1TF6A

Co-crystal structure of xenopus tfiiia zinc finger domain bound to the 5s ribosomal rna gene internal control region
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
YKRYICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIKICVYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differing roles for zinc fingers in DNA recognition: structure of a six-finger transcription factor IIIA complex.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*CP*GP*GP*GP*CP*CP*TP*GP*GP*TP*TP*AP*GP*TP*AP*C
total genus 36
structure length 179
sequence length 179
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A05
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A06
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf6A02
1UN6B 2EOJA 2CTDA 2MDGA 2ELYA 2RPCA 2WCC3 2EN3A 2EM0A 2YTPA 2EP3A 2EMFA 1YUIA 2ENHA 2GHFA 2EQ3A 2A25A 2EL5A 1X6EA 2EL4A 2EOHA 1X6FA 2JP9A 2EN1A 5KL7A 4R2EA 1A1JA 2EQ0A 2EPZA 2EPCA 2YTQA 4R2QA 3MHSC 2EM3A 2M9AA 4F6NA 2NABA 1P47A 2DLQA 1JK1A 2EMAA 1UBDC 2DGCA 2EOXA 2WBTA 4R2SA 2YTEA 1LLMC 5KL4A 1X6HA 2CT1A 2EOQA 2WBSA 4R2PA 1TN9A 2LVHA 2YTNA 2YU8A 2E72A 2EMBA 1X3CA 2EM4A 1TF6A 1X5WA 2LO3A 2HGHA 2DMIA 3UK3C 2EN2A 2YTFA 5KL3A 2EOFA 3EPKA 1RMDA 2EL6A 2EMWA 2EN8A 1A1FA 1YSAC 2DRPA 5KL6A 2LT7A 2EPAA 3EPHA 4IJDA 5KL5A 2MKNA 2EOYA 2EMIA 2JPAA 2EJ4A 4X9JA 1YUJA 2EOEA 1A1IA 2EOIA 2EPUA 4GZNC 3VHTB 1WJPA 2YU5A 4R2CA 1ZR9A 2EN7A 4IS1C 1A1KA 1B69A 5KL2A 2EN6A 1ZU1A 2VRDA 2EPRA 2EM2A 4R2AA 2EMCA 2EM6A 1A1GA 1F2IG 2EPPA 2YSOA 1G2DC 1TF3A 2YTJA 2YRMA 4F6MA 2ENAA 4R2RA 2LCEA 2CSHA 2WBUA 2EM9A 2EOZA 2YTDA 2EN4A 2R1FA 2EMGA 2EOSA 3EPLA 2EOOA 2EM8A 2GLIA 1G2FC 1NCSA 2EM5A 1MEYC 2EMLA 2EPXA 2EM7A 2LV2A 3M99B 3MHHC 2EMXA 1ZAAC 2MKDA 2EE8A 2YTGA 1AAYA 4R2DA 2EORA 2EMKA 2YTOA 2J7JA 2EQ1A 1Z1BA 2YRKA 2ELZA 1BB8A 1JK2A 2EMYA 2EOMA 1DGCA 2YRHA 2EMHA 2EMZA 4M9VC 2D9HA 2ENCA 2DLKA 2YSPA 4F2JC 1BBOA 4FK5C 1A1HA 3EPJA 2ADRA 2I13A 1KJKA 2YTIA 2BB8A 2PRTA 4WSGA 2RSIA 1A1LA
chains in the Genus database with same CATH superfamily
4NXNE 4WSPA 3T1HE 2MDGA 2ELYA 3HPZA 1I94E 4P7DA 2EN3A 2YTPA 4LF8E 2EMFA 1XMOE 2LJUA 3C6MA 2NUEA 2E5LE 4MLQA 1GQEA 4JI1E 2UUAE 4OX9E 3C6KA 2EQ0A 4JI2E 1EH8A 3HXLA 2EPCA 4F9AB 1WHQA 3MHSC 4R2QA 2EPMX 2NABA 1P47A 1JK1A 2EMAA 5A69A 3T1YE 2YTEA 4DR3E 2G7HA 1XNQE 2UUBE 1X47A 2YTNA 2M7QA 2EMBA 2KHXA 5AASA 1HNXE 2RS7A 1TF6A 3DJWA 3KZZA 1DQ3A 4ZYDA 5ADZA 2YTFA 1YSAC 2DB2A 1A1FA 2FTXB 5KL6A 1WRJA 2IHR1 2L3CA 5KL5A 2MKNA 3IWDA 4X8WA 2JPAA 2L2KB 2LRSA 2F8BA 4KHPE 3P1XA 3JU0A 1IQSA 4GZNC 4DR7E 5FLXC 3VYYA 4JI5E 4JYAE 2EN7A 4IS1C 2LJHA 4LU9A 1ZU1A 2R76A 4O5GA 4DKKA 2EMCA 2VQFE 1A1GA 2RSMA 3J81C 1YYWA 1G2DC 2YWQA 4DMIA 1TF3A 4F6MA 2L33A 5T6JA 1T39A 2YTDA 2EN4A 2EMGA 1XNRE 3BIDA 3F6HA 5LMNE 1EKZA 3BBGA 1N34E 1NCSA 2EM5A 2L2NA 4TUIA 3M99B 4M30A 3ADGA 1AAYA 4K0KE 1MGTA 1PDAA 2B9DA 2YPNA 1X49A 1X48A 1EH6A 2J7JA 3BGHA 1DI2A 2LMZA 3HTXA 2YRKA 2ELZA 4B3TE 4DV0E 2E1MA 4RH8A 2JOXA 2YRHA 5DNYA 3VYXA 2MC6A 2ENCA 3EPJA 4DR2E 2BB8A 4ZYHA 4WSGA 2EOJA 2EPLX 4I8OA 2V88A 2WCC3 2EM0A 2CPNA 2ENHA 1UILA 4DV5E 3KWRA 1YPNA 2A25A 4DR1E 2YT4A 1X6EA 2EL4A 2EOHA 1X6FA 2FGGA 2JP9A 2EN1A 1IBLE 2EM3A 3J7Yp 1J5EE 4F6NA 3THNA 4ZYGA 2DLQA 2JYAA 2JVAA 2DGCA 1GZ6A 4R2SA 2LUQA 1X6HA 4JI3E 3ZOQB 1RQ0A 2WBSA 1WXRA 1TN9A 2LVHA 5AE3A 2E72A 2EM4A 2LO3A 2KONA 2I9IA 2LTRA 2HGHA 3UK3C 2BBGA 3EPKA 2DRPA 4JI4E 2V85A 5IXMB 3OTOE 2V83A 3EPHA 5BR8E 4N4RB 1T38A 4BC7A 4WX9A 2EJ4A 1SR9A 1O0WA 4B3SE 1A1IA 2EOIA 3ADLA 4GKKE 4R8OA 1A1KA 1PKPA 2JY9A 2EN6A 2EM2A 4WPYA 2VQEE 4R2AA 1KJKA 1UHZA 4JV5E 2EPPA 2YSOA 1HNZE 1N36E 2V87A 2V86A 4WFTA 1STUA 5AC5A 1WHNA 2JWOA 3THOB 2DMYA 2WBUA 2EOZA 2EOSA 2K7IA 4DUZE 2M1SA 2EPNA 1HR0E 2EMLA 2EPXA 4O4KA 1ZAAC 3IWCA 3MSWA 4R2DA 2EMKA 2EWLA 4O24A 2EQ1A 2RS6A 4BHCA 2EPOA 3J7AG 4AQYE 1ZBQA 4DR5E 1DGCA 4Q35B 3RMPA 2NA2A 2DIXA 2EMZA 5A6KA 3AV0A 2EPKX 5LMUE 2MDRA 1SFEA 2FV4B 4YY3E 2RSIA 1UN6B 1N3GA 4B3ME 4L8NA 5LL6R 1BBGA 2RPCA 4KZSA 4NZVA 1YYKA 2UU9E 2ODRD 2V8QB 2EP3A 4YHHE 4LFCE 1YUIA 2B7TA 3HQ1A 1AH5A 2EQ3A 1PJSA 4GKJE 2EL5A 4O43A 3ADIA 2LTSA 4X66E 5KL7A 4OOGC 4R2EA 1A1JA 4LF5E 2EPZA 2YTQA 4TUGA 2LE2A 2M9AA 4P78A 2L2MA 4BS9A 2H36X 5LLQA 5IWAE 2EOXA 1LLMC 5KL4A 2UXCE 2DSYA 1T4NA 4R2PA 4MLVA 4DV6E 1X3CA 1X5WA 4M2ZA 1YYOA 3OMLA 4L5NC 2DMIA 4BMJA 1RC7A 2EN2A 3LLHA 2EMWA 2JXPA 2MC5A 2LBSB 1GTKA 2N8XA 2LT7A 4IJDA 4DV3E 2EMIA 2HC5A 5AE1A 1IQOA 5A6AA 3VHTB 5IV8B 1WJPA 2YU5A 4RHBB 4DR4E 1B69A 5AE2A 3KZYA 2EM6A 1F2IG 5F3WA 4LFAE 4DR6E 2WZOA 2YRMA 1QU6A 3EQ1A 3F6GA 1IBME 4R2RA 2CSHA 5TSEA 1PJQA 4NXME 3JTZA 4Q28A 2HJJA 3EPLA 3JAMC 1EH7A 2EOOA 2EM8A 2VE7C 4LF6E 4LFBE 1XMQE 3DF6A 4F9CB 4LF4E 2EM7A 2KOUA 2EMXA 2MKDA 1HNWE 3K6QA 2UXDE 1NEIA 2YTGA 1T4OA 4NHRA 3IWBA 2EORA 2RQLA 2RTXA 4F54A 2YTOA 1N33E 1Z1BA 1FJGE 1JK2A 1KYQA 5A6BD 3ADJA 1L4SA 2B7VA 2JR1A 3ECRA 5CFFE 2B3TB 2D9HA 2M4IA 2GPIA 2YSPA 2UUCE 1BBOA 4FK5C 2LUPB 1A1LA 1IMUA 2CTDA 4DV2E 4JI0E 3LMLA 4LF7E 2VF1A 4R03A 4X65E 1T4LB 5A6JA 1J26A 3FIGA 2ODRC 2GHFA 2Q8UA 5IT9C 2V89A 4M0VA 2N3HA 4DUYE 1UBDC 2ZM6E 4HEIA 2WBTA 4B3RE 2CT1A 1PJTA 2EOQA 2YZTA 2YU8A 4HTGA 4LTYA 2EZ6A 2N3GA 5KL3A 3C4BA 2EOFA 1RMDA 2EL6A 3AUZA 2EN8A 4LF9E 2EPAA 3C4TA 4J8ZA 2L6MA 2EOYA 3HPSA 2JOBA 2L8TA 4X9JA 1YUJA 2EOEA 1N32E 2EPUA 4BBYA 4WXCA 4DV4E 4R2CA 1ZR9A 1FKAE 2L92A 4JI8E 3TQMA 1YZ9A 2K4VA 5KL2A 2UXBE 3J80C 2VRDA 2EPRA 3VK6A 4DV1E 1YFHA 1IBKE 5AC4A 2NUGA 4WYQB 4GEQB 2F4VE 2YTJA 4KWYA 4F9BB 4DV7E 2NUFA 2ENAA 2LCEA 4ZYEA 2EM9A 4X64E 2R1FA 2GLIA 1G2FC 4JI6E 1MEYC 5A2QC 2LV2A 3MHHC 1ZBTA 2EE8A 3H09A 4JI7E 4X62E 3QG5C 1QNTA 1BB8A 2EMYA 2EOMA 4BCAA 2EMHA 2HHHE 4BC9A 4M9VC 2DLKA 2L3JA 4F2JC 4BHBA 5A6BA 1A1HA 3BF2A 2ADRA 2I13A 4WXDA 2YTIA 2PRTA 3L00A
chains in the Genus database with same CATH topology
1UN6B 2EOJA 2CTDA 2MDGA 2ELYA 2RPCA 2WCC3 2EN3A 2EM0A 2YTPA 2EP3A 2EMFA 1YUIA 2ENHA 2GHFA 2EQ3A 2A25A 2EL5A 1X6EA 2EL4A 2EOHA 1X6FA 2JP9A 2EN1A 5KL7A 4R2EA 1A1JA 2EQ0A 2EPZA 2EPCA 2YTQA 4R2QA 3MHSC 2EM3A 2M9AA 4F6NA 2NABA 1P47A 2DLQA 1JK1A 2EMAA 1UBDC 2DGCA 2EOXA 2WBTA 4R2SA 2YTEA 1LLMC 5KL4A 1X6HA 2CT1A 2EOQA 2WBSA 4R2PA 1TN9A 2LVHA 2YTNA 2YU8A 2E72A 2EMBA 1X3CA 2EM4A 1TF6A 1X5WA 2LO3A 2HGHA 2DMIA 3UK3C 2EN2A 2YTFA 5KL3A 2EOFA 3EPKA 1RMDA 2EL6A 2EMWA 2EN8A 1A1FA 1YSAC 2DRPA 5KL6A 2LT7A 2EPAA 3EPHA 4IJDA 5KL5A 2MKNA 2EOYA 2EMIA 2JPAA 2EJ4A 4X9JA 1YUJA 2EOEA 1A1IA 2EOIA 2EPUA 4GZNC 3VHTB 1WJPA 2YU5A 4R2CA 1ZR9A 2EN7A 4IS1C 1A1KA 1B69A 5KL2A 2EN6A 1ZU1A 2VRDA 2EPRA 2EM2A 4R2AA 2EMCA 2EM6A 1A1GA 1F2IG 2EPPA 2YSOA 1G2DC 1TF3A 2YTJA 2YRMA 4F6MA 2ENAA 4R2RA 2LCEA 2CSHA 2WBUA 2EM9A 2EOZA 2YTDA 2EN4A 2R1FA 2EMGA 2EOSA 3EPLA 2EOOA 2EM8A 2GLIA 1G2FC 1NCSA 2EM5A 1MEYC 2EMLA 2EPXA 2EM7A 2LV2A 3M99B 3MHHC 2EMXA 1ZAAC 2MKDA 2EE8A 2YTGA 1AAYA 4R2DA 2EORA 2EMKA 2YTOA 2J7JA 2EQ1A 1Z1BA 2YRKA 2ELZA 1BB8A 1JK2A 2EMYA 2EOMA 1DGCA 2YRHA 2EMHA 2EMZA 4M9VC 2D9HA 2ENCA 2DLKA 2YSPA 4F2JC 1BBOA 4FK5C 1A1HA 3EPJA 2ADRA 2I13A 1KJKA 2YTIA 2BB8A 2PRTA 4WSGA 2RSIA 1A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN6 B;  2EOJ A;  2CTD A;  2MDG A;  2ELY A;  2RPC A;  2WCC 3;  2EN3 A;  2EM0 A;  2YTP A;  2EP3 A;  2EMF A;  1YUI A;  2ENH A;  2GHF A;  2EQ3 A;  2A25 A;  2EL5 A;  1X6E A;  2EL4 A;  2EOH A;  1X6F A;  2JP9 A;  2EN1 A;  5KL7 A;  4R2E A;  1A1J A;  2EQ0 A;  2EPZ A;  2EPC A;  2YTQ A;  4R2Q A;  3MHS C;  2EM3 A;  2M9A A;  4F6N A;  2NAB A;  1P47 A;  2DLQ A;  1JK1 A;  2EMA A;  1UBD C;  2DGC A;  2EOX A;  2WBT A;  4R2S A;  2YTE A;  1LLM C;  5KL4 A;  1X6H A;  2CT1 A;  2EOQ A;  2WBS A;  4R2P A;  1TN9 A;  2LVH A;  2YTN A;  2YU8 A;  2E72 A;  2EMB A;  1X3C A;  2EM4 A;  1TF6 A;  1X5W A;  2LO3 A;  2HGH A;  2DMI A;  3UK3 C;  2EN2 A;  2YTF A;  5KL3 A;  2EOF A;  3EPK A;  1RMD A;  2EL6 A;  2EMW A;  2EN8 A;  1A1F A;  1YSA C;  2DRP A;  5KL6 A;  2LT7 A;  2EPA A;  3EPH A;  4IJD A;  5KL5 A;  2MKN A;  2EOY A;  2EMI A;  2JPA A;  2EJ4 A;  4X9J A;  1YUJ A;  2EOE A;  1A1I A;  2EOI A;  2EPU A;  4GZN C;  3VHT B;  1WJP A;  2YU5 A;  4R2C A;  1ZR9 A;  2EN7 A;  4IS1 C;  1A1K A;  1B69 A;  5KL2 A;  2EN6 A;  1ZU1 A;  2VRD A;  2EPR A;  2EM2 A;  4R2A A;  2EMC A;  2EM6 A;  1A1G A;  1F2I G;  2EPP A;  2YSO A;  1G2D C;  1TF3 A;  2YTJ A;  2YRM A;  4F6M A;  2ENA A;  4R2R A;  2LCE A;  2CSH A;  2WBU A;  2EM9 A;  2EOZ A;  2YTD A;  2EN4 A;  2R1F A;  2EMG A;  2EOS A;  3EPL A;  2EOO A;  2EM8 A;  2GLI A;  1G2F C;  1NCS A;  2EM5 A;  1MEY C;  2EML A;  2EPX A;  2EM7 A;  2LV2 A;  3M99 B;  3MHH C;  2EMX A;  1ZAA C;  2MKD A;  2EE8 A;  2YTG A;  1AAY A;  4R2D A;  2EOR A;  2EMK A;  2YTO A;  2J7J A;  2EQ1 A;  1Z1B A;  2YRK A;  2ELZ A;  1BB8 A;  1JK2 A;  2EMY A;  2EOM A;  1DGC A;  2YRH A;  2EMH A;  2EMZ A;  4M9V C;  2D9H A;  2ENC A;  2DLK A;  2YSP A;  4F2J C;  1BBO A;  4FK5 C;  1A1H A;  3EPJ A;  2ADR A;  2I13 A;  1KJK A;  2YTI A;  2BB8 A;  2PRT A;  4WSG A;  2RSI A;  1A1L A; 
#chains in the Genus database with same CATH topology
 4NXN E;  4WSP A;  3T1H E;  2MDG A;  2ELY A;  3HPZ A;  1I94 E;  4P7D A;  2EN3 A;  2YTP A;  4LF8 E;  2EMF A;  1XMO E;  2LJU A;  3C6M A;  2NUE A;  2E5L E;  4MLQ A;  1GQE A;  4JI1 E;  2UUA E;  4OX9 E;  3C6K A;  2EQ0 A;  4JI2 E;  1EH8 A;  3HXL A;  2EPC A;  4F9A B;  1WHQ A;  3MHS C;  4R2Q A;  2EPM X;  2NAB A;  1P47 A;  1JK1 A;  2EMA A;  5A69 A;  3T1Y E;  2YTE A;  4DR3 E;  2G7H A;  1XNQ E;  2UUB E;  1X47 A;  2YTN A;  2M7Q A;  2EMB A;  2KHX A;  5AAS A;  1HNX E;  2RS7 A;  1TF6 A;  3DJW A;  3KZZ A;  1DQ3 A;  4ZYD A;  5ADZ A;  2YTF A;  1YSA C;  2DB2 A;  1A1F A;  2FTX B;  5KL6 A;  1WRJ A;  2IHR 1;  2L3C A;  5KL5 A;  2MKN A;  3IWD A;  4X8W A;  2JPA A;  2L2K B;  2LRS A;  2F8B A;  4KHP E;  3P1X A;  3JU0 A;  1IQS A;  4GZN C;  4DR7 E;  5FLX C;  3VYY A;  4JI5 E;  4JYA E;  2EN7 A;  4IS1 C;  2LJH A;  4LU9 A;  1ZU1 A;  2R76 A;  4O5G A;  4DKK A;  2EMC A;  2VQF E;  1A1G A;  2RSM A;  3J81 C;  1YYW A;  1G2D C;  2YWQ A;  4DMI A;  1TF3 A;  4F6M A;  2L33 A;  5T6J A;  1T39 A;  2YTD A;  2EN4 A;  2EMG A;  1XNR E;  3BID A;  3F6H A;  5LMN E;  1EKZ A;  3BBG A;  1N34 E;  1NCS A;  2EM5 A;  2L2N A;  4TUI A;  3M99 B;  4M30 A;  3ADG A;  1AAY A;  4K0K E;  1MGT A;  1PDA A;  2B9D A;  2YPN A;  1X49 A;  1X48 A;  1EH6 A;  2J7J A;  3BGH A;  1DI2 A;  2LMZ A;  3HTX A;  2YRK A;  2ELZ A;  4B3T E;  4DV0 E;  2E1M A;  4RH8 A;  2JOX A;  2YRH A;  5DNY A;  3VYX A;  2MC6 A;  2ENC A;  3EPJ A;  4DR2 E;  2BB8 A;  4ZYH A;  4WSG A;  2EOJ A;  2EPL X;  4I8O A;  2V88 A;  2WCC 3;  2EM0 A;  2CPN A;  2ENH A;  1UIL A;  4DV5 E;  3KWR A;  1YPN A;  2A25 A;  4DR1 E;  2YT4 A;  1X6E A;  2EL4 A;  2EOH A;  1X6F A;  2FGG A;  2JP9 A;  2EN1 A;  1IBL E;  2EM3 A;  3J7Y p;  1J5E E;  4F6N A;  3THN A;  4ZYG A;  2DLQ A;  2JYA A;  2JVA A;  2DGC A;  1GZ6 A;  4R2S A;  2LUQ A;  1X6H A;  4JI3 E;  3ZOQ B;  1RQ0 A;  2WBS A;  1WXR A;  1TN9 A;  2LVH A;  5AE3 A;  2E72 A;  2EM4 A;  2LO3 A;  2KON A;  2I9I A;  2LTR A;  2HGH A;  3UK3 C;  2BBG A;  3EPK A;  2DRP A;  4JI4 E;  2V85 A;  5IXM B;  3OTO E;  2V83 A;  3EPH A;  5BR8 E;  4N4R B;  1T38 A;  4BC7 A;  4WX9 A;  2EJ4 A;  1SR9 A;  1O0W A;  4B3S E;  1A1I A;  2EOI A;  3ADL A;  4GKK E;  4R8O A;  1A1K A;  1PKP A;  2JY9 A;  2EN6 A;  2EM2 A;  4WPY A;  2VQE E;  4R2A A;  1KJK A;  1UHZ A;  4JV5 E;  2EPP A;  2YSO A;  1HNZ E;  1N36 E;  2V87 A;  2V86 A;  4WFT A;  1STU A;  5AC5 A;  1WHN A;  2JWO A;  3THO B;  2DMY A;  2WBU A;  2EOZ A;  2EOS A;  2K7I A;  4DUZ E;  2M1S A;  2EPN A;  1HR0 E;  2EML A;  2EPX A;  4O4K A;  1ZAA C;  3IWC A;  3MSW A;  4R2D A;  2EMK A;  2EWL A;  4O24 A;  2EQ1 A;  2RS6 A;  4BHC A;  2EPO A;  3J7A G;  4AQY E;  1ZBQ A;  4DR5 E;  1DGC A;  4Q35 B;  3RMP A;  2NA2 A;  2DIX A;  2EMZ A;  5A6K A;  3AV0 A;  2EPK X;  5LMU E;  2MDR A;  1SFE A;  2FV4 B;  4YY3 E;  2RSI A;  1UN6 B;  1N3G A;  4B3M E;  4L8N A;  5LL6 R;  1BBG A;  2RPC A;  4KZS A;  4NZV A;  1YYK A;  2UU9 E;  2ODR D;  2V8Q B;  2EP3 A;  4YHH E;  4LFC E;  1YUI A;  2B7T A;  3HQ1 A;  1AH5 A;  2EQ3 A;  1PJS A;  4GKJ E;  2EL5 A;  4O43 A;  3ADI A;  2LTS A;  4X66 E;  5KL7 A;  4OOG C;  4R2E A;  1A1J A;  4LF5 E;  2EPZ A;  2YTQ A;  4TUG A;  2LE2 A;  2M9A A;  4P78 A;  2L2M A;  4BS9 A;  2H36 X;  5LLQ A;  5IWA E;  2EOX A;  1LLM C;  5KL4 A;  2UXC E;  2DSY A;  1T4N A;  4R2P A;  4MLV A;  4DV6 E;  1X3C A;  1X5W A;  4M2Z A;  1YYO A;  3OML A;  4L5N C;  2DMI A;  4BMJ A;  1RC7 A;  2EN2 A;  3LLH A;  2EMW A;  2JXP A;  2MC5 A;  2LBS B;  1GTK A;  2N8X A;  2LT7 A;  4IJD A;  4DV3 E;  2EMI A;  2HC5 A;  5AE1 A;  1IQO A;  5A6A A;  3VHT B;  5IV8 B;  1WJP A;  2YU5 A;  4RHB B;  4DR4 E;  1B69 A;  5AE2 A;  3KZY A;  2EM6 A;  1F2I G;  5F3W A;  4LFA E;  4DR6 E;  2WZO A;  2YRM A;  1QU6 A;  3EQ1 A;  3F6G A;  1IBM E;  4R2R A;  2CSH A;  5TSE A;  1PJQ A;  4NXM E;  3JTZ A;  4Q28 A;  2HJJ A;  3EPL A;  3JAM C;  1EH7 A;  2EOO A;  2EM8 A;  2VE7 C;  4LF6 E;  4LFB E;  1XMQ E;  3DF6 A;  4F9C B;  4LF4 E;  2EM7 A;  2KOU A;  2EMX A;  2MKD A;  1HNW E;  3K6Q A;  2UXD E;  1NEI A;  2YTG A;  1T4O A;  4NHR A;  3IWB A;  2EOR A;  2RQL A;  2RTX A;  4F54 A;  2YTO A;  1N33 E;  1Z1B A;  1FJG E;  1JK2 A;  1KYQ A;  5A6B D;  3ADJ A;  1L4S A;  2B7V A;  2JR1 A;  3ECR A;  5CFF E;  2B3T B;  2D9H A;  2M4I A;  2GPI A;  2YSP A;  2UUC E;  1BBO A;  4FK5 C;  2LUP B;  1A1L A;  1IMU A;  2CTD A;  4DV2 E;  4JI0 E;  3LML A;  4LF7 E;  2VF1 A;  4R03 A;  4X65 E;  1T4L B;  5A6J A;  1J26 A;  3FIG A;  2ODR C;  2GHF A;  2Q8U A;  5IT9 C;  2V89 A;  4M0V A;  2N3H A;  4DUY E;  1UBD C;  2ZM6 E;  4HEI A;  2WBT A;  4B3R E;  2CT1 A;  1PJT A;  2EOQ A;  2YZT A;  2YU8 A;  4HTG A;  4LTY A;  2EZ6 A;  2N3G A;  5KL3 A;  3C4B A;  2EOF A;  1RMD A;  2EL6 A;  3AUZ A;  2EN8 A;  4LF9 E;  2EPA A;  3C4T A;  4J8Z A;  2L6M A;  2EOY A;  3HPS A;  2JOB A;  2L8T A;  4X9J A;  1YUJ A;  2EOE A;  1N32 E;  2EPU A;  4BBY A;  4WXC A;  4DV4 E;  4R2C A;  1ZR9 A;  1FKA E;  2L92 A;  4JI8 E;  3TQM A;  1YZ9 A;  2K4V A;  5KL2 A;  2UXB E;  3J80 C;  2VRD A;  2EPR A;  3VK6 A;  4DV1 E;  1YFH A;  1IBK E;  5AC4 A;  2NUG A;  4WYQ B;  4GEQ B;  2F4V E;  2YTJ A;  4KWY A;  4F9B B;  4DV7 E;  2NUF A;  2ENA A;  2LCE A;  4ZYE A;  2EM9 A;  4X64 E;  2R1F A;  2GLI A;  1G2F C;  4JI6 E;  1MEY C;  5A2Q C;  2LV2 A;  3MHH C;  1ZBT A;  2EE8 A;  3H09 A;  4JI7 E;  4X62 E;  3QG5 C;  1QNT A;  1BB8 A;  2EMY A;  2EOM A;  4BCA A;  2EMH A;  2HHH E;  4BC9 A;  4M9V C;  2DLK A;  2L3J A;  4F2J C;  4BHB A;  5A6B A;  1A1H A;  3BF2 A;  2ADR A;  2I13 A;  4WXD A;  2YTI A;  2PRT A;  3L00 A; 
#chains in the Genus database with same CATH homology
 1UN6 B;  2EOJ A;  2CTD A;  2MDG A;  2ELY A;  2RPC A;  2WCC 3;  2EN3 A;  2EM0 A;  2YTP A;  2EP3 A;  2EMF A;  1YUI A;  2ENH A;  2GHF A;  2EQ3 A;  2A25 A;  2EL5 A;  1X6E A;  2EL4 A;  2EOH A;  1X6F A;  2JP9 A;  2EN1 A;  5KL7 A;  4R2E A;  1A1J A;  2EQ0 A;  2EPZ A;  2EPC A;  2YTQ A;  4R2Q A;  3MHS C;  2EM3 A;  2M9A A;  4F6N A;  2NAB A;  1P47 A;  2DLQ A;  1JK1 A;  2EMA A;  1UBD C;  2DGC A;  2EOX A;  2WBT A;  4R2S A;  2YTE A;  1LLM C;  5KL4 A;  1X6H A;  2CT1 A;  2EOQ A;  2WBS A;  4R2P A;  1TN9 A;  2LVH A;  2YTN A;  2YU8 A;  2E72 A;  2EMB A;  1X3C A;  2EM4 A;  1TF6 A;  1X5W A;  2LO3 A;  2HGH A;  2DMI A;  3UK3 C;  2EN2 A;  2YTF A;  5KL3 A;  2EOF A;  3EPK A;  1RMD A;  2EL6 A;  2EMW A;  2EN8 A;  1A1F A;  1YSA C;  2DRP A;  5KL6 A;  2LT7 A;  2EPA A;  3EPH A;  4IJD A;  5KL5 A;  2MKN A;  2EOY A;  2EMI A;  2JPA A;  2EJ4 A;  4X9J A;  1YUJ A;  2EOE A;  1A1I A;  2EOI A;  2EPU A;  4GZN C;  3VHT B;  1WJP A;  2YU5 A;  4R2C A;  1ZR9 A;  2EN7 A;  4IS1 C;  1A1K A;  1B69 A;  5KL2 A;  2EN6 A;  1ZU1 A;  2VRD A;  2EPR A;  2EM2 A;  4R2A A;  2EMC A;  2EM6 A;  1A1G A;  1F2I G;  2EPP A;  2YSO A;  1G2D C;  1TF3 A;  2YTJ A;  2YRM A;  4F6M A;  2ENA A;  4R2R A;  2LCE A;  2CSH A;  2WBU A;  2EM9 A;  2EOZ A;  2YTD A;  2EN4 A;  2R1F A;  2EMG A;  2EOS A;  3EPL A;  2EOO A;  2EM8 A;  2GLI A;  1G2F C;  1NCS A;  2EM5 A;  1MEY C;  2EML A;  2EPX A;  2EM7 A;  2LV2 A;  3M99 B;  3MHH C;  2EMX A;  1ZAA C;  2MKD A;  2EE8 A;  2YTG A;  1AAY A;  4R2D A;  2EOR A;  2EMK A;  2YTO A;  2J7J A;  2EQ1 A;  1Z1B A;  2YRK A;  2ELZ A;  1BB8 A;  1JK2 A;  2EMY A;  2EOM A;  1DGC A;  2YRH A;  2EMH A;  2EMZ A;  4M9V C;  2D9H A;  2ENC A;  2DLK A;  2YSP A;  4F2J C;  1BBO A;  4FK5 C;  1A1H A;  3EPJ A;  2ADR A;  2I13 A;  1KJK A;  2YTI A;  2BB8 A;  2PRT A;  4WSG A;  2RSI A;  1A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...