2VRDA

The structure of the zinc finger from the human spliceosomal protein u1c
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN C
publication title The Structure and Biochemical Properties of the Human Spliceosomal Protein U1C
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06220 zf-U1 U1 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2vrdA00
2PRTA 2EM4A 1X6HA 2WCC3 2MKNA 1A1GA 2EN3A 4WSGA 2HGHA 4GZNC 3VHTB 2EOYA 2EOOA 1TF6A 2EOXA 2EMFA 2EOJA 2LV2A 2EN2A 2EOQA 5KL7A 4M9VC 2EMWA 2DGCA 1A1HA 2VRDA 2DMIA 5KL4A 2DLQA 2EPRA 2EPUA 2D9HA 1ZAAC 2EJ4A 2NABA 2EPZA 4X9JA 2EOHA 3EPJA 2EMBA 3EPKA 4R2RA 2EP3A 2M9AA 4R2SA 1JK1A 2EMKA 2YSOA 1UBDC 2YRMA 1YSAC 3UK3C 2CSHA 2LVHA 2LO3A 2EM7A 2YTFA 2EL6A 2EPPA 2EQ1A 1BB8A 2EMLA 2YU8A 1KJKA 1F2IG 2WBSA 2EM0A 1ZU1A 2J7JA 3MHSC 5KL6A 2EPCA 2R1FA 1RMDA 2EL5A 1G2DC 2YSPA 2YRKA 2DRPA 4R2DA 2EN8A 2EOFA 2WBUA 2WBTA 2EM6A 1TF3A 5KL5A 2EOIA 2EN1A 1X5WA 2ENAA 2EN4A 5KL2A 1A1JA 1JK2A 2DLKA 2EPXA 2YTPA 4FK5C 2EM3A 2EM2A 2EQ0A 1TN9A 2YTOA 5KL3A 2RSIA 4R2PA 2I13A 1X6EA 1BBOA 2MDGA 1YUJA 2JPAA 2EN6A 4IJDA 1MEYC 4F2JC 4R2QA 2RPCA 2EL4A 2EQ3A 4F6MA 1WJPA 1B69A 1LLMC 3EPHA 1X6FA 2CT1A 2EMIA 1G2FC 1A1LA 3MHHC 2YU5A 3M99B 2ELZA 2YTEA 4R2EA 4R2AA 2EMZA 2YTDA 2ENCA 4F6NA 2CTDA 2EMHA 2EOZA 1A1FA 2YTQA 2EE8A 1A1IA 4IS1C 1Z1BA 1DGCA 1X3CA 2YTGA 2ADRA 2A25A 2YTNA 2YTIA 3EPLA 2YTJA 2EM8A 2JP9A 2EN7A 2LCEA 2EMAA 2EORA 2ENHA 2GHFA 1UN6B 2EMXA 2BB8A 2E72A 2EMCA 1A1KA 4R2CA 2LT7A 1AAYA 1ZR9A 2EMGA 2EM5A 2GLIA 2EM9A 2EOMA 1NCSA 2EPAA 2EMYA 1YUIA 2EOEA 2MKDA 2ELYA 2YRHA 1P47A 2EOSA
chains in the Genus database with same CATH superfamily
2V88A 4DR7E 1X6HA 4JI1E 2EPLX 4WSGA 2HGHA 2UU9E 2I9IA 4LU9A 3ADIA 5IV8B 1TF6A 2EMFA 2EOQA 2EPRA 2EPUA 1AH5A 2V85A 1RC7A 2NABA 5AE1A 2EPZA 4M0VA 4X8WA 2EMBA 4BBYA 3C4BA 4DV5E 1IMUA 1STUA 3DJWA 2M9AA 1JK1A 2LE2A 1N33E 4JI4E 2LVHA 4O24A 1N3GA 2RS7A 4DR5E 2EM7A 4KZSA 5BR8E 3AUZA 2NUEA 3LMLA 2EMLA 4DV1E 2YU8A 2L3JA 2K7IA 1F2IG 2M1SA 2V89A 1ZU1A 2J7JA 5A6JA 3MHSC 2L6MA 1GZ6A 1G2DC 2UUCE 2YSPA 2HC5A 4JI2E 2YRKA 2LJHA 1GQEA 2DMYA 1T38A 3T1HE 2M4IA 2EN1A 2ENAA 3ECRA 2EPNA 1JK2A 2YTPA 4L5NC 2EM3A 2EM2A 2EQ0A 3F6GA 3IWDA 1TN9A 1YPNA 1N34E 5KL3A 5AE3A 4GKKE 1PKPA 2JY9A 2L2NA 1YUJA 2JPAA 3HXLA 4IJDA 1L4SA 2MC5A 1PDAA 1FJGE 4HTGA 4K0KE 2CT1A 2NA2A 2N3HA 3ADGA 3IWCA 3VYYA 4R2AA 4R8OA 2EMZA 4JI3E 4BC7A 4ZYHA 2CTDA 1X49A 4F9CB 1A1IA 3AV0A 3T1YE 1DGCA 2CPNA 2ADRA 2FGGA 2YTNA 1HNWE 4LF4E 3JU0A 5IXMB 2RSMA 2ENHA 2G7HA 4WPYA 2EMXA 2EMCA 1AAYA 2UXDE 4R2CA 4WXCA 5A69A 2RTXA 5FLXC 2N3GA 2EM5A 4ZYDA 2LUPB 4J8ZA 2EPAA 1MGTA 2EMYA 2YT4A 2EOEA 2RPCA 1P47A 4M30A 4WFTA 2EM4A 1XNQE 1BBGA 1A1GA 2EN3A 2LTSA 4N4RB 3ADLA 4DV6E 2EOOA 4KWYA 2DIXA 2B9DA 2LUQA 2VRDA 2DMIA 3THOB 2D9HA 2EJ4A 2JWOA 4X9JA 4F9BB 1QU6A 4R2RA 2V87A 3FIGA 4R2SA 2R76A 2EMKA 1YSAC 5A6BD 2LBSB 2LO3A 1YZ9A 3J7Yp 2EPPA 2EQ1A 1YYOA 4LTYA 1PJSA 5TSEA 1WRJA 4DKKA 2R1FA 2M7QA 4R2DA 1IBME 5A6AA 1EH7A 4L8NA 2JOBA 4X66E 1DI2A 1TF3A 1YYKA 2EOIA 1X5WA 4X64E 4DR4E 2EN4A 3DF6A 3J81C 1IQOA 2DLKA 5AE2A 4FK5C 5CFFE 3EQ1A 2HJJA 1HR0E 1WHQA 2KOUA 2EPOA 2YTOA 4BMJA 1WXRA 1X6EA 1BBOA 4F2JC 4DV2E 2EL4A 4BCAA 2NUFA 5A6BA 1LLMC 1YFHA 3EPHA 4I8OA 1EH6A 4WX9A 3MHHC 2L33A 2YU5A 2ZM6E 4B3ME 4WYQB 3KZYA 2YTDA 1XMQE 3ZOQB 4P78A 4F6NA 3TQMA 4TUGA 3C6MA 2EMHA 2EOZA 4DV0E 4RHBB 4BC9A 2EE8A 2LTRA 2ODRD 4JV5E 4IS1C 3LLHA 4F54A 1X3CA 2YTGA 4MLVA 1T39A 3HTXA 1IBKE 2BBGA 4Q28A 2EORA 1UN6B 1NEIA 2JR1A 2E72A 5F3WA 2LT7A 2L2KB 5AC5A 4JI6E 2E1MA 4NXME 2EM9A 4OOGC 2EOMA 5LMUE 1YUIA 1N32E 2EOSA 3ADJA 4M2ZA 1WHNA 4JI5E 2MKNA 2JVAA 3VHTB 2YWQA 4NXNE 3K6QA 1XNRE 2EOXA 2EOJA 5LL6R 2EN2A 5KL7A 3P1XA 4MLQA 2DGCA 1A1HA 4YY3E 2EPKX 5KL4A 2DLQA 2LMZA 1ZAAC 3EPJA 4DR6E 4LF6E 2N8XA 4AQYE 5A6KA 5AC4A 2EP3A 5LMNE 1UBDC 4DR2E 1SFEA 3BBGA 2CSHA 1FKAE 1PJTA 4O43A 2EL6A 3F6HA 1J5EE 1BB8A 1T4NA 2L8TA 2UUAE 4B3SE 2WBSA 2EM0A 3QG5C 4P7DA 2NUGA 4JYAE 2FV4B 5KL6A 2EPCA 2VQFE 4DUZE 2F8BA 1N36E 2DRPA 3J7AG 2EN8A 1RQ0A 2EOFA 3MSWA 5IWAE 4DUYE 2WBTA 1GTKA 2F4VE 2EWLA 2L3CA 2EM6A 2IHR1 2YPNA 3KZZA 2VF1A 2RSIA 1PJQA 2MDGA 3VYXA 4ZYGA 5T6JA 1T4OA 1WJPA 4NZVA 1B69A 5AASA 1X6FA 1G2FC 4KHPE 1EH8A 4BHCA 1A1LA 4DR3E 2JOXA 3C6KA 2K4VA 2HHHE 2YTEA 3KWRA 1UHZA 2RS6A 4R03A 1A1FA 2YTQA 4B3TE 4BS9A 3JTZA 4NHRA 2A25A 2YTIA 3HPSA 2YTJA 2JP9A 1KYQA 2YZTA 4GKJE 3HQ1A 2BB8A 4JI8E 1ZR9A 4DV4E 4B3RE 5IT9C 2H36X 3BF2A 3BGHA 1NCSA 2DSYA 4OX9E 4GEQB 2MKDA 2ELYA 2YRHA 1IQSA 2PRTA 2LJUA 2V86A 2WCC3 2MDRA 3OMLA 4GZNC 4O5GA 2EOYA 2JXPA 2Q8UA 2LV2A 4M9VC 2EMWA 2EZ6A 2EOHA 3EPKA 4TUIA 2UXCE 2YSOA 1YYWA 3THNA 2YRMA 4BHBA 2FTXB 3UK3C 2UXBE 3H09A 1X48A 5LLQA 1HNZE 2YTFA 4RH8A 1I94E 4Q35B 4O4KA 4LF8E 2L2MA 4X65E 4LFAE 2E5LE 2L92A 4DV7E 2WZOA 3VK6A 4LFCE 1ZBQA 4F9AB 1RMDA 1ZBTA 2EL5A 4WSPA 2UUBE 2KHXA 4JI0E 2B7TA 1SR9A 2KONA 2WBUA 1T4LB 3L00A 5KL5A 1UILA 5KL2A 1A1JA 2EPXA 3RMPA 3IWBA 4JI7E 5DNYA 2V83A 2VQEE 4R2PA 2I13A 2EN6A 2LRSA 1MEYC 3OTOE 4R2QA 4YHHE 2EQ3A 4F6MA 2EPMX 4X62E 2EMIA 1DQ3A 2JYAA 4LF7E 3M99B 2ELZA 3JAMC 3HPZA 4R2EA 2DB2A 4DR1E 3BIDA 1XMOE 2VE7C 2ENCA 3J80C 2B3TB 4ZYEA 1IBLE 4DMIA 2V8QB 4DV3E 4LF5E 2MC6A 4LFBE 5A2QC 1QNTA 1J26A 1Z1BA 2B7VA 3C4TA 3EPLA 2EM8A 1HNXE 2EN7A 1O0WA 2ODRC 2LCEA 2EMAA 2GHFA 5ADZA 1A1KA 1EKZA 2EMGA 4WXDA 2GPIA 4LF9E 2GLIA 2RQLA 4HEIA 1X47A 1KJKA
chains in the Genus database with same CATH topology
2PRTA 2EM4A 1X6HA 2WCC3 2MKNA 1A1GA 2EN3A 4WSGA 2HGHA 4GZNC 3VHTB 2EOYA 2EOOA 1TF6A 2EOXA 2EMFA 2EOJA 2LV2A 2EN2A 2EOQA 5KL7A 4M9VC 2EMWA 2DGCA 1A1HA 2VRDA 2DMIA 5KL4A 2DLQA 2EPRA 2EPUA 2D9HA 1ZAAC 2EJ4A 2NABA 2EPZA 4X9JA 2EOHA 3EPJA 2EMBA 3EPKA 4R2RA 2EP3A 2M9AA 4R2SA 1JK1A 2EMKA 2YSOA 1UBDC 2YRMA 1YSAC 3UK3C 2CSHA 2LVHA 2LO3A 2EM7A 2YTFA 2EL6A 2EPPA 2EQ1A 1BB8A 2EMLA 2YU8A 1KJKA 1F2IG 2WBSA 2EM0A 1ZU1A 2J7JA 3MHSC 5KL6A 2EPCA 2R1FA 1RMDA 2EL5A 1G2DC 2YSPA 2YRKA 2DRPA 4R2DA 2EN8A 2EOFA 2WBUA 2WBTA 2EM6A 1TF3A 5KL5A 2EOIA 2EN1A 1X5WA 2ENAA 2EN4A 5KL2A 1A1JA 1JK2A 2DLKA 2EPXA 2YTPA 4FK5C 2EM3A 2EM2A 2EQ0A 1TN9A 2YTOA 5KL3A 2RSIA 4R2PA 2I13A 1X6EA 1BBOA 2MDGA 1YUJA 2JPAA 2EN6A 4IJDA 1MEYC 4F2JC 4R2QA 2RPCA 2EL4A 2EQ3A 4F6MA 1WJPA 1B69A 1LLMC 3EPHA 1X6FA 2CT1A 2EMIA 1G2FC 1A1LA 3MHHC 2YU5A 3M99B 2ELZA 2YTEA 4R2EA 4R2AA 2EMZA 2YTDA 2ENCA 4F6NA 2CTDA 2EMHA 2EOZA 1A1FA 2YTQA 2EE8A 1A1IA 4IS1C 1Z1BA 1DGCA 1X3CA 2YTGA 2ADRA 2A25A 2YTNA 2YTIA 3EPLA 2YTJA 2EM8A 2JP9A 2EN7A 2LCEA 2EMAA 2EORA 2ENHA 2GHFA 1UN6B 2EMXA 2BB8A 2E72A 2EMCA 1A1KA 4R2CA 2LT7A 1AAYA 1ZR9A 2EMGA 2EM5A 2GLIA 2EM9A 2EOMA 1NCSA 2EPAA 2EMYA 1YUIA 2EOEA 2MKDA 2ELYA 2YRHA 1P47A 2EOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRT A;  2EM4 A;  1X6H A;  2WCC 3;  2MKN A;  1A1G A;  2EN3 A;  4WSG A;  2HGH A;  4GZN C;  3VHT B;  2EOY A;  2EOO A;  1TF6 A;  2EOX A;  2EMF A;  2EOJ A;  2LV2 A;  2EN2 A;  2EOQ A;  5KL7 A;  4M9V C;  2EMW A;  2DGC A;  1A1H A;  2VRD A;  2DMI A;  5KL4 A;  2DLQ A;  2EPR A;  2EPU A;  2D9H A;  1ZAA C;  2EJ4 A;  2NAB A;  2EPZ A;  4X9J A;  2EOH A;  3EPJ A;  2EMB A;  3EPK A;  4R2R A;  2EP3 A;  2M9A A;  4R2S A;  1JK1 A;  2EMK A;  2YSO A;  1UBD C;  2YRM A;  1YSA C;  3UK3 C;  2CSH A;  2LVH A;  2LO3 A;  2EM7 A;  2YTF A;  2EL6 A;  2EPP A;  2EQ1 A;  1BB8 A;  2EML A;  2YU8 A;  1KJK A;  1F2I G;  2WBS A;  2EM0 A;  1ZU1 A;  2J7J A;  3MHS C;  5KL6 A;  2EPC A;  2R1F A;  1RMD A;  2EL5 A;  1G2D C;  2YSP A;  2YRK A;  2DRP A;  4R2D A;  2EN8 A;  2EOF A;  2WBU A;  2WBT A;  2EM6 A;  1TF3 A;  5KL5 A;  2EOI A;  2EN1 A;  1X5W A;  2ENA A;  2EN4 A;  5KL2 A;  1A1J A;  1JK2 A;  2DLK A;  2EPX A;  2YTP A;  4FK5 C;  2EM3 A;  2EM2 A;  2EQ0 A;  1TN9 A;  2YTO A;  5KL3 A;  2RSI A;  4R2P A;  2I13 A;  1X6E A;  1BBO A;  2MDG A;  1YUJ A;  2JPA A;  2EN6 A;  4IJD A;  1MEY C;  4F2J C;  4R2Q A;  2RPC A;  2EL4 A;  2EQ3 A;  4F6M A;  1WJP A;  1B69 A;  1LLM C;  3EPH A;  1X6F A;  2CT1 A;  2EMI A;  1G2F C;  1A1L A;  3MHH C;  2YU5 A;  3M99 B;  2ELZ A;  2YTE A;  4R2E A;  4R2A A;  2EMZ A;  2YTD A;  2ENC A;  4F6N A;  2CTD A;  2EMH A;  2EOZ A;  1A1F A;  2YTQ A;  2EE8 A;  1A1I A;  4IS1 C;  1Z1B A;  1DGC A;  1X3C A;  2YTG A;  2ADR A;  2A25 A;  2YTN A;  2YTI A;  3EPL A;  2YTJ A;  2EM8 A;  2JP9 A;  2EN7 A;  2LCE A;  2EMA A;  2EOR A;  2ENH A;  2GHF A;  1UN6 B;  2EMX A;  2BB8 A;  2E72 A;  2EMC A;  1A1K A;  4R2C A;  2LT7 A;  1AAY A;  1ZR9 A;  2EMG A;  2EM5 A;  2GLI A;  2EM9 A;  2EOM A;  1NCS A;  2EPA A;  2EMY A;  1YUI A;  2EOE A;  2MKD A;  2ELY A;  2YRH A;  1P47 A;  2EOS A; 
#chains in the Genus database with same CATH topology
 2V88 A;  4DR7 E;  1X6H A;  4JI1 E;  2EPL X;  4WSG A;  2HGH A;  2UU9 E;  2I9I A;  4LU9 A;  3ADI A;  5IV8 B;  1TF6 A;  2EMF A;  2EOQ A;  2EPR A;  2EPU A;  1AH5 A;  2V85 A;  1RC7 A;  2NAB A;  5AE1 A;  2EPZ A;  4M0V A;  4X8W A;  2EMB A;  4BBY A;  3C4B A;  4DV5 E;  1IMU A;  1STU A;  3DJW A;  2M9A A;  1JK1 A;  2LE2 A;  1N33 E;  4JI4 E;  2LVH A;  4O24 A;  1N3G A;  2RS7 A;  4DR5 E;  2EM7 A;  4KZS A;  5BR8 E;  3AUZ A;  2NUE A;  3LML A;  2EML A;  4DV1 E;  2YU8 A;  2L3J A;  2K7I A;  1F2I G;  2M1S A;  2V89 A;  1ZU1 A;  2J7J A;  5A6J A;  3MHS C;  2L6M A;  1GZ6 A;  1G2D C;  2UUC E;  2YSP A;  2HC5 A;  4JI2 E;  2YRK A;  2LJH A;  1GQE A;  2DMY A;  1T38 A;  3T1H E;  2M4I A;  2EN1 A;  2ENA A;  3ECR A;  2EPN A;  1JK2 A;  2YTP A;  4L5N C;  2EM3 A;  2EM2 A;  2EQ0 A;  3F6G A;  3IWD A;  1TN9 A;  1YPN A;  1N34 E;  5KL3 A;  5AE3 A;  4GKK E;  1PKP A;  2JY9 A;  2L2N A;  1YUJ A;  2JPA A;  3HXL A;  4IJD A;  1L4S A;  2MC5 A;  1PDA A;  1FJG E;  4HTG A;  4K0K E;  2CT1 A;  2NA2 A;  2N3H A;  3ADG A;  3IWC A;  3VYY A;  4R2A A;  4R8O A;  2EMZ A;  4JI3 E;  4BC7 A;  4ZYH A;  2CTD A;  1X49 A;  4F9C B;  1A1I A;  3AV0 A;  3T1Y E;  1DGC A;  2CPN A;  2ADR A;  2FGG A;  2YTN A;  1HNW E;  4LF4 E;  3JU0 A;  5IXM B;  2RSM A;  2ENH A;  2G7H A;  4WPY A;  2EMX A;  2EMC A;  1AAY A;  2UXD E;  4R2C A;  4WXC A;  5A69 A;  2RTX A;  5FLX C;  2N3G A;  2EM5 A;  4ZYD A;  2LUP B;  4J8Z A;  2EPA A;  1MGT A;  2EMY A;  2YT4 A;  2EOE A;  2RPC A;  1P47 A;  4M30 A;  4WFT A;  2EM4 A;  1XNQ E;  1BBG A;  1A1G A;  2EN3 A;  2LTS A;  4N4R B;  3ADL A;  4DV6 E;  2EOO A;  4KWY A;  2DIX A;  2B9D A;  2LUQ A;  2VRD A;  2DMI A;  3THO B;  2D9H A;  2EJ4 A;  2JWO A;  4X9J A;  4F9B B;  1QU6 A;  4R2R A;  2V87 A;  3FIG A;  4R2S A;  2R76 A;  2EMK A;  1YSA C;  5A6B D;  2LBS B;  2LO3 A;  1YZ9 A;  3J7Y p;  2EPP A;  2EQ1 A;  1YYO A;  4LTY A;  1PJS A;  5TSE A;  1WRJ A;  4DKK A;  2R1F A;  2M7Q A;  4R2D A;  1IBM E;  5A6A A;  1EH7 A;  4L8N A;  2JOB A;  4X66 E;  1DI2 A;  1TF3 A;  1YYK A;  2EOI A;  1X5W A;  4X64 E;  4DR4 E;  2EN4 A;  3DF6 A;  3J81 C;  1IQO A;  2DLK A;  5AE2 A;  4FK5 C;  5CFF E;  3EQ1 A;  2HJJ A;  1HR0 E;  1WHQ A;  2KOU A;  2EPO A;  2YTO A;  4BMJ A;  1WXR A;  1X6E A;  1BBO A;  4F2J C;  4DV2 E;  2EL4 A;  4BCA A;  2NUF A;  5A6B A;  1LLM C;  1YFH A;  3EPH A;  4I8O A;  1EH6 A;  4WX9 A;  3MHH C;  2L33 A;  2YU5 A;  2ZM6 E;  4B3M E;  4WYQ B;  3KZY A;  2YTD A;  1XMQ E;  3ZOQ B;  4P78 A;  4F6N A;  3TQM A;  4TUG A;  3C6M A;  2EMH A;  2EOZ A;  4DV0 E;  4RHB B;  4BC9 A;  2EE8 A;  2LTR A;  2ODR D;  4JV5 E;  4IS1 C;  3LLH A;  4F54 A;  1X3C A;  2YTG A;  4MLV A;  1T39 A;  3HTX A;  1IBK E;  2BBG A;  4Q28 A;  2EOR A;  1UN6 B;  1NEI A;  2JR1 A;  2E72 A;  5F3W A;  2LT7 A;  2L2K B;  5AC5 A;  4JI6 E;  2E1M A;  4NXM E;  2EM9 A;  4OOG C;  2EOM A;  5LMU E;  1YUI A;  1N32 E;  2EOS A;  3ADJ A;  4M2Z A;  1WHN A;  4JI5 E;  2MKN A;  2JVA A;  3VHT B;  2YWQ A;  4NXN E;  3K6Q A;  1XNR E;  2EOX A;  2EOJ A;  5LL6 R;  2EN2 A;  5KL7 A;  3P1X A;  4MLQ A;  2DGC A;  1A1H A;  4YY3 E;  2EPK X;  5KL4 A;  2DLQ A;  2LMZ A;  1ZAA C;  3EPJ A;  4DR6 E;  4LF6 E;  2N8X A;  4AQY E;  5A6K A;  5AC4 A;  2EP3 A;  5LMN E;  1UBD C;  4DR2 E;  1SFE A;  3BBG A;  2CSH A;  1FKA E;  1PJT A;  4O43 A;  2EL6 A;  3F6H A;  1J5E E;  1BB8 A;  1T4N A;  2L8T A;  2UUA E;  4B3S E;  2WBS A;  2EM0 A;  3QG5 C;  4P7D A;  2NUG A;  4JYA E;  2FV4 B;  5KL6 A;  2EPC A;  2VQF E;  4DUZ E;  2F8B A;  1N36 E;  2DRP A;  3J7A G;  2EN8 A;  1RQ0 A;  2EOF A;  3MSW A;  5IWA E;  4DUY E;  2WBT A;  1GTK A;  2F4V E;  2EWL A;  2L3C A;  2EM6 A;  2IHR 1;  2YPN A;  3KZZ A;  2VF1 A;  2RSI A;  1PJQ A;  2MDG A;  3VYX A;  4ZYG A;  5T6J A;  1T4O A;  1WJP A;  4NZV A;  1B69 A;  5AAS A;  1X6F A;  1G2F C;  4KHP E;  1EH8 A;  4BHC A;  1A1L A;  4DR3 E;  2JOX A;  3C6K A;  2K4V A;  2HHH E;  2YTE A;  3KWR A;  1UHZ A;  2RS6 A;  4R03 A;  1A1F A;  2YTQ A;  4B3T E;  4BS9 A;  3JTZ A;  4NHR A;  2A25 A;  2YTI A;  3HPS A;  2YTJ A;  2JP9 A;  1KYQ A;  2YZT A;  4GKJ E;  3HQ1 A;  2BB8 A;  4JI8 E;  1ZR9 A;  4DV4 E;  4B3R E;  5IT9 C;  2H36 X;  3BF2 A;  3BGH A;  1NCS A;  2DSY A;  4OX9 E;  4GEQ B;  2MKD A;  2ELY A;  2YRH A;  1IQS A;  2PRT A;  2LJU A;  2V86 A;  2WCC 3;  2MDR A;  3OML A;  4GZN C;  4O5G A;  2EOY A;  2JXP A;  2Q8U A;  2LV2 A;  4M9V C;  2EMW A;  2EZ6 A;  2EOH A;  3EPK A;  4TUI A;  2UXC E;  2YSO A;  1YYW A;  3THN A;  2YRM A;  4BHB A;  2FTX B;  3UK3 C;  2UXB E;  3H09 A;  1X48 A;  5LLQ A;  1HNZ E;  2YTF A;  4RH8 A;  1I94 E;  4Q35 B;  4O4K A;  4LF8 E;  2L2M A;  4X65 E;  4LFA E;  2E5L E;  2L92 A;  4DV7 E;  2WZO A;  3VK6 A;  4LFC E;  1ZBQ A;  4F9A B;  1RMD A;  1ZBT A;  2EL5 A;  4WSP A;  2UUB E;  2KHX A;  4JI0 E;  2B7T A;  1SR9 A;  2KON A;  2WBU A;  1T4L B;  3L00 A;  5KL5 A;  1UIL A;  5KL2 A;  1A1J A;  2EPX A;  3RMP A;  3IWB A;  4JI7 E;  5DNY A;  2V83 A;  2VQE E;  4R2P A;  2I13 A;  2EN6 A;  2LRS A;  1MEY C;  3OTO E;  4R2Q A;  4YHH E;  2EQ3 A;  4F6M A;  2EPM X;  4X62 E;  2EMI A;  1DQ3 A;  2JYA A;  4LF7 E;  3M99 B;  2ELZ A;  3JAM C;  3HPZ A;  4R2E A;  2DB2 A;  4DR1 E;  3BID A;  1XMO E;  2VE7 C;  2ENC A;  3J80 C;  2B3T B;  4ZYE A;  1IBL E;  4DMI A;  2V8Q B;  4DV3 E;  4LF5 E;  2MC6 A;  4LFB E;  5A2Q C;  1QNT A;  1J26 A;  1Z1B A;  2B7V A;  3C4T A;  3EPL A;  2EM8 A;  1HNX E;  2EN7 A;  1O0W A;  2ODR C;  2LCE A;  2EMA A;  2GHF A;  5ADZ A;  1A1K A;  1EKZ A;  2EMG A;  4WXD A;  2GPI A;  4LF9 E;  2GLI A;  2RQL A;  4HEI A;  1X47 A;  1KJK A; 
#chains in the Genus database with same CATH homology
 2PRT A;  2EM4 A;  1X6H A;  2WCC 3;  2MKN A;  1A1G A;  2EN3 A;  4WSG A;  2HGH A;  4GZN C;  3VHT B;  2EOY A;  2EOO A;  1TF6 A;  2EOX A;  2EMF A;  2EOJ A;  2LV2 A;  2EN2 A;  2EOQ A;  5KL7 A;  4M9V C;  2EMW A;  2DGC A;  1A1H A;  2VRD A;  2DMI A;  5KL4 A;  2DLQ A;  2EPR A;  2EPU A;  2D9H A;  1ZAA C;  2EJ4 A;  2NAB A;  2EPZ A;  4X9J A;  2EOH A;  3EPJ A;  2EMB A;  3EPK A;  4R2R A;  2EP3 A;  2M9A A;  4R2S A;  1JK1 A;  2EMK A;  2YSO A;  1UBD C;  2YRM A;  1YSA C;  3UK3 C;  2CSH A;  2LVH A;  2LO3 A;  2EM7 A;  2YTF A;  2EL6 A;  2EPP A;  2EQ1 A;  1BB8 A;  2EML A;  2YU8 A;  1KJK A;  1F2I G;  2WBS A;  2EM0 A;  1ZU1 A;  2J7J A;  3MHS C;  5KL6 A;  2EPC A;  2R1F A;  1RMD A;  2EL5 A;  1G2D C;  2YSP A;  2YRK A;  2DRP A;  4R2D A;  2EN8 A;  2EOF A;  2WBU A;  2WBT A;  2EM6 A;  1TF3 A;  5KL5 A;  2EOI A;  2EN1 A;  1X5W A;  2ENA A;  2EN4 A;  5KL2 A;  1A1J A;  1JK2 A;  2DLK A;  2EPX A;  2YTP A;  4FK5 C;  2EM3 A;  2EM2 A;  2EQ0 A;  1TN9 A;  2YTO A;  5KL3 A;  2RSI A;  4R2P A;  2I13 A;  1X6E A;  1BBO A;  2MDG A;  1YUJ A;  2JPA A;  2EN6 A;  4IJD A;  1MEY C;  4F2J C;  4R2Q A;  2RPC A;  2EL4 A;  2EQ3 A;  4F6M A;  1WJP A;  1B69 A;  1LLM C;  3EPH A;  1X6F A;  2CT1 A;  2EMI A;  1G2F C;  1A1L A;  3MHH C;  2YU5 A;  3M99 B;  2ELZ A;  2YTE A;  4R2E A;  4R2A A;  2EMZ A;  2YTD A;  2ENC A;  4F6N A;  2CTD A;  2EMH A;  2EOZ A;  1A1F A;  2YTQ A;  2EE8 A;  1A1I A;  4IS1 C;  1Z1B A;  1DGC A;  1X3C A;  2YTG A;  2ADR A;  2A25 A;  2YTN A;  2YTI A;  3EPL A;  2YTJ A;  2EM8 A;  2JP9 A;  2EN7 A;  2LCE A;  2EMA A;  2EOR A;  2ENH A;  2GHF A;  1UN6 B;  2EMX A;  2BB8 A;  2E72 A;  2EMC A;  1A1K A;  4R2C A;  2LT7 A;  1AAY A;  1ZR9 A;  2EMG A;  2EM5 A;  2GLI A;  2EM9 A;  2EOM A;  1NCS A;  2EPA A;  2EMY A;  1YUI A;  2EOE A;  2MKD A;  2ELY A;  2YRH A;  1P47 A;  2EOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...