2ADRA

Adr1 dna-binding domain from saccharomyces cerevisiae, nmr, 25 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRAFTRRDLLIRHAQKIHSGNLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A folding transition and novel zinc finger accessory domain in the transcription factor ADR1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulation
molecule keywords ADR1
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1998-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2adrA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2adrA02
1UBDC 2CTDA 2DGCA 1WJPA 2EL5A 5KL6A 4R2CA 2EOXA 2YTPA 2JP9A 2EOHA 2YTJA 4IS1C 2YTFA 1TF6A 2I13A 2EPUA 2WBSA 1G2DC 2DMIA 4IJDA 5KL2A 1TF3A 2ELZA 4R2SA 2YSPA 1TN9A 2YRMA 1X6FA 1G2FC 2WBUA 2EMYA 2JPAA 2YRKA 2EMZA 2EPCA 2PRTA 1ZR9A 1A1JA 1JK1A 1AAYA 2MKNA 2BB8A 1X6EA 2EP3A 2YTNA 2EOIA 2J7JA 1A1KA 1NCSA 2EN4A 2EM9A 1JK2A 3VHTB 2EN8A 2EMGA 2VRDA 2CT1A 3EPKA 4F2JC 4R2AA 4F6MA 2YSOA 5KL5A 2YTIA 1MEYC 2EQ0A 2EOYA 2EMWA 2EM5A 2EOQA 2RPCA 2GHFA 4R2EA 1X3CA 3M99B 5KL3A 2EOZA 1Z1BA 2EN1A 1RMDA 2EMHA 2EORA 2EM6A 2EPXA 2EM2A 2YTEA 2EE8A 2EPRA 2LV2A 2EMIA 2EN6A 1F2IG 2CSHA 2WBTA 2LVHA 2EMFA 2EPAA 4R2QA 2A25A 1A1HA 1YSAC 2NABA 2ENCA 4X9JA 2E72A 4R2RA 1LLMC 2YTGA 5KL4A 2ELYA 2EOSA 4FK5C 2MKDA 4WSGA 1UN6B 1KJKA 3EPLA 1X5WA 2RSIA 2EN2A 2EN7A 2LO3A 2EMXA 2LCEA 2EPZA 2EM8A 2EOFA 1X6HA 2EM0A 1DGCA 1A1GA 2DRPA 4R2DA 3MHSC 4F6NA 2EOEA 2EJ4A 2EL4A 4GZNC 2EMBA 2EM3A 2D9HA 2ADRA 2EMAA 4R2PA 2EMCA 3UK3C 2DLKA 2LT7A 2R1FA 2EPPA 1P47A 1B69A 5KL7A 2EM4A 2YRHA 1YUJA 4M9VC 1A1FA 2EOJA 2EOMA 2YTOA 2EOOA 2YTDA 1ZU1A 2EM7A 2GLIA 2ENAA 2WCC3 2EMKA 1A1LA 2EN3A 2EMLA 1ZAAC 1YUIA 1A1IA 3EPHA 2MDGA 2YTQA 2M9AA 1BB8A 2EQ3A 2YU8A 2DLQA 2ENHA 2EQ1A 2HGHA 3EPJA 2EL6A 3MHHC 1BBOA 2YU5A
chains in the Genus database with same CATH superfamily
3BBGA 3C4TA 2YTPA 2JP9A 1QU6A 2V86A 2YTJA 4IS1C 4DV0E 2RS7A 1G2DC 2ELZA 1WHQA 2YSPA 4R2SA 2YRMA 4X66E 3C6MA 3AUZA 2JPAA 2YRKA 1A1JA 1AAYA 2MKNA 1O0WA 2DIXA 1N3GA 2EP3A 2Q8UA 2EOIA 5A6BD 1NCSA 3VK6A 2YZTA 2MC5A 5IT9C 2VRDA 2CT1A 1J5EE 4F6MA 2JXPA 1DQ3A 2EOYA 1EH8A 4BCAA 1FJGE 2GHFA 2V8QB 5KL3A 2EOZA 3KZYA 2EZ6A 4WXDA 3DJWA 1IQOA 4GEQB 1T4OA 3HQ1A 4DR5E 4JI2E 4NXNE 2V85A 5IWAE 2LV2A 1N34E 4TUGA 5CFFE 2EPAA 4J8ZA 2A25A 1YSAC 1IQSA 1PDAA 1LLMC 4O5GA 2ELYA 1STUA 5KL4A 1N36E 2UUAE 4BC7A 1WXRA 2V87A 1RC7A 1UN6B 3ZOQB 1KJKA 4B3ME 2LO3A 2EPZA 1DGCA 1GZ6A 4N4RB 4O24A 2UUCE 1YYOA 1T4NA 1DI2A 1RQ0A 1GQEA 2EOEA 2EMBA 2EM3A 4R8OA 2EMCA 3UK3C 5LLQA 2LT7A 1X48A 1XNQE 2R1FA 4X62E 1B69A 2HHHE 1A1FA 4JYAE 2UXDE 2NUFA 2B3TB 3J7AG 2EMLA 1WHNA 2HC5A 3EPHA 2FTXB 2M9AA 2YTQA 2WZOA 4DV1E 2EQ1A 2V83A 3EPJA 4BC9A 3J7Yp 2YWQA 5F3WA 4RHBB 2EPNA 2YU5A 2BBGA 5A6KA 2DGCA 4WX9A 2EL5A 2I9IA 2NA2A 2LJHA 2L2NA 2DSYA 2YPNA 5BR8E 1X47A 4M0VA 4DKKA 2LTRA 2MDRA 2ODRD 5T6JA 3JTZA 1TF3A 3THOB 4B3SE 1TN9A 4DV3E 3ADGA 3BF2A 1X6FA 2JWOA 2WBUA 1ZR9A 4NZVA 1JK1A 4DR6E 4ZYDA 2BB8A 1X6EA 2LE2A 2HJJA 3VYXA 2EN4A 4JI5E 1PKPA 5AE1A 1KYQA 4WSPA 4LFCE 4LF5E 3HPSA 3HXLA 1UILA 2EPMX 5AASA 1HNWE 2L3CA 1GTKA 2EMWA 2LUPB 2EM5A 1HNZE 2RPCA 4HTGA 4KHPE 4R03A 4R2EA 1ZBQA 2E1MA 3M99B 1NEIA 4LU9A 4DUYE 4LFAE 2RSMA 5LMNE 2EPRA 3LLHA 2LVHA 2JYAA 4RH8A 4DR4E 3HTXA 4F9CB 3FIGA 2ENCA 3BGHA 4R2RA 2B7TA 5LMUE 4JI1E 1UHZA 4FK5C 4WSGA 2LMZA 1SR9A 4KWYA 5AE3A 1EH6A 4ZYGA 3EPLA 4JI4E 2EN2A 2EMXA 2EM8A 2EOFA 1X6HA 1A1GA 1T38A 2VQFE 1EH7A 2DRPA 2L92A 2RTXA 2L33A 2L6MA 3JAMC 2EL4A 2DMYA 2D9HA 2ADRA 4R2PA 2DLKA 4P78A 3J80C 4WPYA 4F9AB 5TSEA 5KL7A 2EM4A 1BBGA 4L5NC 2LTSA 4HEIA 4DV5E 1T39A 4F9BB 2LRSA 3F6GA 1ZU1A 2WCC3 2EMKA 1YUIA 2EN3A 1ZAAC 2UU9E 5FLXC 1A1IA 1QNTA 1XMQE 5LL6R 2EWLA 1X49A 5A69A 4X64E 2EPKX 4GKJE 2E5LE 1PJSA 4DV6E 1BBOA 3IWDA 5IXMB 2CTDA 3ADLA 4BHCA 2MC6A 4OX9E 5KL6A 4JI3E 4R2CA 4ZYEA 2VQEE 2EOHA 5A6BA 5DNYA 2LBSB 1EKZA 2YTFA 1I94E 1TF6A 2EPUA 2DMIA 2GPIA 1T4LB 4NXME 4YHHE 2B7VA 1G2FC 1MGTA 2RQLA 4NHRA 3ECRA 2EMZA 2EPCA 2PRTA 2M1SA 2JVAA 4JV5E 4BMJA 2RS6A 4K0KE 3ADJA 4KZSA 1JK2A 4L8NA 2EN8A 3EPKA 4F2JC 4LFBE 4I8OA 4R2AA 2M4IA 1SFEA 2YTIA 2EQ0A 1IBLE 2EOQA 4DV4E 4WFTA 3HPZA 1Z1BA 2EN1A 2EMHA 2EORA 3KWRA 4MLQA 2EM6A 2EPXA 4DV7E 1YYKA 2EMIA 1F2IG 4O43A 2B9DA 2CSHA 2WBTA 2EMFA 2N8XA 2NABA 2H36X 3BIDA 5IV8B 2YTGA 2F8BA 4BS9A 2FGGA 2DB2A 1YFHA 2K7IA 1HR0E 2KONA 2RSIA 4F54A 2LCEA 2LJUA 2L3JA 2EM0A 1N33E 4MLVA 4R2DA 4LF6E 4M30A 2VE7C 4BBYA 4DR7E 2EMAA 2YT4A 1FKAE 4BHBA 5AE2A 3TQMA 1PJTA 3IWBA 2EPPA 1P47A 4JI6E 4JI7E 2JOXA 2V88A 1YPNA 2YTOA 2YTDA 2EM7A 4Q35B 5A2QC 2JOBA 3KZZA 2EQ3A 2YU8A 4TUIA 2DLQA 2ENHA 5A6AA 4DR3E 1X5WA 2EL6A 1L4SA 3MHHC 1BB8A 2V89A 2LUQA 1UBDC 2L2MA 1WJPA 3LMLA 2L2KB 3DF6A 1IBME 2EOXA 2UXCE 5A6JA 3ADIA 3F6HA 2I13A 2ODRC 2WBSA 2JR1A 4IJDA 4P7DA 5KL2A 4DV2E 1IMUA 1YYWA 4LF4E 2EMYA 4WXCA 4YY3E 2YTNA 4DMIA 2J7JA 1A1KA 4B3TE 3H09A 2EM9A 3VHTB 2UXBE 4M2ZA 2EMGA 4LTYA 2YSOA 5KL5A 1XNRE 1MEYC 3THNA 4GKKE 2N3HA 2N3GA 1X3CA 2NUGA 2ZM6E 1RMDA 3IWCA 5ADZA 4X8WA 4DR1E 5AC4A 2EM2A 2YTEA 2EE8A 3EQ1A 1IBKE 1ZBTA 4WYQB 2EN6A 3OMLA 1PJQA 1HNXE 3RMPA 4X65E 1A1HA 4R2QA 1WRJA 2VF1A 3L00A 4X9JA 2E72A 1J26A 4OOGC 2L8TA 4JI8E 3T1YE 2EPLX 2KOUA 2KHXA 2EOSA 4AQYE 3OTOE 2FV4B 2MKDA 4LF9E 2IHR1 3J81C 2EN7A 1AH5A 4Q28A 2UUBE 3P1XA 4JI0E 2M7QA 1N32E 4F6NA 2NUEA 2EJ4A 4GZNC 2F4VE 4LF8E 3MSWA 4B3RE 3C6KA 4DUZE 4O4KA 2YRHA 2G7HA 2K4VA 1YUJA 4M9VC 3AV0A 2JY9A 3JU0A 2EOJA 2EOMA 3K6QA 4ZYHA 1YZ9A 2EOOA 2CPNA 2GLIA 2ENAA 1A1LA 3C4BA 3VYYA 2R76A 2EPOA 2MDGA 3T1HE 3QG5C 2HGHA 4LF7E 5AC5A 1XMOE 4DR2E 3MHSC
chains in the Genus database with same CATH topology
1UBDC 2CTDA 2DGCA 1WJPA 2EL5A 5KL6A 4R2CA 2EOXA 2YTPA 2JP9A 2EOHA 2YTJA 4IS1C 2YTFA 1TF6A 2I13A 2EPUA 2WBSA 1G2DC 2DMIA 4IJDA 5KL2A 1TF3A 2ELZA 4R2SA 2YSPA 1TN9A 2YRMA 1X6FA 1G2FC 2WBUA 2EMYA 2JPAA 2YRKA 2EMZA 2EPCA 2PRTA 1ZR9A 1A1JA 1JK1A 1AAYA 2MKNA 2BB8A 1X6EA 2EP3A 2YTNA 2EOIA 2J7JA 1A1KA 1NCSA 2EN4A 2EM9A 1JK2A 3VHTB 2EN8A 2EMGA 2VRDA 2CT1A 3EPKA 4F2JC 4R2AA 4F6MA 2YSOA 5KL5A 2YTIA 1MEYC 2EQ0A 2EOYA 2EMWA 2EM5A 2EOQA 2RPCA 2GHFA 4R2EA 1X3CA 3M99B 5KL3A 2EOZA 1Z1BA 2EN1A 1RMDA 2EMHA 2EORA 2EM6A 2EPXA 2EM2A 2YTEA 2EE8A 2EPRA 2LV2A 2EMIA 2EN6A 1F2IG 2CSHA 2WBTA 2LVHA 2EMFA 2EPAA 4R2QA 2A25A 1A1HA 1YSAC 2NABA 2ENCA 4X9JA 2E72A 4R2RA 1LLMC 2YTGA 5KL4A 2ELYA 2EOSA 4FK5C 2MKDA 4WSGA 1UN6B 1KJKA 3EPLA 1X5WA 2RSIA 2EN2A 2EN7A 2LO3A 2EMXA 2LCEA 2EPZA 2EM8A 2EOFA 1X6HA 2EM0A 1DGCA 1A1GA 2DRPA 4R2DA 3MHSC 4F6NA 2EOEA 2EJ4A 2EL4A 4GZNC 2EMBA 2EM3A 2D9HA 2ADRA 2EMAA 4R2PA 2EMCA 3UK3C 2DLKA 2LT7A 2R1FA 2EPPA 1P47A 1B69A 5KL7A 2EM4A 2YRHA 1YUJA 4M9VC 1A1FA 2EOJA 2EOMA 2YTOA 2EOOA 2YTDA 1ZU1A 2EM7A 2GLIA 2ENAA 2WCC3 2EMKA 1A1LA 2EN3A 2EMLA 1ZAAC 1YUIA 1A1IA 3EPHA 2MDGA 2YTQA 2M9AA 1BB8A 2EQ3A 2YU8A 2DLQA 2ENHA 2EQ1A 2HGHA 3EPJA 2EL6A 3MHHC 1BBOA 2YU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBD C;  2CTD A;  2DGC A;  1WJP A;  2EL5 A;  5KL6 A;  4R2C A;  2EOX A;  2YTP A;  2JP9 A;  2EOH A;  2YTJ A;  4IS1 C;  2YTF A;  1TF6 A;  2I13 A;  2EPU A;  2WBS A;  1G2D C;  2DMI A;  4IJD A;  5KL2 A;  1TF3 A;  2ELZ A;  4R2S A;  2YSP A;  1TN9 A;  2YRM A;  1X6F A;  1G2F C;  2WBU A;  2EMY A;  2JPA A;  2YRK A;  2EMZ A;  2EPC A;  2PRT A;  1ZR9 A;  1A1J A;  1JK1 A;  1AAY A;  2MKN A;  2BB8 A;  1X6E A;  2EP3 A;  2YTN A;  2EOI A;  2J7J A;  1A1K A;  1NCS A;  2EN4 A;  2EM9 A;  1JK2 A;  3VHT B;  2EN8 A;  2EMG A;  2VRD A;  2CT1 A;  3EPK A;  4F2J C;  4R2A A;  4F6M A;  2YSO A;  5KL5 A;  2YTI A;  1MEY C;  2EQ0 A;  2EOY A;  2EMW A;  2EM5 A;  2EOQ A;  2RPC A;  2GHF A;  4R2E A;  1X3C A;  3M99 B;  5KL3 A;  2EOZ A;  1Z1B A;  2EN1 A;  1RMD A;  2EMH A;  2EOR A;  2EM6 A;  2EPX A;  2EM2 A;  2YTE A;  2EE8 A;  2EPR A;  2LV2 A;  2EMI A;  2EN6 A;  1F2I G;  2CSH A;  2WBT A;  2LVH A;  2EMF A;  2EPA A;  4R2Q A;  2A25 A;  1A1H A;  1YSA C;  2NAB A;  2ENC A;  4X9J A;  2E72 A;  4R2R A;  1LLM C;  2YTG A;  5KL4 A;  2ELY A;  2EOS A;  4FK5 C;  2MKD A;  4WSG A;  1UN6 B;  1KJK A;  3EPL A;  1X5W A;  2RSI A;  2EN2 A;  2EN7 A;  2LO3 A;  2EMX A;  2LCE A;  2EPZ A;  2EM8 A;  2EOF A;  1X6H A;  2EM0 A;  1DGC A;  1A1G A;  2DRP A;  4R2D A;  3MHS C;  4F6N A;  2EOE A;  2EJ4 A;  2EL4 A;  4GZN C;  2EMB A;  2EM3 A;  2D9H A;  2ADR A;  2EMA A;  4R2P A;  2EMC A;  3UK3 C;  2DLK A;  2LT7 A;  2R1F A;  2EPP A;  1P47 A;  1B69 A;  5KL7 A;  2EM4 A;  2YRH A;  1YUJ A;  4M9V C;  1A1F A;  2EOJ A;  2EOM A;  2YTO A;  2EOO A;  2YTD A;  1ZU1 A;  2EM7 A;  2GLI A;  2ENA A;  2WCC 3;  2EMK A;  1A1L A;  2EN3 A;  2EML A;  1ZAA C;  1YUI A;  1A1I A;  3EPH A;  2MDG A;  2YTQ A;  2M9A A;  1BB8 A;  2EQ3 A;  2YU8 A;  2DLQ A;  2ENH A;  2EQ1 A;  2HGH A;  3EPJ A;  2EL6 A;  3MHH C;  1BBO A;  2YU5 A; 
#chains in the Genus database with same CATH topology
 3BBG A;  3C4T A;  2YTP A;  2JP9 A;  1QU6 A;  2V86 A;  2YTJ A;  4IS1 C;  4DV0 E;  2RS7 A;  1G2D C;  2ELZ A;  1WHQ A;  2YSP A;  4R2S A;  2YRM A;  4X66 E;  3C6M A;  3AUZ A;  2JPA A;  2YRK A;  1A1J A;  1AAY A;  2MKN A;  1O0W A;  2DIX A;  1N3G A;  2EP3 A;  2Q8U A;  2EOI A;  5A6B D;  1NCS A;  3VK6 A;  2YZT A;  2MC5 A;  5IT9 C;  2VRD A;  2CT1 A;  1J5E E;  4F6M A;  2JXP A;  1DQ3 A;  2EOY A;  1EH8 A;  4BCA A;  1FJG E;  2GHF A;  2V8Q B;  5KL3 A;  2EOZ A;  3KZY A;  2EZ6 A;  4WXD A;  3DJW A;  1IQO A;  4GEQ B;  1T4O A;  3HQ1 A;  4DR5 E;  4JI2 E;  4NXN E;  2V85 A;  5IWA E;  2LV2 A;  1N34 E;  4TUG A;  5CFF E;  2EPA A;  4J8Z A;  2A25 A;  1YSA C;  1IQS A;  1PDA A;  1LLM C;  4O5G A;  2ELY A;  1STU A;  5KL4 A;  1N36 E;  2UUA E;  4BC7 A;  1WXR A;  2V87 A;  1RC7 A;  1UN6 B;  3ZOQ B;  1KJK A;  4B3M E;  2LO3 A;  2EPZ A;  1DGC A;  1GZ6 A;  4N4R B;  4O24 A;  2UUC E;  1YYO A;  1T4N A;  1DI2 A;  1RQ0 A;  1GQE A;  2EOE A;  2EMB A;  2EM3 A;  4R8O A;  2EMC A;  3UK3 C;  5LLQ A;  2LT7 A;  1X48 A;  1XNQ E;  2R1F A;  4X62 E;  1B69 A;  2HHH E;  1A1F A;  4JYA E;  2UXD E;  2NUF A;  2B3T B;  3J7A G;  2EML A;  1WHN A;  2HC5 A;  3EPH A;  2FTX B;  2M9A A;  2YTQ A;  2WZO A;  4DV1 E;  2EQ1 A;  2V83 A;  3EPJ A;  4BC9 A;  3J7Y p;  2YWQ A;  5F3W A;  4RHB B;  2EPN A;  2YU5 A;  2BBG A;  5A6K A;  2DGC A;  4WX9 A;  2EL5 A;  2I9I A;  2NA2 A;  2LJH A;  2L2N A;  2DSY A;  2YPN A;  5BR8 E;  1X47 A;  4M0V A;  4DKK A;  2LTR A;  2MDR A;  2ODR D;  5T6J A;  3JTZ A;  1TF3 A;  3THO B;  4B3S E;  1TN9 A;  4DV3 E;  3ADG A;  3BF2 A;  1X6F A;  2JWO A;  2WBU A;  1ZR9 A;  4NZV A;  1JK1 A;  4DR6 E;  4ZYD A;  2BB8 A;  1X6E A;  2LE2 A;  2HJJ A;  3VYX A;  2EN4 A;  4JI5 E;  1PKP A;  5AE1 A;  1KYQ A;  4WSP A;  4LFC E;  4LF5 E;  3HPS A;  3HXL A;  1UIL A;  2EPM X;  5AAS A;  1HNW E;  2L3C A;  1GTK A;  2EMW A;  2LUP B;  2EM5 A;  1HNZ E;  2RPC A;  4HTG A;  4KHP E;  4R03 A;  4R2E A;  1ZBQ A;  2E1M A;  3M99 B;  1NEI A;  4LU9 A;  4DUY E;  4LFA E;  2RSM A;  5LMN E;  2EPR A;  3LLH A;  2LVH A;  2JYA A;  4RH8 A;  4DR4 E;  3HTX A;  4F9C B;  3FIG A;  2ENC A;  3BGH A;  4R2R A;  2B7T A;  5LMU E;  4JI1 E;  1UHZ A;  4FK5 C;  4WSG A;  2LMZ A;  1SR9 A;  4KWY A;  5AE3 A;  1EH6 A;  4ZYG A;  3EPL A;  4JI4 E;  2EN2 A;  2EMX A;  2EM8 A;  2EOF A;  1X6H A;  1A1G A;  1T38 A;  2VQF E;  1EH7 A;  2DRP A;  2L92 A;  2RTX A;  2L33 A;  2L6M A;  3JAM C;  2EL4 A;  2DMY A;  2D9H A;  2ADR A;  4R2P A;  2DLK A;  4P78 A;  3J80 C;  4WPY A;  4F9A B;  5TSE A;  5KL7 A;  2EM4 A;  1BBG A;  4L5N C;  2LTS A;  4HEI A;  4DV5 E;  1T39 A;  4F9B B;  2LRS A;  3F6G A;  1ZU1 A;  2WCC 3;  2EMK A;  1YUI A;  2EN3 A;  1ZAA C;  2UU9 E;  5FLX C;  1A1I A;  1QNT A;  1XMQ E;  5LL6 R;  2EWL A;  1X49 A;  5A69 A;  4X64 E;  2EPK X;  4GKJ E;  2E5L E;  1PJS A;  4DV6 E;  1BBO A;  3IWD A;  5IXM B;  2CTD A;  3ADL A;  4BHC A;  2MC6 A;  4OX9 E;  5KL6 A;  4JI3 E;  4R2C A;  4ZYE A;  2VQE E;  2EOH A;  5A6B A;  5DNY A;  2LBS B;  1EKZ A;  2YTF A;  1I94 E;  1TF6 A;  2EPU A;  2DMI A;  2GPI A;  1T4L B;  4NXM E;  4YHH E;  2B7V A;  1G2F C;  1MGT A;  2RQL A;  4NHR A;  3ECR A;  2EMZ A;  2EPC A;  2PRT A;  2M1S A;  2JVA A;  4JV5 E;  4BMJ A;  2RS6 A;  4K0K E;  3ADJ A;  4KZS A;  1JK2 A;  4L8N A;  2EN8 A;  3EPK A;  4F2J C;  4LFB E;  4I8O A;  4R2A A;  2M4I A;  1SFE A;  2YTI A;  2EQ0 A;  1IBL E;  2EOQ A;  4DV4 E;  4WFT A;  3HPZ A;  1Z1B A;  2EN1 A;  2EMH A;  2EOR A;  3KWR A;  4MLQ A;  2EM6 A;  2EPX A;  4DV7 E;  1YYK A;  2EMI A;  1F2I G;  4O43 A;  2B9D A;  2CSH A;  2WBT A;  2EMF A;  2N8X A;  2NAB A;  2H36 X;  3BID A;  5IV8 B;  2YTG A;  2F8B A;  4BS9 A;  2FGG A;  2DB2 A;  1YFH A;  2K7I A;  1HR0 E;  2KON A;  2RSI A;  4F54 A;  2LCE A;  2LJU A;  2L3J A;  2EM0 A;  1N33 E;  4MLV A;  4R2D A;  4LF6 E;  4M30 A;  2VE7 C;  4BBY A;  4DR7 E;  2EMA A;  2YT4 A;  1FKA E;  4BHB A;  5AE2 A;  3TQM A;  1PJT A;  3IWB A;  2EPP A;  1P47 A;  4JI6 E;  4JI7 E;  2JOX A;  2V88 A;  1YPN A;  2YTO A;  2YTD A;  2EM7 A;  4Q35 B;  5A2Q C;  2JOB A;  3KZZ A;  2EQ3 A;  2YU8 A;  4TUI A;  2DLQ A;  2ENH A;  5A6A A;  4DR3 E;  1X5W A;  2EL6 A;  1L4S A;  3MHH C;  1BB8 A;  2V89 A;  2LUQ A;  1UBD C;  2L2M A;  1WJP A;  3LML A;  2L2K B;  3DF6 A;  1IBM E;  2EOX A;  2UXC E;  5A6J A;  3ADI A;  3F6H A;  2I13 A;  2ODR C;  2WBS A;  2JR1 A;  4IJD A;  4P7D A;  5KL2 A;  4DV2 E;  1IMU A;  1YYW A;  4LF4 E;  2EMY A;  4WXC A;  4YY3 E;  2YTN A;  4DMI A;  2J7J A;  1A1K A;  4B3T E;  3H09 A;  2EM9 A;  3VHT B;  2UXB E;  4M2Z A;  2EMG A;  4LTY A;  2YSO A;  5KL5 A;  1XNR E;  1MEY C;  3THN A;  4GKK E;  2N3H A;  2N3G A;  1X3C A;  2NUG A;  2ZM6 E;  1RMD A;  3IWC A;  5ADZ A;  4X8W A;  4DR1 E;  5AC4 A;  2EM2 A;  2YTE A;  2EE8 A;  3EQ1 A;  1IBK E;  1ZBT A;  4WYQ B;  2EN6 A;  3OML A;  1PJQ A;  1HNX E;  3RMP A;  4X65 E;  1A1H A;  4R2Q A;  1WRJ A;  2VF1 A;  3L00 A;  4X9J A;  2E72 A;  1J26 A;  4OOG C;  2L8T A;  4JI8 E;  3T1Y E;  2EPL X;  2KOU A;  2KHX A;  2EOS A;  4AQY E;  3OTO E;  2FV4 B;  2MKD A;  4LF9 E;  2IHR 1;  3J81 C;  2EN7 A;  1AH5 A;  4Q28 A;  2UUB E;  3P1X A;  4JI0 E;  2M7Q A;  1N32 E;  4F6N A;  2NUE A;  2EJ4 A;  4GZN C;  2F4V E;  4LF8 E;  3MSW A;  4B3R E;  3C6K A;  4DUZ E;  4O4K A;  2YRH A;  2G7H A;  2K4V A;  1YUJ A;  4M9V C;  3AV0 A;  2JY9 A;  3JU0 A;  2EOJ A;  2EOM A;  3K6Q A;  4ZYH A;  1YZ9 A;  2EOO A;  2CPN A;  2GLI A;  2ENA A;  1A1L A;  3C4B A;  3VYY A;  2R76 A;  2EPO A;  2MDG A;  3T1H E;  3QG5 C;  2HGH A;  4LF7 E;  5AC5 A;  1XMO E;  4DR2 E;  3MHS C; 
#chains in the Genus database with same CATH homology
 1UBD C;  2CTD A;  2DGC A;  1WJP A;  2EL5 A;  5KL6 A;  4R2C A;  2EOX A;  2YTP A;  2JP9 A;  2EOH A;  2YTJ A;  4IS1 C;  2YTF A;  1TF6 A;  2I13 A;  2EPU A;  2WBS A;  1G2D C;  2DMI A;  4IJD A;  5KL2 A;  1TF3 A;  2ELZ A;  4R2S A;  2YSP A;  1TN9 A;  2YRM A;  1X6F A;  1G2F C;  2WBU A;  2EMY A;  2JPA A;  2YRK A;  2EMZ A;  2EPC A;  2PRT A;  1ZR9 A;  1A1J A;  1JK1 A;  1AAY A;  2MKN A;  2BB8 A;  1X6E A;  2EP3 A;  2YTN A;  2EOI A;  2J7J A;  1A1K A;  1NCS A;  2EN4 A;  2EM9 A;  1JK2 A;  3VHT B;  2EN8 A;  2EMG A;  2VRD A;  2CT1 A;  3EPK A;  4F2J C;  4R2A A;  4F6M A;  2YSO A;  5KL5 A;  2YTI A;  1MEY C;  2EQ0 A;  2EOY A;  2EMW A;  2EM5 A;  2EOQ A;  2RPC A;  2GHF A;  4R2E A;  1X3C A;  3M99 B;  5KL3 A;  2EOZ A;  1Z1B A;  2EN1 A;  1RMD A;  2EMH A;  2EOR A;  2EM6 A;  2EPX A;  2EM2 A;  2YTE A;  2EE8 A;  2EPR A;  2LV2 A;  2EMI A;  2EN6 A;  1F2I G;  2CSH A;  2WBT A;  2LVH A;  2EMF A;  2EPA A;  4R2Q A;  2A25 A;  1A1H A;  1YSA C;  2NAB A;  2ENC A;  4X9J A;  2E72 A;  4R2R A;  1LLM C;  2YTG A;  5KL4 A;  2ELY A;  2EOS A;  4FK5 C;  2MKD A;  4WSG A;  1UN6 B;  1KJK A;  3EPL A;  1X5W A;  2RSI A;  2EN2 A;  2EN7 A;  2LO3 A;  2EMX A;  2LCE A;  2EPZ A;  2EM8 A;  2EOF A;  1X6H A;  2EM0 A;  1DGC A;  1A1G A;  2DRP A;  4R2D A;  3MHS C;  4F6N A;  2EOE A;  2EJ4 A;  2EL4 A;  4GZN C;  2EMB A;  2EM3 A;  2D9H A;  2ADR A;  2EMA A;  4R2P A;  2EMC A;  3UK3 C;  2DLK A;  2LT7 A;  2R1F A;  2EPP A;  1P47 A;  1B69 A;  5KL7 A;  2EM4 A;  2YRH A;  1YUJ A;  4M9V C;  1A1F A;  2EOJ A;  2EOM A;  2YTO A;  2EOO A;  2YTD A;  1ZU1 A;  2EM7 A;  2GLI A;  2ENA A;  2WCC 3;  2EMK A;  1A1L A;  2EN3 A;  2EML A;  1ZAA C;  1YUI A;  1A1I A;  3EPH A;  2MDG A;  2YTQ A;  2M9A A;  1BB8 A;  2EQ3 A;  2YU8 A;  2DLQ A;  2ENH A;  2EQ1 A;  2HGH A;  3EPJ A;  2EL6 A;  3MHH C;  1BBO A;  2YU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...