1TF6A

Co-crystal structure of xenopus tfiiia zinc finger domain bound to the 5s ribosomal rna gene internal control region
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
YKRYICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIKICVYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*CP*GP*GP*GP*CP*CP*TP*GP*GP*TP*TP*AP*GP*TP*AP*C
publication title Differing roles for zinc fingers in DNA recognition: structure of a six-finger transcription factor IIIA complex.
pubmed doi rcsb
source organism Xenopus laevis
total genus 36
structure length 179
sequence length 179
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A05
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A06
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A02
2EN2A 1Z1BA 4R2QA 4R2PA 1TF3A 2EM9A 3VHTB 1RMDA 4X9JA 2EQ1A 2EOOA 2ELYA 2EN8A 4R2AA 2EP3A 2EOXA 2LV2A 2EQ3A 1TF6A 2MDGA 2EOYA 2EM8A 2EMXA 3MHSC 2EMYA 2ENAA 2YSPA 2YTJA 1AAYA 2YTQA 2EPAA 5KL6A 2EOIA 2WCC3 2EM2A 2EMGA 3MHHC 4R2DA 2HGHA 1JK2A 1G2FC 1BBOA 2EOJA 4F6MA 1YSAC 2EPCA 3EPLA 2EPUA 2WBTA 2BB8A 2DLQA 2CTDA 5KL3A 2EORA 4IJDA 2JPAA 5KL2A 2D9HA 1MEYC 2EMZA 2M9AA 2DLKA 1KJKA 4R2SA 2EQ0A 4F6NA 1DGCA 2JP9A 1NCSA 1UBDC 3EPKA 2WBSA 2YU5A 1JK1A 2EMAA 4GZNC 2EMIA 2EOMA 2YTOA 3M99B 1A1GA 2EMHA 4F2JC 2EMWA 1BB8A 1A1LA 2ENCA 2YSOA 2DGCA 1X5WA 2EMLA 4R2EA 1ZR9A 2EPZA 2EN1A 3UK3C 2ENHA 4IS1C 1YUJA 2EL4A 1B69A 1A1JA 1X6HA 2EM5A 1A1IA 2NABA 1WJPA 2EN7A 2EPXA 2MKDA 2LVHA 2LT7A 2EOSA 2DMIA 2ADRA 2ELZA 2EM7A 2DRPA 2RPCA 2YTDA 2EN4A 2EOQA 1P47A 1TN9A 2YTFA 2YTEA 2EOEA 2EMKA 2EPPA 1LLMC 1YUIA 2EL6A 1A1HA 2EM6A 3EPHA 2EOZA 2EPRA 2RSIA 2VRDA 1G2DC 5KL4A 2EOHA 2A25A 4M9VC 2CSHA 2GHFA 2EJ4A 2YTNA 2YTPA 4WSGA 2EM4A 3EPJA 1F2IG 1ZAAC 2YRHA 2PRTA 2EMCA 2EM3A 2EM0A 2YTIA 1ZU1A 1A1FA 5KL5A 4FK5C 2EMBA 5KL7A 4R2RA 2EOFA 1X6FA 2YRKA 2WBUA 2EMFA 2E72A 1UN6B 2CT1A 2J7JA 2LCEA 1A1KA 2EE8A 2EN3A 2YU8A 2GLIA 2YTGA 2EL5A 2EN6A 2LO3A 1X6EA 2R1FA 2YRMA 1X3CA 4R2CA 2I13A 2MKNA
chains in the Genus database with same CATH superfamily
4LF7E 1YYWA 3VHTB 3VYXA 1RQ0A 1RMDA 4KWYA 3C4BA 2EQ1A 1QNTA 2EOOA 4MLVA 4TUGA 2ELYA 2VQFE 2EOXA 5A69A 1T4LB 2MDGA 5A6BD 3MHSC 2ENAA 4O4KA 4JYAE 2EPOA 2K7IA 2JVAA 3MHHC 4R2DA 1SFEA 5AE2A 1JK2A 1G2FC 3L00A 4WFTA 5BR8E 4DV6E 2FV4B 4DV0E 2YWQA 1YFHA 2BB8A 2JPAA 5KL2A 2D9HA 1L4SA 1MEYC 2EMZA 4DV7E 4R2SA 1DGCA 3MSWA 3IWDA 2KONA 1KYQA 2YU5A 2EMAA 1GZ6A 1N32E 1EH6A 2EMIA 2V8QB 2YTOA 2EMHA 2E5LE 2NUEA 1XNRE 2YSOA 2DGCA 1ZR9A 2EPZA 2EN1A 2HC5A 1I94E 4KHPE 4LF5E 5A2QC 4JI3E 2EPXA 3AV0A 2LVHA 2LT7A 2DMIA 2V83A 3JTZA 1P47A 1HR0E 5A6KA 4MLQA 4BBYA 2YTFA 2UU9E 1X49A 1YUIA 4AQYE 3EPHA 2RSIA 2EOHA 2A25A 1IBME 3J7AG 2V85A 3C6KA 2N3GA 2EJ4A 3RMPA 2YTPA 1N33E 4DKKA 5AASA 3DF6A 1A1FA 2I9IA 4R2RA 2JYAA 1PJSA 2EOFA 4F9BB 4X8WA 4B3SE 1PDAA 2EMFA 3C4TA 2CT1A 4BS9A 2NUGA 2N8XA 2F8BA 2YTGA 4ZYEA 4B3TE 2LO3A 2YRMA 4LF4E 4RHBB 1X3CA 4NXNE 4NHRA 4HTGA 2EN2A 1Z1BA 2EM9A 4RH8A 4GEQB 4X9JA 4X64E 4Q28A 2HHHE 3TQMA 2EN8A 2LV2A 2Q8UA 4DR5E 1EKZA 1TF6A 1DQ3A 4YHHE 2YTJA 2YSPA 4JI2E 1WRJA 1IMUA 2EM2A 2EMGA 1IBLE 3VYYA 1BBOA 4GKJE 2LMZA 2VQEE 5IWAE 5AE3A 1FJGE 3EPLA 2EPLX 4M30A 4M2ZA 2WBTA 2DLQA 2UXDE 2CTDA 4BMJA 1PJTA 4DUYE 3KZZA 2BBGA 3THNA 2MC6A 2DLKA 2EQ0A 1T39A 1WHNA 4DR3E 2L2KB 4LFAE 4GZNC 4KZSA 3LMLA 2UXCE 3M99B 1FKAE 1PJQA 1EH7A 4F2JC 2EMWA 2LBSB 2N3HA 1A1LA 2ENCA 4WXDA 5AC4A 1XMQE 1BBGA 4JI8E 3JAMC 4L5NC 3UK3C 3ADGA 4IS1C 1YUJA 1T4OA 3EQ1A 3J80C 2NABA 2L8TA 1SR9A 3J81C 2ADRA 1YYKA 2LTRA 2RS6A 2EPNA 4B3ME 2JOBA 4WXCA 3HPZA 1TN9A 4DR1E 2YTEA 4DR6E 1G2DC 4M9VC 1T4NA 4NZVA 2CSHA 2LUPB 2YTNA 1F2IG 1ZAAC 3H09A 5LMNE 3BBGA 2L33A 3ADIA 2LJHA 2EMCA 2YTIA 2EPKX 4JI5E 1XNQE 1X6FA 4TUIA 2FTXB 2EWLA 1YYOA 2F4VE 2E72A 2J7JA 4R8OA 1STUA 2EN3A 2M7QA 2JR1A 3T1HE 2ODRD 2EL5A 1O0WA 2L6MA 2R1FA 3BGHA 4OOGC 2I13A 2MKNA 4R2QA 4R2PA 1MGTA 4I8OA 1TF3A 4WYQB 4J8ZA 2EP3A 5A6BA 2EQ3A 4JI4E 2RQLA 3VK6A 2EOYA 2L2MA 5DNYA 2EMXA 2L3JA 3P1XA 3K6QA 3HQ1A 2EOIA 4O5GA 2HGHA 3LLHA 2KOUA 5LL6R 2EPCA 5AC5A 1NEIA 1N3GA 2EPUA 2YZTA 2NA2A 2EORA 1ZBQA 4IJDA 3OMLA 2LRSA 4WX9A 3OTOE 1KJKA 5ADZA 1WHQA 4F6NA 1NCSA 1UBDC 2MDRA 1J26A 5F3WA 4DR7E 1BB8A 3F6GA 1YZ9A 1GTKA 4B3RE 3ADJA 2MC5A 1XMOE 5CFFE 2ENHA 2EL4A 1A1JA 1X6HA 2EM5A 2EZ6A 2JWOA 3QG5C 1A1IA 1WJPA 1PKPA 2JY9A 2ELZA 2V86A 3IWBA 5IV8B 2V88A 2EN4A 3FIGA 1T38A 2EOQA 1X48A 1AH5A 4WSPA 4O24A 2VF1A 4X65E 2EPPA 1LLMC 2EPMX 1A1HA 2L2NA 4YY3E 4DR4E 2EPRA 4F54A 4O43A 4P78A 2LJUA 2DIXA 4JI0E 2RTXA 2RS7A 4DV2E 3BF2A 1YPNA 2PRTA 2EM3A 2EM0A 1ZU1A 2LUQA 2UUAE 5KL7A 2EMBA 2YT4A 3HPSA 2B7TA 2V89A 4BCAA 3F6HA 3ZOQB 2DB2A 1A1KA 4DV3E 2GPIA 2ODRC 2ZM6E 2NUFA 4DV5E 4X62E 1X6EA 4JI7E 1IQOA 5IT9C 3J7Yp 4Q35B 4LU9A 2B9DA 1N34E 1ZBTA 3C6MA 4R2AA 2FGGA 3KWRA 2EM8A 2EMYA 2JOXA 2YPNA 1AAYA 2YTQA 1GQEA 2EPAA 5KL6A 2WCC3 4P7DA 3ADLA 2G7HA 3ECRA 4DUZE 1EH8A 2EOJA 4F6MA 4JI6E 1RC7A 1YSAC 2UUCE 2HJJA 1HNXE 2L92A 4HEIA 4ZYGA 5KL3A 1HNWE 4NXME 1IBKE 2K4VA 2M9AA 5IXMB 2L3CA 2JP9A 3EPKA 2WBSA 4L8NA 4N4RB 2V87A 4BHCA 1JK1A 4LFCE 1WXRA 2EOMA 2LTSA 2R76A 1A1GA 5A6JA 2DSYA 1N36E 5AE1A 4LFBE 3HXLA 2E1MA 2H36X 1X5WA 2EMLA 4R2EA 4R03A 4BHBA 4F9CB 1HNZE 5T6JA 3KZYA 2DMYA 1B69A 5A6AA 2VE7C 4BC9A 2EN7A 2MKDA 5LMUE 4ZYHA 2EOSA 4LF9E 2EM7A 2DRPA 4JV5E 4GKKE 2RPCA 2YTDA 2M4IA 1IQSA 2CPNA 1QU6A 3HTXA 1UILA 5FLXC 2WZOA 2EOEA 4BC7A 4LF8E 2RSMA 2EMKA 3JU0A 2B3TB 2EL6A 2EM6A 3THOB 4DR2E 2EOZA 5TSEA 2VRDA 5KL4A 4X66E 4F9AB 2GHFA 2M1SA 4WSGA 2EM4A 3EPJA 2JXPA 4M0VA 3AUZA 2YRHA 3T1YE 4JI1E 1X47A 5LLQA 3DJWA 2KHXA 1UHZA 4FK5C 5KL5A 2WBUA 2YRKA 4LF6E 1UN6B 2LCEA 2UUBE 4LTYA 1J5EE 4DMIA 2EE8A 2YU8A 2IHR1 2GLIA 4WPYA 4DV1E 4K0KE 4OX9E 3IWCA 2EN6A 2UXBE 3BIDA 2LE2A 4DV4E 2B7VA 1DI2A 4ZYDA 4R2CA
chains in the Genus database with same CATH topology
2EN2A 1Z1BA 4R2QA 4R2PA 1TF3A 2EM9A 3VHTB 1RMDA 4X9JA 2EQ1A 2EOOA 2ELYA 2EN8A 4R2AA 2EP3A 2EOXA 2LV2A 2EQ3A 1TF6A 2MDGA 2EOYA 2EM8A 2EMXA 3MHSC 2EMYA 2ENAA 2YSPA 2YTJA 1AAYA 2YTQA 2EPAA 5KL6A 2EOIA 2WCC3 2EM2A 2EMGA 3MHHC 4R2DA 2HGHA 1JK2A 1G2FC 1BBOA 2EOJA 4F6MA 1YSAC 2EPCA 3EPLA 2EPUA 2WBTA 2BB8A 2DLQA 2CTDA 5KL3A 2EORA 4IJDA 2JPAA 5KL2A 2D9HA 1MEYC 2EMZA 2M9AA 2DLKA 1KJKA 4R2SA 2EQ0A 4F6NA 1DGCA 2JP9A 1NCSA 1UBDC 3EPKA 2WBSA 2YU5A 1JK1A 2EMAA 4GZNC 2EMIA 2EOMA 2YTOA 3M99B 1A1GA 2EMHA 4F2JC 2EMWA 1BB8A 1A1LA 2ENCA 2YSOA 2DGCA 1X5WA 2EMLA 4R2EA 1ZR9A 2EPZA 2EN1A 3UK3C 2ENHA 4IS1C 1YUJA 2EL4A 1B69A 1A1JA 1X6HA 2EM5A 1A1IA 2NABA 1WJPA 2EN7A 2EPXA 2MKDA 2LVHA 2LT7A 2EOSA 2DMIA 2ADRA 2ELZA 2EM7A 2DRPA 2RPCA 2YTDA 2EN4A 2EOQA 1P47A 1TN9A 2YTFA 2YTEA 2EOEA 2EMKA 2EPPA 1LLMC 1YUIA 2EL6A 1A1HA 2EM6A 3EPHA 2EOZA 2EPRA 2RSIA 2VRDA 1G2DC 5KL4A 2EOHA 2A25A 4M9VC 2CSHA 2GHFA 2EJ4A 2YTNA 2YTPA 4WSGA 2EM4A 3EPJA 1F2IG 1ZAAC 2YRHA 2PRTA 2EMCA 2EM3A 2EM0A 2YTIA 1ZU1A 1A1FA 5KL5A 4FK5C 2EMBA 5KL7A 4R2RA 2EOFA 1X6FA 2YRKA 2WBUA 2EMFA 2E72A 1UN6B 2CT1A 2J7JA 2LCEA 1A1KA 2EE8A 2EN3A 2YU8A 2GLIA 2YTGA 2EL5A 2EN6A 2LO3A 1X6EA 2R1FA 2YRMA 1X3CA 4R2CA 2I13A 2MKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN2 A;  1Z1B A;  4R2Q A;  4R2P A;  1TF3 A;  2EM9 A;  3VHT B;  1RMD A;  4X9J A;  2EQ1 A;  2EOO A;  2ELY A;  2EN8 A;  4R2A A;  2EP3 A;  2EOX A;  2LV2 A;  2EQ3 A;  1TF6 A;  2MDG A;  2EOY A;  2EM8 A;  2EMX A;  3MHS C;  2EMY A;  2ENA A;  2YSP A;  2YTJ A;  1AAY A;  2YTQ A;  2EPA A;  5KL6 A;  2EOI A;  2WCC 3;  2EM2 A;  2EMG A;  3MHH C;  4R2D A;  2HGH A;  1JK2 A;  1G2F C;  1BBO A;  2EOJ A;  4F6M A;  1YSA C;  2EPC A;  3EPL A;  2EPU A;  2WBT A;  2BB8 A;  2DLQ A;  2CTD A;  5KL3 A;  2EOR A;  4IJD A;  2JPA A;  5KL2 A;  2D9H A;  1MEY C;  2EMZ A;  2M9A A;  2DLK A;  1KJK A;  4R2S A;  2EQ0 A;  4F6N A;  1DGC A;  2JP9 A;  1NCS A;  1UBD C;  3EPK A;  2WBS A;  2YU5 A;  1JK1 A;  2EMA A;  4GZN C;  2EMI A;  2EOM A;  2YTO A;  3M99 B;  1A1G A;  2EMH A;  4F2J C;  2EMW A;  1BB8 A;  1A1L A;  2ENC A;  2YSO A;  2DGC A;  1X5W A;  2EML A;  4R2E A;  1ZR9 A;  2EPZ A;  2EN1 A;  3UK3 C;  2ENH A;  4IS1 C;  1YUJ A;  2EL4 A;  1B69 A;  1A1J A;  1X6H A;  2EM5 A;  1A1I A;  2NAB A;  1WJP A;  2EN7 A;  2EPX A;  2MKD A;  2LVH A;  2LT7 A;  2EOS A;  2DMI A;  2ADR A;  2ELZ A;  2EM7 A;  2DRP A;  2RPC A;  2YTD A;  2EN4 A;  2EOQ A;  1P47 A;  1TN9 A;  2YTF A;  2YTE A;  2EOE A;  2EMK A;  2EPP A;  1LLM C;  1YUI A;  2EL6 A;  1A1H A;  2EM6 A;  3EPH A;  2EOZ A;  2EPR A;  2RSI A;  2VRD A;  1G2D C;  5KL4 A;  2EOH A;  2A25 A;  4M9V C;  2CSH A;  2GHF A;  2EJ4 A;  2YTN A;  2YTP A;  4WSG A;  2EM4 A;  3EPJ A;  1F2I G;  1ZAA C;  2YRH A;  2PRT A;  2EMC A;  2EM3 A;  2EM0 A;  2YTI A;  1ZU1 A;  1A1F A;  5KL5 A;  4FK5 C;  2EMB A;  5KL7 A;  4R2R A;  2EOF A;  1X6F A;  2YRK A;  2WBU A;  2EMF A;  2E72 A;  1UN6 B;  2CT1 A;  2J7J A;  2LCE A;  1A1K A;  2EE8 A;  2EN3 A;  2YU8 A;  2GLI A;  2YTG A;  2EL5 A;  2EN6 A;  2LO3 A;  1X6E A;  2R1F A;  2YRM A;  1X3C A;  4R2C A;  2I13 A;  2MKN A; 
#chains in the Genus database with same CATH topology
 4LF7 E;  1YYW A;  3VHT B;  3VYX A;  1RQ0 A;  1RMD A;  4KWY A;  3C4B A;  2EQ1 A;  1QNT A;  2EOO A;  4MLV A;  4TUG A;  2ELY A;  2VQF E;  2EOX A;  5A69 A;  1T4L B;  2MDG A;  5A6B D;  3MHS C;  2ENA A;  4O4K A;  4JYA E;  2EPO A;  2K7I A;  2JVA A;  3MHH C;  4R2D A;  1SFE A;  5AE2 A;  1JK2 A;  1G2F C;  3L00 A;  4WFT A;  5BR8 E;  4DV6 E;  2FV4 B;  4DV0 E;  2YWQ A;  1YFH A;  2BB8 A;  2JPA A;  5KL2 A;  2D9H A;  1L4S A;  1MEY C;  2EMZ A;  4DV7 E;  4R2S A;  1DGC A;  3MSW A;  3IWD A;  2KON A;  1KYQ A;  2YU5 A;  2EMA A;  1GZ6 A;  1N32 E;  1EH6 A;  2EMI A;  2V8Q B;  2YTO A;  2EMH A;  2E5L E;  2NUE A;  1XNR E;  2YSO A;  2DGC A;  1ZR9 A;  2EPZ A;  2EN1 A;  2HC5 A;  1I94 E;  4KHP E;  4LF5 E;  5A2Q C;  4JI3 E;  2EPX A;  3AV0 A;  2LVH A;  2LT7 A;  2DMI A;  2V83 A;  3JTZ A;  1P47 A;  1HR0 E;  5A6K A;  4MLQ A;  4BBY A;  2YTF A;  2UU9 E;  1X49 A;  1YUI A;  4AQY E;  3EPH A;  2RSI A;  2EOH A;  2A25 A;  1IBM E;  3J7A G;  2V85 A;  3C6K A;  2N3G A;  2EJ4 A;  3RMP A;  2YTP A;  1N33 E;  4DKK A;  5AAS A;  3DF6 A;  1A1F A;  2I9I A;  4R2R A;  2JYA A;  1PJS A;  2EOF A;  4F9B B;  4X8W A;  4B3S E;  1PDA A;  2EMF A;  3C4T A;  2CT1 A;  4BS9 A;  2NUG A;  2N8X A;  2F8B A;  2YTG A;  4ZYE A;  4B3T E;  2LO3 A;  2YRM A;  4LF4 E;  4RHB B;  1X3C A;  4NXN E;  4NHR A;  4HTG A;  2EN2 A;  1Z1B A;  2EM9 A;  4RH8 A;  4GEQ B;  4X9J A;  4X64 E;  4Q28 A;  2HHH E;  3TQM A;  2EN8 A;  2LV2 A;  2Q8U A;  4DR5 E;  1EKZ A;  1TF6 A;  1DQ3 A;  4YHH E;  2YTJ A;  2YSP A;  4JI2 E;  1WRJ A;  1IMU A;  2EM2 A;  2EMG A;  1IBL E;  3VYY A;  1BBO A;  4GKJ E;  2LMZ A;  2VQE E;  5IWA E;  5AE3 A;  1FJG E;  3EPL A;  2EPL X;  4M30 A;  4M2Z A;  2WBT A;  2DLQ A;  2UXD E;  2CTD A;  4BMJ A;  1PJT A;  4DUY E;  3KZZ A;  2BBG A;  3THN A;  2MC6 A;  2DLK A;  2EQ0 A;  1T39 A;  1WHN A;  4DR3 E;  2L2K B;  4LFA E;  4GZN C;  4KZS A;  3LML A;  2UXC E;  3M99 B;  1FKA E;  1PJQ A;  1EH7 A;  4F2J C;  2EMW A;  2LBS B;  2N3H A;  1A1L A;  2ENC A;  4WXD A;  5AC4 A;  1XMQ E;  1BBG A;  4JI8 E;  3JAM C;  4L5N C;  3UK3 C;  3ADG A;  4IS1 C;  1YUJ A;  1T4O A;  3EQ1 A;  3J80 C;  2NAB A;  2L8T A;  1SR9 A;  3J81 C;  2ADR A;  1YYK A;  2LTR A;  2RS6 A;  2EPN A;  4B3M E;  2JOB A;  4WXC A;  3HPZ A;  1TN9 A;  4DR1 E;  2YTE A;  4DR6 E;  1G2D C;  4M9V C;  1T4N A;  4NZV A;  2CSH A;  2LUP B;  2YTN A;  1F2I G;  1ZAA C;  3H09 A;  5LMN E;  3BBG A;  2L33 A;  3ADI A;  2LJH A;  2EMC A;  2YTI A;  2EPK X;  4JI5 E;  1XNQ E;  1X6F A;  4TUI A;  2FTX B;  2EWL A;  1YYO A;  2F4V E;  2E72 A;  2J7J A;  4R8O A;  1STU A;  2EN3 A;  2M7Q A;  2JR1 A;  3T1H E;  2ODR D;  2EL5 A;  1O0W A;  2L6M A;  2R1F A;  3BGH A;  4OOG C;  2I13 A;  2MKN A;  4R2Q A;  4R2P A;  1MGT A;  4I8O A;  1TF3 A;  4WYQ B;  4J8Z A;  2EP3 A;  5A6B A;  2EQ3 A;  4JI4 E;  2RQL A;  3VK6 A;  2EOY A;  2L2M A;  5DNY A;  2EMX A;  2L3J A;  3P1X A;  3K6Q A;  3HQ1 A;  2EOI A;  4O5G A;  2HGH A;  3LLH A;  2KOU A;  5LL6 R;  2EPC A;  5AC5 A;  1NEI A;  1N3G A;  2EPU A;  2YZT A;  2NA2 A;  2EOR A;  1ZBQ A;  4IJD A;  3OML A;  2LRS A;  4WX9 A;  3OTO E;  1KJK A;  5ADZ A;  1WHQ A;  4F6N A;  1NCS A;  1UBD C;  2MDR A;  1J26 A;  5F3W A;  4DR7 E;  1BB8 A;  3F6G A;  1YZ9 A;  1GTK A;  4B3R E;  3ADJ A;  2MC5 A;  1XMO E;  5CFF E;  2ENH A;  2EL4 A;  1A1J A;  1X6H A;  2EM5 A;  2EZ6 A;  2JWO A;  3QG5 C;  1A1I A;  1WJP A;  1PKP A;  2JY9 A;  2ELZ A;  2V86 A;  3IWB A;  5IV8 B;  2V88 A;  2EN4 A;  3FIG A;  1T38 A;  2EOQ A;  1X48 A;  1AH5 A;  4WSP A;  4O24 A;  2VF1 A;  4X65 E;  2EPP A;  1LLM C;  2EPM X;  1A1H A;  2L2N A;  4YY3 E;  4DR4 E;  2EPR A;  4F54 A;  4O43 A;  4P78 A;  2LJU A;  2DIX A;  4JI0 E;  2RTX A;  2RS7 A;  4DV2 E;  3BF2 A;  1YPN A;  2PRT A;  2EM3 A;  2EM0 A;  1ZU1 A;  2LUQ A;  2UUA E;  5KL7 A;  2EMB A;  2YT4 A;  3HPS A;  2B7T A;  2V89 A;  4BCA A;  3F6H A;  3ZOQ B;  2DB2 A;  1A1K A;  4DV3 E;  2GPI A;  2ODR C;  2ZM6 E;  2NUF A;  4DV5 E;  4X62 E;  1X6E A;  4JI7 E;  1IQO A;  5IT9 C;  3J7Y p;  4Q35 B;  4LU9 A;  2B9D A;  1N34 E;  1ZBT A;  3C6M A;  4R2A A;  2FGG A;  3KWR A;  2EM8 A;  2EMY A;  2JOX A;  2YPN A;  1AAY A;  2YTQ A;  1GQE A;  2EPA A;  5KL6 A;  2WCC 3;  4P7D A;  3ADL A;  2G7H A;  3ECR A;  4DUZ E;  1EH8 A;  2EOJ A;  4F6M A;  4JI6 E;  1RC7 A;  1YSA C;  2UUC E;  2HJJ A;  1HNX E;  2L92 A;  4HEI A;  4ZYG A;  5KL3 A;  1HNW E;  4NXM E;  1IBK E;  2K4V A;  2M9A A;  5IXM B;  2L3C A;  2JP9 A;  3EPK A;  2WBS A;  4L8N A;  4N4R B;  2V87 A;  4BHC A;  1JK1 A;  4LFC E;  1WXR A;  2EOM A;  2LTS A;  2R76 A;  1A1G A;  5A6J A;  2DSY A;  1N36 E;  5AE1 A;  4LFB E;  3HXL A;  2E1M A;  2H36 X;  1X5W A;  2EML A;  4R2E A;  4R03 A;  4BHB A;  4F9C B;  1HNZ E;  5T6J A;  3KZY A;  2DMY A;  1B69 A;  5A6A A;  2VE7 C;  4BC9 A;  2EN7 A;  2MKD A;  5LMU E;  4ZYH A;  2EOS A;  4LF9 E;  2EM7 A;  2DRP A;  4JV5 E;  4GKK E;  2RPC A;  2YTD A;  2M4I A;  1IQS A;  2CPN A;  1QU6 A;  3HTX A;  1UIL A;  5FLX C;  2WZO A;  2EOE A;  4BC7 A;  4LF8 E;  2RSM A;  2EMK A;  3JU0 A;  2B3T B;  2EL6 A;  2EM6 A;  3THO B;  4DR2 E;  2EOZ A;  5TSE A;  2VRD A;  5KL4 A;  4X66 E;  4F9A B;  2GHF A;  2M1S A;  4WSG A;  2EM4 A;  3EPJ A;  2JXP A;  4M0V A;  3AUZ A;  2YRH A;  3T1Y E;  4JI1 E;  1X47 A;  5LLQ A;  3DJW A;  2KHX A;  1UHZ A;  4FK5 C;  5KL5 A;  2WBU A;  2YRK A;  4LF6 E;  1UN6 B;  2LCE A;  2UUB E;  4LTY A;  1J5E E;  4DMI A;  2EE8 A;  2YU8 A;  2IHR 1;  2GLI A;  4WPY A;  4DV1 E;  4K0K E;  4OX9 E;  3IWC A;  2EN6 A;  2UXB E;  3BID A;  2LE2 A;  4DV4 E;  2B7V A;  1DI2 A;  4ZYD A;  4R2C A; 
#chains in the Genus database with same CATH homology
 2EN2 A;  1Z1B A;  4R2Q A;  4R2P A;  1TF3 A;  2EM9 A;  3VHT B;  1RMD A;  4X9J A;  2EQ1 A;  2EOO A;  2ELY A;  2EN8 A;  4R2A A;  2EP3 A;  2EOX A;  2LV2 A;  2EQ3 A;  1TF6 A;  2MDG A;  2EOY A;  2EM8 A;  2EMX A;  3MHS C;  2EMY A;  2ENA A;  2YSP A;  2YTJ A;  1AAY A;  2YTQ A;  2EPA A;  5KL6 A;  2EOI A;  2WCC 3;  2EM2 A;  2EMG A;  3MHH C;  4R2D A;  2HGH A;  1JK2 A;  1G2F C;  1BBO A;  2EOJ A;  4F6M A;  1YSA C;  2EPC A;  3EPL A;  2EPU A;  2WBT A;  2BB8 A;  2DLQ A;  2CTD A;  5KL3 A;  2EOR A;  4IJD A;  2JPA A;  5KL2 A;  2D9H A;  1MEY C;  2EMZ A;  2M9A A;  2DLK A;  1KJK A;  4R2S A;  2EQ0 A;  4F6N A;  1DGC A;  2JP9 A;  1NCS A;  1UBD C;  3EPK A;  2WBS A;  2YU5 A;  1JK1 A;  2EMA A;  4GZN C;  2EMI A;  2EOM A;  2YTO A;  3M99 B;  1A1G A;  2EMH A;  4F2J C;  2EMW A;  1BB8 A;  1A1L A;  2ENC A;  2YSO A;  2DGC A;  1X5W A;  2EML A;  4R2E A;  1ZR9 A;  2EPZ A;  2EN1 A;  3UK3 C;  2ENH A;  4IS1 C;  1YUJ A;  2EL4 A;  1B69 A;  1A1J A;  1X6H A;  2EM5 A;  1A1I A;  2NAB A;  1WJP A;  2EN7 A;  2EPX A;  2MKD A;  2LVH A;  2LT7 A;  2EOS A;  2DMI A;  2ADR A;  2ELZ A;  2EM7 A;  2DRP A;  2RPC A;  2YTD A;  2EN4 A;  2EOQ A;  1P47 A;  1TN9 A;  2YTF A;  2YTE A;  2EOE A;  2EMK A;  2EPP A;  1LLM C;  1YUI A;  2EL6 A;  1A1H A;  2EM6 A;  3EPH A;  2EOZ A;  2EPR A;  2RSI A;  2VRD A;  1G2D C;  5KL4 A;  2EOH A;  2A25 A;  4M9V C;  2CSH A;  2GHF A;  2EJ4 A;  2YTN A;  2YTP A;  4WSG A;  2EM4 A;  3EPJ A;  1F2I G;  1ZAA C;  2YRH A;  2PRT A;  2EMC A;  2EM3 A;  2EM0 A;  2YTI A;  1ZU1 A;  1A1F A;  5KL5 A;  4FK5 C;  2EMB A;  5KL7 A;  4R2R A;  2EOF A;  1X6F A;  2YRK A;  2WBU A;  2EMF A;  2E72 A;  1UN6 B;  2CT1 A;  2J7J A;  2LCE A;  1A1K A;  2EE8 A;  2EN3 A;  2YU8 A;  2GLI A;  2YTG A;  2EL5 A;  2EN6 A;  2LO3 A;  1X6E A;  2R1F A;  2YRM A;  1X3C A;  4R2C A;  2I13 A;  2MKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...