;  4DV1 E;  4O5G A;  1UN6 B;  2JVA A;  4Q35 B;  1UHZ A;  2DMY A;  5F3W A;  4DV2 E;  2LE2 A;  2N3G A;  2DMI A;  4R8O A;  3EPL A;  2YRK A;  2LVH A;  1GZ6 A;  4M0V A;  1X47 A;  1HNX E;  2EN1 A;  3EPK A;  2YT4 A;  2DB2 A;  5AE2 A;  1T4L B;  3DF6 A;  4FK5 C;  2EM2 A;  1A1J A;  4R2E A;  2WZO A;  3THN A;  3UK3 C;  2LUP B;  4R2C A;  2WBU A;  4DUZ E;  2EMX A;  5DNY A;  3ADG A;  4TUI A;  1IBM E;  3JAM C;  4ZYH A;  2CPN A;  3MSW A;  2UXB E;  3ECR A;  2EPX A;  4R2D A;  1HNW E;  2EPL X;  4DR3 E;  2ENC A;  4R2P A;  2B7T A;  2EL5 A;  1EH8 A;  1X6F A;  3VK6 A;  2EL6 A;  4WYQ B;  2YTJ A;  4JI5 E;  2B9D A;  4F9C B;  5IWA E;  3OML A;  3ADL A;  2EOF A;  4B3S E;  4BHC A;  4Q28 A;  5AE1 A;  3EPJ A;  1HR0 E;  1O0W A;  4KZS A;  2WBT A;  3MHS C;  2EOM A;  1A1K A;  4M30 A;  1RMD A;  3KWR A;  1TF6 A;  5KL3 A;  4JV5 E;  1AAY A;  2EOX A;  2YZT A;  2EMA A;  2ZM6 E;  2JOX A;  4DR6 E; 
#chains in the Genus database with same CATH homology
 1X3C A;  2HGH A;  1JK1 A;  2LCE A;  2EQ0 A;  2DGC A;  2GLI A;  2EMG A;  2EMB A;  3M99 B;  1KJK A;  4GZN C;  2EQ3 A;  2WBS A;  2DRP A;  1A1I A;  1BB8 A;  1ZR9 A;  2LT7 A;  2EM3 A;  2ENA A;  2YSP A;  1TF3 A;  1A1F A;  2GHF A;  2EM9 A;  1Z1B A;  1B69 A;  5KL4 A;  2R1F A;  3MHH C;  2DLQ A;  2LO3 A;  2EN6 A;  1G2F C;  2JPA A;  1A1H A;  1NCS A;  2JP9 A;  1ZAA C;  2VRD A;  2EL4 A;  2NAB A;  1YSA C;  1ZU1 A;  2YU5 A;  4WSG A;  4M9V C;  1UN6 B;  2YTO A;  2MKN A;  2EPC A;  1LLM C;  2EN8 A;  2CSH A;  2EMF A;  2YRM A;  1X6E A;  2DLK A;  2EPP A;  2YTD A;  2YTE A;  2PRT A;  4IJD A;  2EML A;  2EMZ A;  2YU8 A;  2DMI A;  3EPL A;  2CTD A;  2YRK A;  2LVH A;  2YTG A;  1TN9 A;  1X6H A;  1A1L A;  2EN1 A;  3EPK A;  1DGC A;  4FK5 C;  2EE8 A;  2EN4 A;  1YUI A;  2EPA A;  2YTQ A;  2EMK A;  2EM2 A;  2EM6 A;  1MEY C;  1UBD C;  2EOQ A;  4R2Q A;  4R2E A;  1A1J A;  3UK3 C;  2ELY A;  2EPU A;  1G2D C;  2EMY A;  2LV2 A;  2EMW A;  4R2C A;  2WBU A;  2EMX A;  1F2I G;  2YSO A;  1JK2 A;  2EOI A;  1BBO A;  4R2R A;  2EPX A;  2EN7 A;  4R2A A;  4R2D A;  2MKD A;  2EMI A;  1YUJ A;  2EM8 A;  2YTF A;  2EOR A;  2ENC A;  2RSI A;  4R2P A;  2WCC 3;  4IS1 C;  3EPH A;  2EMH A;  2EL5 A;  1X6F A;  2EPR A;  1WJP A;  3VHT B;  2YTP A;  5KL2 A;  4F2J C;  2I13 A;  2EL6 A;  2YTJ A;  2M9A A;  4F6N A;  2EOJ A;  5KL6 A;  2EOS A;  2A25 A;  5KL5 A;  5KL7 A;  2EOF A;  2MDG A;  2E72 A;  2EM0 A;  3EPJ A;  2BB8 A;  2EJ4 A;  1X5W A;  2EOY A;  2EPZ A;  2RPC A;  2EN2 A;  2EOH A;  2WBT A;  2EM5 A;  3MHS C;  4F6M A;  2EOM A;  1A1G A;  2EN3 A;  1RMD A;  1A1K A;  2D9H A;  2ELZ A;  2ADR A;  4R2S A;  2EM4 A;  2J7J A;  1TF6 A;  2EOO A;  5KL3 A;  2YTN A;  1AAY A;  2EOX A;  2EQ1 A;  2EMA A;  2EM7 A;  2EOE A;  2ENH A;  2EOZ A;  2EP3 A;  4X9J A;  1P47 A;  2YRH A;  2CT1 A;  2EMC A;  2YTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...