1TF6A

Co-crystal structure of xenopus tfiiia zinc finger domain bound to the 5s ribosomal rna gene internal control region
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
YKRYICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIKICVYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*CP*GP*GP*GP*CP*CP*TP*GP*GP*TP*TP*AP*GP*TP*AP*C
publication title Differing roles for zinc fingers in DNA recognition: structure of a six-finger transcription factor IIIA complex.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
total genus 36
structure length 179
sequence length 179
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A05
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A06
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A02
3VHTB 4R2QA 4R2CA 2EN6A 2R1FA 2LVHA 2EM0A 2EOXA 1X5WA 2EMYA 2EQ1A 1F2IG 3MHSC 4R2SA 2HGHA 4F6MA 2JP9A 2EPAA 4R2DA 3MHHC 2GLIA 4R2RA 2EM3A 1A1GA 2EP3A 2EN4A 2I13A 1RMDA 2YTDA 2EOJA 1LLMC 1BB8A 2DGCA 2YTFA 2EM4A 2GHFA 2CTDA 2EL6A 2EMZA 2ELZA 2WBUA 2EQ0A 1YUIA 3EPLA 2EMXA 4WSGA 1G2DC 2EPCA 1MEYC 2YTPA 1ZR9A 2EN8A 4F2JC 1TF6A 2J7JA 2YTOA 1A1JA 2ENAA 4IS1C 2LT7A 1X6HA 2EE8A 1A1KA 2EMAA 2YRHA 2EMFA 2EPZA 3EPKA 5KL6A 2YU8A 2EMIA 1B69A 2EOFA 2DLKA 2JPAA 2EM6A 2A25A 2EOEA 2EN7A 2RPCA 1A1LA 2EN2A 1A1IA 2YSPA 2ELYA 1ZU1A 2YSOA 2YTEA 2YTNA 2YTGA 2WBSA 1Z1BA 4F6NA 2DMIA 2EORA 2EMLA 2EPPA 4X9JA 1G2FC 3UK3C 5KL4A 2DLQA 2MDGA 1BBOA 2EMBA 4R2PA 2EOQA 2RSIA 1X6FA 2WBTA 2EM8A 1A1FA 2EM5A 2EMKA 1NCSA 1X3CA 2E72A 5KL5A 1YSAC 5KL7A 1A1HA 2EN3A 2LO3A 1P47A 2YU5A 1JK1A 2CT1A 2YRMA 2EOIA 2EPRA 1KJKA 3EPHA 2VRDA 2YTQA 2EM9A 1AAYA 2EL4A 2EMCA 5KL2A 1UN6B 3EPJA 4R2AA 1TN9A 2M9AA 2NABA 2EN1A 2MKDA 4GZNC 1DGCA 2YTJA 1WJPA 4M9VC 2ENHA 2EJ4A 1YUJA 4IJDA 2EMWA 2EMGA 2ADRA 2EOSA 4FK5C 2EPUA 2EL5A 2CSHA 2D9HA 2ENCA 2EMHA 1TF3A 2EOZA 3M99B 2EM7A 2PRTA 2EOHA 2YRKA 5KL3A 1UBDC 1JK2A 2WCC3 2EQ3A 1ZAAC 2DRPA 2MKNA 1X6EA 2EOMA 4R2EA 2EOYA 2YTIA 2EOOA 2EPXA 2EM2A 2LV2A 2LCEA 2BB8A
chains in the Genus database with same CATH superfamily
3HPSA 2NA2A 3BBGA 1FJGE 1X5WA 2EMYA 3MHSC 4BBYA 2HGHA 2EPNA 2JP9A 2CPNA 3AV0A 4JI4E 2LUPB 3IWCA 3J7AG 2EM3A 2I13A 1PJTA 1BB8A 3IWDA 4DV1E 1HNZE 2EMZA 1PJQA 2WBUA 4L5NC 2JY9A 2EQ0A 3K6QA 1ZR9A 3KZZA 4YHHE 1IQSA 4IS1C 4DV0E 2LT7A 3T1YE 2LE2A 4F54A 3HTXA 3EPKA 4DR3E 2GPIA 2L2KB 1ZBQA 4J8ZA 5AC5A 1EH8A 4K0KE 2EOEA 2UXCE 3IWBA 1EKZA 4O5GA 2YSPA 2YSOA 2YTEA 1G2FC 2WBSA 2EORA 4X9JA 2B7VA 4N4RB 1DI2A 1BBOA 2YPNA 2EMBA 4WX9A 3F6GA 2YT4A 3F6HA 2L92A 4LU9A 2DIXA 2FGGA 4LF5E 1XMQE 1GTKA 4DR5E 2EN3A 2HJJA 4DV4E 2LTRA 2UU9E 2EPRA 4GEQB 3L00A 4BHBA 2L6MA 2EMCA 5KL2A 4DUZE 3DF6A 3EPJA 1WHNA 2YWQA 2F8BA 2M9AA 1NEIA 5IXMB 4GZNC 1XNRE 1DGCA 4TUIA 5F3WA 1KYQA 2HC5A 5A6KA 3C4TA 2EOSA 2V85A 3EQ1A 4O4KA 1DQ3A 3H09A 4ZYDA 2EOZA 2PRTA 1JK2A 4MLVA 3LLHA 4WXCA 4JI8E 1PKPA 2MKNA 3ADJA 2JOXA 2LTSA 4KWYA 4YY3E 2WZOA 4LF4E 2L2MA 3JAMC 2LJHA 3VHTB 4WFTA 4R2QA 2V83A 4DR7E 5AC4A 2R1FA 3OMLA 1F2IG 2V88A 4ZYHA 2V89A 2JYAA 2HHHE 4R8OA 2B7TA 4LF7E 2Q8UA 3MHHC 2GLIA 1STUA 5AE2A 2ODRD 1XMOE 1AH5A 2EM4A 2EWLA 2EL6A 2CTDA 2GHFA 2L3CA 2L3JA 4R03A 2LBSB 5AE3A 4JI2E 2EN8A 4F2JC 1TF6A 2J7JA 4JI7E 1YZ9A 5LMUE 5LMNE 2YZTA 1EH7A 2EE8A 4WPYA 2EMAA 4M30A 2ZM6E 2YU8A 4AQYE 2EMIA 2EOFA 1T39A 2JPAA 2UUBE 2V8QB 5LLQA 2A25A 2RPCA 1IBLE 4X64E 3THNA 1A1IA 4WSPA 3BIDA 2YTGA 1IBKE 5IV8B 1Z1BA 3C6MA 2EPPA 2EMLA 4JI5E 3UK3C 5KL4A 3BF2A 4F9AB 3ECRA 2EM8A 2EM5A 4OX9E 1X3CA 2LJUA 4JYAE 5LL6R 2H36X 2JWOA 4BHCA 4ZYGA 1YYWA 2LO3A 1P47A 2YU5A 4JI3E 5A6BA 2YRMA 2EOIA 3EPHA 2VRDA 2EM9A 1WHQA 2KOUA 1TN9A 4LF8E 1GQEA 3BGHA 4B3ME 4NXNE 4BC7A 2EN1A 1FKAE 1WJPA 1GZ6A 2DMYA 2EMWA 3T1HE 4JV5E 3QG5C 1YYKA 5A69A 1PDAA 2B9DA 1I94E 4DV6E 4DV3E 4OOGC 4LFBE 2D9HA 1IBME 1TF3A 4BC9A 1N32E 2RTXA 1X47A 2RS6A 3J7Yp 2DRPA 1ZAAC 2UUAE 2EOMA 5IWAE 5T6JA 1YPNA 3ADLA 2EM2A 5ADZA 2VF1A 2VQFE 2LVHA 2EM0A 2EOXA 2EQ1A 2KHXA 4TUGA 4LFCE 4DV2E 2IHR1 4NZVA 5FLXC 5TSEA 2N3HA 4RH8A 2NUEA 4R2RA 1RC7A 1A1GA 2MDRA 2N3GA 1J26A 5AASA 1SFEA 4KHPE 2YTDA 1XNQE 2DGCA 1BBGA 2I9IA 4BMJA 2LRSA 3EPLA 2EMXA 4LFAE 2EPCA 2YTPA 3JTZA 2MC5A 3ADGA 2YTOA 1HNWE 4GKKE 2JXPA 2YRHA 1IMUA 2JOBA 1B69A 2K7IA 3VYYA 1YYOA 1T38A 4HEIA 3DJWA 4NXME 2MC6A 2L33A 2ELYA 1ZU1A 4F6NA 2DMIA 4DR1E 2EPMX 2L2NA 1WRJA 4JI0E 2DLQA 3THOB 4DR2E 4R2PA 2G7HA 1QNTA 3RMPA 2RSIA 2WBTA 1A1FA 4M0VA 4ZYEA 2M4IA 4DUYE 3KWRA 1SR9A 2E72A 4KZSA 5KL5A 1YSAC 4P7DA 4DR6E 2E5LE 5BR8E 2FV4B 2RQLA 4JI1E 4DV7E 1KJKA 4DV5E 3VYXA 5A6BD 2EL4A 4DR4E 1O0WA 2BBGA 3VK6A 2NABA 2YTJA 4M9VC 2EJ4A 4IJDA 5A6AA 3C4BA 2ADRA 3MSWA 4FK5C 2UXBE 2EMHA 5DNYA 4GKJE 1QU6A 3P1XA 3TQMA 2EOHA 2YRKA 3FIGA 2WCC3 1RQ0A 2B3TB 3HPZA 4R2EA 2YTIA 2EPXA 2LV2A 4X65E 2LCEA 2JVAA 4R2CA 2EN6A 3ZOQB 3J80C 4B3RE 3LMLA 4B3TE 2LMZA 4R2SA 2M7QA 4F6MA 2EPAA 2EZ6A 2EPLX 2K4VA 1UILA 4R2DA 1T4OA 4MLQA 4M2ZA 2EP3A 2DSYA 1HR0E 2EN4A 4X62E 1RMDA 5IT9C 4LF6E 4O43A 1N33E 2EOJA 3HXLA 2JR1A 1LLMC 2YTFA 4WYQB 4WXDA 2ELZA 2UUCE 1N36E 1YUIA 4RHBB 4WSGA 1G2DC 1MEYC 3C6KA 4DKKA 1A1JA 2ENAA 1N34E 1X6HA 1A1KA 2V86A 4B3SE 2EMFA 2EPZA 1WXRA 5KL6A 2DLKA 4X66E 2DB2A 2EM6A 4X8WA 2EN7A 2F4VE 2RS7A 2VQEE 4BCAA 1A1LA 2EN2A 1X48A 1T4NA 2YTNA 4I8OA 3J81C 1EH6A 3AUZA 1N3GA 5A2QC 2FTXB 1PJSA 4O24A 2MDGA 2LUQA 2NUGA 2EOQA 1X6FA 2KONA 5CFFE 2EMKA 1NCSA 4DMIA 5A6JA 5KL7A 1A1HA 1IQOA 4Q35B 2NUFA 1JK1A 2CT1A 2R76A 4L8NA 2E1MA 4NHRA 1ZBTA 2L8TA 1T4LB 2YTQA 1AAYA 1UHZA 1UN6B 2EPOA 4R2AA 4LF9E 4LTYA 3JU0A 2MKDA 2RSMA 2ENHA 1YUJA 3OTOE 2EMGA 4Q28A 5AE1A 1J5EE 4F9BB 2UXDE 3HQ1A 2EPUA 2V87A 2EL5A 2CSHA 3KZYA 4HTGA 2ENCA 4JI6E 2N8XA 2ODRC 3M99B 2EM7A 4P78A 3ADIA 2VE7C 5KL3A 1UBDC 2M1SA 1HNXE 1L4SA 1YFHA 2EQ3A 4F9CB 2EPKX 1X6EA 2EOYA 1MGTA 1X49A 2EOOA 4BS9A 2BB8A
chains in the Genus database with same CATH topology
3VHTB 4R2QA 4R2CA 2EN6A 2R1FA 2LVHA 2EM0A 2EOXA 1X5WA 2EMYA 2EQ1A 1F2IG 3MHSC 4R2SA 2HGHA 4F6MA 2JP9A 2EPAA 4R2DA 3MHHC 2GLIA 4R2RA 2EM3A 1A1GA 2EP3A 2EN4A 2I13A 1RMDA 2YTDA 2EOJA 1LLMC 1BB8A 2DGCA 2YTFA 2EM4A 2GHFA 2CTDA 2EL6A 2EMZA 2ELZA 2WBUA 2EQ0A 1YUIA 3EPLA 2EMXA 4WSGA 1G2DC 2EPCA 1MEYC 2YTPA 1ZR9A 2EN8A 4F2JC 1TF6A 2J7JA 2YTOA 1A1JA 2ENAA 4IS1C 2LT7A 1X6HA 2EE8A 1A1KA 2EMAA 2YRHA 2EMFA 2EPZA 3EPKA 5KL6A 2YU8A 2EMIA 1B69A 2EOFA 2DLKA 2JPAA 2EM6A 2A25A 2EOEA 2EN7A 2RPCA 1A1LA 2EN2A 1A1IA 2YSPA 2ELYA 1ZU1A 2YSOA 2YTEA 2YTNA 2YTGA 2WBSA 1Z1BA 4F6NA 2DMIA 2EORA 2EMLA 2EPPA 4X9JA 1G2FC 3UK3C 5KL4A 2DLQA 2MDGA 1BBOA 2EMBA 4R2PA 2EOQA 2RSIA 1X6FA 2WBTA 2EM8A 1A1FA 2EM5A 2EMKA 1NCSA 1X3CA 2E72A 5KL5A 1YSAC 5KL7A 1A1HA 2EN3A 2LO3A 1P47A 2YU5A 1JK1A 2CT1A 2YRMA 2EOIA 2EPRA 1KJKA 3EPHA 2VRDA 2YTQA 2EM9A 1AAYA 2EL4A 2EMCA 5KL2A 1UN6B 3EPJA 4R2AA 1TN9A 2M9AA 2NABA 2EN1A 2MKDA 4GZNC 1DGCA 2YTJA 1WJPA 4M9VC 2ENHA 2EJ4A 1YUJA 4IJDA 2EMWA 2EMGA 2ADRA 2EOSA 4FK5C 2EPUA 2EL5A 2CSHA 2D9HA 2ENCA 2EMHA 1TF3A 2EOZA 3M99B 2EM7A 2PRTA 2EOHA 2YRKA 5KL3A 1UBDC 1JK2A 2WCC3 2EQ3A 1ZAAC 2DRPA 2MKNA 1X6EA 2EOMA 4R2EA 2EOYA 2YTIA 2EOOA 2EPXA 2EM2A 2LV2A 2LCEA 2BB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHT B;  4R2Q A;  4R2C A;  2EN6 A;  2R1F A;  2LVH A;  2EM0 A;  2EOX A;  1X5W A;  2EMY A;  2EQ1 A;  1F2I G;  3MHS C;  4R2S A;  2HGH A;  4F6M A;  2JP9 A;  2EPA A;  4R2D A;  3MHH C;  2GLI A;  4R2R A;  2EM3 A;  1A1G A;  2EP3 A;  2EN4 A;  2I13 A;  1RMD A;  2YTD A;  2EOJ A;  1LLM C;  1BB8 A;  2DGC A;  2YTF A;  2EM4 A;  2GHF A;  2CTD A;  2EL6 A;  2EMZ A;  2ELZ A;  2WBU A;  2EQ0 A;  1YUI A;  3EPL A;  2EMX A;  4WSG A;  1G2D C;  2EPC A;  1MEY C;  2YTP A;  1ZR9 A;  2EN8 A;  4F2J C;  1TF6 A;  2J7J A;  2YTO A;  1A1J A;  2ENA A;  4IS1 C;  2LT7 A;  1X6H A;  2EE8 A;  1A1K A;  2EMA A;  2YRH A;  2EMF A;  2EPZ A;  3EPK A;  5KL6 A;  2YU8 A;  2EMI A;  1B69 A;  2EOF A;  2DLK A;  2JPA A;  2EM6 A;  2A25 A;  2EOE A;  2EN7 A;  2RPC A;  1A1L A;  2EN2 A;  1A1I A;  2YSP A;  2ELY A;  1ZU1 A;  2YSO A;  2YTE A;  2YTN A;  2YTG A;  2WBS A;  1Z1B A;  4F6N A;  2DMI A;  2EOR A;  2EML A;  2EPP A;  4X9J A;  1G2F C;  3UK3 C;  5KL4 A;  2DLQ A;  2MDG A;  1BBO A;  2EMB A;  4R2P A;  2EOQ A;  2RSI A;  1X6F A;  2WBT A;  2EM8 A;  1A1F A;  2EM5 A;  2EMK A;  1NCS A;  1X3C A;  2E72 A;  5KL5 A;  1YSA C;  5KL7 A;  1A1H A;  2EN3 A;  2LO3 A;  1P47 A;  2YU5 A;  1JK1 A;  2CT1 A;  2YRM A;  2EOI A;  2EPR A;  1KJK A;  3EPH A;  2VRD A;  2YTQ A;  2EM9 A;  1AAY A;  2EL4 A;  2EMC A;  5KL2 A;  1UN6 B;  3EPJ A;  4R2A A;  1TN9 A;  2M9A A;  2NAB A;  2EN1 A;  2MKD A;  4GZN C;  1DGC A;  2YTJ A;  1WJP A;  4M9V C;  2ENH A;  2EJ4 A;  1YUJ A;  4IJD A;  2EMW A;  2EMG A;  2ADR A;  2EOS A;  4FK5 C;  2EPU A;  2EL5 A;  2CSH A;  2D9H A;  2ENC A;  2EMH A;  1TF3 A;  2EOZ A;  3M99 B;  2EM7 A;  2PRT A;  2EOH A;  2YRK A;  5KL3 A;  1UBD C;  1JK2 A;  2WCC 3;  2EQ3 A;  1ZAA C;  2DRP A;  2MKN A;  1X6E A;  2EOM A;  4R2E A;  2EOY A;  2YTI A;  2EOO A;  2EPX A;  2EM2 A;  2LV2 A;  2LCE A;  2BB8 A; 
#chains in the Genus database with same CATH topology
 3HPS A;  2NA2 A;  3BBG A;  1FJG E;  1X5W A;  2EMY A;  3MHS C;  4BBY A;  2HGH A;  2EPN A;  2JP9 A;  2CPN A;  3AV0 A;  4JI4 E;  2LUP B;  3IWC A;  3J7A G;  2EM3 A;  2I13 A;  1PJT A;  1BB8 A;  3IWD A;  4DV1 E;  1HNZ E;  2EMZ A;  1PJQ A;  2WBU A;  4L5N C;  2JY9 A;  2EQ0 A;  3K6Q A;  1ZR9 A;  3KZZ A;  4YHH E;  1IQS A;  4IS1 C;  4DV0 E;  2LT7 A;  3T1Y E;  2LE2 A;  4F54 A;  3HTX A;  3EPK A;  4DR3 E;  2GPI A;  2L2K B;  1ZBQ A;  4J8Z A;  5AC5 A;  1EH8 A;  4K0K E;  2EOE A;  2UXC E;  3IWB A;  1EKZ A;  4O5G A;  2YSP A;  2YSO A;  2YTE A;  1G2F C;  2WBS A;  2EOR A;  4X9J A;  2B7V A;  4N4R B;  1DI2 A;  1BBO A;  2YPN A;  2EMB A;  4WX9 A;  3F6G A;  2YT4 A;  3F6H A;  2L92 A;  4LU9 A;  2DIX A;  2FGG A;  4LF5 E;  1XMQ E;  1GTK A;  4DR5 E;  2EN3 A;  2HJJ A;  4DV4 E;  2LTR A;  2UU9 E;  2EPR A;  4GEQ B;  3L00 A;  4BHB A;  2L6M A;  2EMC A;  5KL2 A;  4DUZ E;  3DF6 A;  3EPJ A;  1WHN A;  2YWQ A;  2F8B A;  2M9A A;  1NEI A;  5IXM B;  4GZN C;  1XNR E;  1DGC A;  4TUI A;  5F3W A;  1KYQ A;  2HC5 A;  5A6K A;  3C4T A;  2EOS A;  2V85 A;  3EQ1 A;  4O4K A;  1DQ3 A;  3H09 A;  4ZYD A;  2EOZ A;  2PRT A;  1JK2 A;  4MLV A;  3LLH A;  4WXC A;  4JI8 E;  1PKP A;  2MKN A;  3ADJ A;  2JOX A;  2LTS A;  4KWY A;  4YY3 E;  2WZO A;  4LF4 E;  2L2M A;  3JAM C;  2LJH A;  3VHT B;  4WFT A;  4R2Q A;  2V83 A;  4DR7 E;  5AC4 A;  2R1F A;  3OML A;  1F2I G;  2V88 A;  4ZYH A;  2V89 A;  2JYA A;  2HHH E;  4R8O A;  2B7T A;  4LF7 E;  2Q8U A;  3MHH C;  2GLI A;  1STU A;  5AE2 A;  2ODR D;  1XMO E;  1AH5 A;  2EM4 A;  2EWL A;  2EL6 A;  2CTD A;  2GHF A;  2L3C A;  2L3J A;  4R03 A;  2LBS B;  5AE3 A;  4JI2 E;  2EN8 A;  4F2J C;  1TF6 A;  2J7J A;  4JI7 E;  1YZ9 A;  5LMU E;  5LMN E;  2YZT A;  1EH7 A;  2EE8 A;  4WPY A;  2EMA A;  4M30 A;  2ZM6 E;  2YU8 A;  4AQY E;  2EMI A;  2EOF A;  1T39 A;  2JPA A;  2UUB E;  2V8Q B;  5LLQ A;  2A25 A;  2RPC A;  1IBL E;  4X64 E;  3THN A;  1A1I A;  4WSP A;  3BID A;  2YTG A;  1IBK E;  5IV8 B;  1Z1B A;  3C6M A;  2EPP A;  2EML A;  4JI5 E;  3UK3 C;  5KL4 A;  3BF2 A;  4F9A B;  3ECR A;  2EM8 A;  2EM5 A;  4OX9 E;  1X3C A;  2LJU A;  4JYA E;  5LL6 R;  2H36 X;  2JWO A;  4BHC A;  4ZYG A;  1YYW A;  2LO3 A;  1P47 A;  2YU5 A;  4JI3 E;  5A6B A;  2YRM A;  2EOI A;  3EPH A;  2VRD A;  2EM9 A;  1WHQ A;  2KOU A;  1TN9 A;  4LF8 E;  1GQE A;  3BGH A;  4B3M E;  4NXN E;  4BC7 A;  2EN1 A;  1FKA E;  1WJP A;  1GZ6 A;  2DMY A;  2EMW A;  3T1H E;  4JV5 E;  3QG5 C;  1YYK A;  5A69 A;  1PDA A;  2B9D A;  1I94 E;  4DV6 E;  4DV3 E;  4OOG C;  4LFB E;  2D9H A;  1IBM E;  1TF3 A;  4BC9 A;  1N32 E;  2RTX A;  1X47 A;  2RS6 A;  3J7Y p;  2DRP A;  1ZAA C;  2UUA E;  2EOM A;  5IWA E;  5T6J A;  1YPN A;  3ADL A;  2EM2 A;  5ADZ A;  2VF1 A;  2VQF E;  2LVH A;  2EM0 A;  2EOX A;  2EQ1 A;  2KHX A;  4TUG A;  4LFC E;  4DV2 E;  2IHR 1;  4NZV A;  5FLX C;  5TSE A;  2N3H A;  4RH8 A;  2NUE A;  4R2R A;  1RC7 A;  1A1G A;  2MDR A;  2N3G A;  1J26 A;  5AAS A;  1SFE A;  4KHP E;  2YTD A;  1XNQ E;  2DGC A;  1BBG A;  2I9I A;  4BMJ A;  2LRS A;  3EPL A;  2EMX A;  4LFA E;  2EPC A;  2YTP A;  3JTZ A;  2MC5 A;  3ADG A;  2YTO A;  1HNW E;  4GKK E;  2JXP A;  2YRH A;  1IMU A;  2JOB A;  1B69 A;  2K7I A;  3VYY A;  1YYO A;  1T38 A;  4HEI A;  3DJW A;  4NXM E;  2MC6 A;  2L33 A;  2ELY A;  1ZU1 A;  4F6N A;  2DMI A;  4DR1 E;  2EPM X;  2L2N A;  1WRJ A;  4JI0 E;  2DLQ A;  3THO B;  4DR2 E;  4R2P A;  2G7H A;  1QNT A;  3RMP A;  2RSI A;  2WBT A;  1A1F A;  4M0V A;  4ZYE A;  2M4I A;  4DUY E;  3KWR A;  1SR9 A;  2E72 A;  4KZS A;  5KL5 A;  1YSA C;  4P7D A;  4DR6 E;  2E5L E;  5BR8 E;  2FV4 B;  2RQL A;  4JI1 E;  4DV7 E;  1KJK A;  4DV5 E;  3VYX A;  5A6B D;  2EL4 A;  4DR4 E;  1O0W A;  2BBG A;  3VK6 A;  2NAB A;  2YTJ A;  4M9V C;  2EJ4 A;  4IJD A;  5A6A A;  3C4B A;  2ADR A;  3MSW A;  4FK5 C;  2UXB E;  2EMH A;  5DNY A;  4GKJ E;  1QU6 A;  3P1X A;  3TQM A;  2EOH A;  2YRK A;  3FIG A;  2WCC 3;  1RQ0 A;  2B3T B;  3HPZ A;  4R2E A;  2YTI A;  2EPX A;  2LV2 A;  4X65 E;  2LCE A;  2JVA A;  4R2C A;  2EN6 A;  3ZOQ B;  3J80 C;  4B3R E;  3LML A;  4B3T E;  2LMZ A;  4R2S A;  2M7Q A;  4F6M A;  2EPA A;  2EZ6 A;  2EPL X;  2K4V A;  1UIL A;  4R2D A;  1T4O A;  4MLQ A;  4M2Z A;  2EP3 A;  2DSY A;  1HR0 E;  2EN4 A;  4X62 E;  1RMD A;  5IT9 C;  4LF6 E;  4O43 A;  1N33 E;  2EOJ A;  3HXL A;  2JR1 A;  1LLM C;  2YTF A;  4WYQ B;  4WXD A;  2ELZ A;  2UUC E;  1N36 E;  1YUI A;  4RHB B;  4WSG A;  1G2D C;  1MEY C;  3C6K A;  4DKK A;  1A1J A;  2ENA A;  1N34 E;  1X6H A;  1A1K A;  2V86 A;  4B3S E;  2EMF A;  2EPZ A;  1WXR A;  5KL6 A;  2DLK A;  4X66 E;  2DB2 A;  2EM6 A;  4X8W A;  2EN7 A;  2F4V E;  2RS7 A;  2VQE E;  4BCA A;  1A1L A;  2EN2 A;  1X48 A;  1T4N A;  2YTN A;  4I8O A;  3J81 C;  1EH6 A;  3AUZ A;  1N3G A;  5A2Q C;  2FTX B;  1PJS A;  4O24 A;  2MDG A;  2LUQ A;  2NUG A;  2EOQ A;  1X6F A;  2KON A;  5CFF E;  2EMK A;  1NCS A;  4DMI A;  5A6J A;  5KL7 A;  1A1H A;  1IQO A;  4Q35 B;  2NUF A;  1JK1 A;  2CT1 A;  2R76 A;  4L8N A;  2E1M A;  4NHR A;  1ZBT A;  2L8T A;  1T4L B;  2YTQ A;  1AAY A;  1UHZ A;  1UN6 B;  2EPO A;  4R2A A;  4LF9 E;  4LTY A;  3JU0 A;  2MKD A;  2RSM A;  2ENH A;  1YUJ A;  3OTO E;  2EMG A;  4Q28 A;  5AE1 A;  1J5E E;  4F9B B;  2UXD E;  3HQ1 A;  2EPU A;  2V87 A;  2EL5 A;  2CSH A;  3KZY A;  4HTG A;  2ENC A;  4JI6 E;  2N8X A;  2ODR C;  3M99 B;  2EM7 A;  4P78 A;  3ADI A;  2VE7 C;  5KL3 A;  1UBD C;  2M1S A;  1HNX E;  1L4S A;  1YFH A;  2EQ3 A;  4F9C B;  2EPK X;  1X6E A;  2EOY A;  1MGT A;  1X49 A;  2EOO A;  4BS9 A;  2BB8 A; 
#chains in the Genus database with same CATH homology
 3VHT B;  4R2Q A;  4R2C A;  2EN6 A;  2R1F A;  2LVH A;  2EM0 A;  2EOX A;  1X5W A;  2EMY A;  2EQ1 A;  1F2I G;  3MHS C;  4R2S A;  2HGH A;  4F6M A;  2JP9 A;  2EPA A;  4R2D A;  3MHH C;  2GLI A;  4R2R A;  2EM3 A;  1A1G A;  2EP3 A;  2EN4 A;  2I13 A;  1RMD A;  2YTD A;  2EOJ A;  1LLM C;  1BB8 A;  2DGC A;  2YTF A;  2EM4 A;  2GHF A;  2CTD A;  2EL6 A;  2EMZ A;  2ELZ A;  2WBU A;  2EQ0 A;  1YUI A;  3EPL A;  2EMX A;  4WSG A;  1G2D C;  2EPC A;  1MEY C;  2YTP A;  1ZR9 A;  2EN8 A;  4F2J C;  1TF6 A;  2J7J A;  2YTO A;  1A1J A;  2ENA A;  4IS1 C;  2LT7 A;  1X6H A;  2EE8 A;  1A1K A;  2EMA A;  2YRH A;  2EMF A;  2EPZ A;  3EPK A;  5KL6 A;  2YU8 A;  2EMI A;  1B69 A;  2EOF A;  2DLK A;  2JPA A;  2EM6 A;  2A25 A;  2EOE A;  2EN7 A;  2RPC A;  1A1L A;  2EN2 A;  1A1I A;  2YSP A;  2ELY A;  1ZU1 A;  2YSO A;  2YTE A;  2YTN A;  2YTG A;  2WBS A;  1Z1B A;  4F6N A;  2DMI A;  2EOR A;  2EML A;  2EPP A;  4X9J A;  1G2F C;  3UK3 C;  5KL4 A;  2DLQ A;  2MDG A;  1BBO A;  2EMB A;  4R2P A;  2EOQ A;  2RSI A;  1X6F A;  2WBT A;  2EM8 A;  1A1F A;  2EM5 A;  2EMK A;  1NCS A;  1X3C A;  2E72 A;  5KL5 A;  1YSA C;  5KL7 A;  1A1H A;  2EN3 A;  2LO3 A;  1P47 A;  2YU5 A;  1JK1 A;  2CT1 A;  2YRM A;  2EOI A;  2EPR A;  1KJK A;  3EPH A;  2VRD A;  2YTQ A;  2EM9 A;  1AAY A;  2EL4 A;  2EMC A;  5KL2 A;  1UN6 B;  3EPJ A;  4R2A A;  1TN9 A;  2M9A A;  2NAB A;  2EN1 A;  2MKD A;  4GZN C;  1DGC A;  2YTJ A;  1WJP A;  4M9V C;  2ENH A;  2EJ4 A;  1YUJ A;  4IJD A;  2EMW A;  2EMG A;  2ADR A;  2EOS A;  4FK5 C;  2EPU A;  2EL5 A;  2CSH A;  2D9H A;  2ENC A;  2EMH A;  1TF3 A;  2EOZ A;  3M99 B;  2EM7 A;  2PRT A;  2EOH A;  2YRK A;  5KL3 A;  1UBD C;  1JK2 A;  2WCC 3;  2EQ3 A;  1ZAA C;  2DRP A;  2MKN A;  1X6E A;  2EOM A;  4R2E A;  2EOY A;  2YTI A;  2EOO A;  2EPX A;  2EM2 A;  2LV2 A;  2LCE A;  2BB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...