2ADRA

Adr1 dna-binding domain from saccharomyces cerevisiae, nmr, 25 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRAFTRRDLLIRHAQKIHSGNLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADR1
publication title A folding transition and novel zinc finger accessory domain in the transcription factor ADR1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulation
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1998-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2adrA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2adrA02
1X5WA 2YSPA 2YRKA 2EMKA 5KL6A 2EM4A 2EM8A 2R1FA 1A1IA 2EOMA 2LCEA 2M9AA 4IS1C 2EM2A 2YTJA 2WCC3 2EMXA 5KL5A 2CSHA 2YTQA 2GHFA 1NCSA 2EQ0A 2YTGA 2YTNA 2VRDA 1A1HA 2DRPA 2YU5A 2CT1A 4R2PA 2EM9A 2MKNA 2EM5A 2DLKA 2YTPA 1RMDA 4R2EA 2WBUA 1TF3A 3VHTB 2EQ1A 2CTDA 1JK1A 2WBTA 2DLQA 2YSOA 2EPAA 4IJDA 1ZAAC 2WBSA 2EOYA 2LVHA 3EPLA 2EQ3A 2NABA 2EMAA 2EMBA 5KL3A 2EMHA 2EN3A 2EMCA 2EPZA 1KJKA 2RPCA 3MHHC 4F2JC 1UBDC 2ELYA 2EOSA 2MKDA 3UK3C 1Z1BA 4FK5C 2EE8A 2EM6A 1YUIA 2YTEA 2D9HA 1G2FC 2EOQA 1MEYC 1A1FA 2DGCA 2EL5A 4F6MA 2ELZA 2A25A 2EPXA 4R2RA 3EPKA 1TF6A 1LLMC 2EPUA 2LV2A 2EMLA 2JP9A 2DMIA 1JK2A 2JPAA 2EOZA 2EL6A 1BB8A 2EOXA 2EMZA 2EM7A 2YTFA 4R2AA 1TN9A 4X9JA 2EOHA 2EPPA 4F6NA 3M99B 1DGCA 2EP3A 2MDGA 2YU8A 2EOFA 2J7JA 2EN7A 2EOEA 2BB8A 2ENCA 4R2SA 2LT7A 2EM0A 2HGHA 1A1LA 2ADRA 1X6HA 5KL7A 4R2CA 1UN6B 2LO3A 2E72A 2ENHA 4R2QA 1F2IG 1A1JA 2YRMA 1ZU1A 2YTDA 2YTOA 5KL2A 1P47A 1X6EA 2EL4A 2RSIA 1YUJA 2EPRA 2EMYA 2YTIA 2EOIA 2EPCA 2EN2A 2EMGA 2YRHA 3EPJA 2EORA 1WJPA 2EN1A 1AAYA 2EJ4A 2EM3A 2PRTA 1A1KA 4GZNC 2EOOA 4R2DA 4M9VC 2EMWA 2EN4A 2I13A 4WSGA 2ENAA 1YSAC 2EMIA 1G2DC 2EN8A 1X3CA 2GLIA 3EPHA 3MHSC 5KL4A 1ZR9A 1B69A 1X6FA 2EMFA 1BBOA 1A1GA 2EN6A 2EOJA
chains in the Genus database with same CATH superfamily
4WYQB 2LTSA 4TUGA 1X5WA 2RS6A 4BHBA 2EMKA 2EM4A 5LMUE 2KHXA 2LCEA 3FIGA 4JI7E 1X48A 2EQ0A 4OOGC 4L8NA 2YTGA 2YU5A 3JTZA 4B3RE 2MKNA 4RH8A 2EM5A 1RMDA 4WFTA 2DLQA 2YSOA 2EPAA 4GEQB 4JI8E 5F3WA 3HTXA 2LVHA 1DI2A 2EQ3A 2NABA 4LF9E 2EMAA 4ZYDA 2EMBA 5KL3A 2I9IA 3C6KA 3ADIA 2YPNA 4ZYEA 3MHHC 1YYKA 4FK5C 2RTXA 1T4OA 2D9HA 1G2FC 5ADZA 4DV3E 2FTXB 2B3TB 4R03A 3EPKA 3LMLA 4MLQA 5A6AA 2LV2A 2VE7C 2ZM6E 2L2NA 2LTRA 3DF6A 2DMIA 2N8XA 3C4TA 2B9DA 5A6BD 3HPZA 3AV0A 2EMZA 2K4VA 4DUYE 2EZ6A 1TN9A 4X9JA 2EOHA 4BBYA 3AUZA 3TQMA 2MDGA 2YU8A 2MC6A 3T1HE 2BB8A 2ENCA 4JYAE 3BF2A 2EM0A 1QU6A 2WZOA 4WPYA 1RC7A 2HC5A 2LO3A 3P1XA 5BR8E 4BC7A 4R2QA 1F2IG 1MGTA 2NUEA 2YTDA 1NEIA 4P7DA 4I8OA 4P78A 2YTIA 2EN2A 2EMGA 1WJPA 2EN1A 1AAYA 4LF8E 2JY9A 3QG5C 4DV1E 3HXLA 4MLVA 4R2DA 4LFAE 2IHR1 2EN4A 5A6JA 4DR4E 4M0VA 1STUA 1L4SA 2UXBE 1ZR9A 5AC5A 3BIDA 4O4KA 2M1SA 3BGHA 1UHZA 4R8OA 4DMIA 1HNXE 4N4RB 5IXMB 2YRKA 2V89A 3HQ1A 4NZVA 1ZBQA 5KL6A 2ODRD 2R1FA 4LF7E 1DQ3A 1WXRA 4M2ZA 3KZYA 2YTJA 4DV0E 4F54A 2CSHA 2JOXA 2GHFA 1NCSA 3RMPA 2DB2A 2UXCE 2M7QA 1XMQE 2DRPA 4R2PA 4B3TE 2EM9A 1J5EE 2WBUA 1TF3A 2G7HA 4X62E 1T38A 1JK1A 2WBTA 4DV5E 3KWRA 4O24A 2DSYA 2V88A 3EPLA 4WX9A 2EPKX 3DJWA 2EN3A 1IQOA 2MKDA 5DNYA 1Z1BA 3T1YE 2EM6A 4ZYHA 2YTEA 3VYXA 2EOQA 1IBKE 4JV5E 1J26A 5AC4A 4AQYE 2DGCA 2EL5A 4LFCE 1KYQA 4OX9E 2EPXA 1LLMC 2EMLA 1JK2A 2EOZA 3KZZA 4X8WA 2EL6A 2H36X 1BB8A 2R76A 2UXDE 2EOXA 2YT4A 2YTFA 2LJHA 4BMJA 2ODRC 4DR7E 4F6NA 5IV8B 2NUGA 1HNZE 3ZOQB 2EOFA 4HEIA 2J7JA 4WXCA 4JI6E 3LLHA 5IT9C 2EPLX 2F4VE 2HGHA 1A1LA 2L2KB 1SR9A 2ADRA 3J81C 4BC9A 2LUQA 4F9BB 4R2CA 1YPNA 3F6GA 2F8BA 1QNTA 2V8QB 1A1JA 2V85A 1X6EA 2RSIA 2EPRA 2EMYA 4DV4E 4WSPA 2YRHA 2EORA 2LE2A 1GZ6A 4BCAA 1A1KA 4GZNC 4M9VC 3F6HA 4WSGA 1N36E 1BBGA 1YSAC 4DR3E 2RS7A 2NUFA 2BBGA 5AE3A 2L6MA 1X6FA 2N3GA 2HHHE 1T4NA 1A1GA 5A2QC 4WXDA 2EOJA 4TUIA 3IWBA 1FKAE 3VK6A 1PJQA 5FLXC 5LMNE 1A1IA 1N3GA 2M9AA 2EMXA 2RSMA 3ADGA 1N33E 2L3CA 4Q35B 4BS9A 2DIXA 2VRDA 1A1HA 4JI5E 4O43A 5A6BA 1N32E 2EPMX 3VHTB 2EQ1A 2L3JA 3VYYA 1UILA 1O0WA 3L00A 4BHCA 4LU9A 4IJDA 2NA2A 1ZAAC 2WBSA 2EOYA 3J80C 2LBSB 2EMHA 2EMCA 1KJKA 2RPCA 4NXME 2M4IA 2EE8A 1ZBTA 2LMZA 5LLQA 1N34E 1RQ0A 1MEYC 2V87A 1A1FA 4F6MA 1SFEA 2ELZA 2RQLA 2A25A 4X64E 4R2RA 1TF6A 4GKKE 2LUPB 2UUCE 4DKKA 4DR2E 3K6QA 2L33A 4F9CB 4X65E 3THOB 1GQEA 2YZTA 3C4BA 2EM7A 5LL6R 3OMLA 5AASA 1IMUA 1XNQE 4DV2E 4LF6E 1GTKA 2LRSA 1YYWA 1DGCA 2EP3A 2GPIA 1YYOA 2YWQA 2EOEA 2KOUA 2VQFE 1IBME 4R2SA 1EH8A 3J7AG 5KL7A 2ENHA 3IWCA 2DMYA 2YRMA 1ZU1A 3THNA 2YTOA 5KL2A 1P47A 1YUJA 2V83A 2EOIA 2EPCA 4RHBB 2JXPA 4LF5E 1XNRE 2PRTA 2UUBE 2UU9E 2EOOA 2EMWA 1T39A 1YFHA 2ENAA 5A69A 3J7Yp 1G2DC 2KONA 2EN8A 3EPHA 5KL4A 1IBLE 2JOBA 2JVAA 2E1MA 2VQEE 1B69A 4L5NC 2EMFA 1BBOA 4DR5E 4YY3E 4JI0E 3ECRA 5CFFE 2YSPA 3MSWA 3IWDA 4X66E 2EM8A 1X49A 2EOMA 4IS1C 2EM2A 1IQSA 2WCC3 5KL5A 2YTQA 4DR1E 1PJTA 2YTNA 2HJJA 2CT1A 4B3SE 1I94E 4K0KE 2MDRA 2YTPA 2DLKA 4R2EA 4GKJE 3OTOE 4JI3E 2K7IA 5AE1A 2CTDA 1EKZA 4JI4E 4F9AB 1PKPA 2LJUA 4DV7E 2L8TA 4DR6E 2EPZA 3C6MA 3ADJA 3EQ1A 4KHPE 4F2JC 1UBDC 2ELYA 2EOSA 3UK3C 1YUIA 5TSEA 1YZ9A 4M30A 4B3ME 2EPUA 2EWLA 4HTGA 5IWAE 1AH5A 2JP9A 1T4LB 1EH7A 2JPAA 4KWYA 1WRJA 2L92A 2E5LE 4LFBE 1FJGE 4R2AA 1WHNA 2L2MA 4Q28A 5T6JA 2EPPA 3M99B 4JI1E 4LTYA 2VF1A 2EN7A 1WHQA 2LT7A 1HNWE 2FGGA 4DUZE 2JWOA 1X6HA 4KZSA 1UN6B 2E72A 5A6KA 4LF4E 2JR1A 4NXNE 2MC5A 2Q8UA 1XMOE 4DV6E 2EL4A 4ZYGA 4O5GA 3EPJA 4JI2E 3HPSA 2EJ4A 2EM3A 1HR0E 2EPNA 1EH6A 5AE2A 2B7TA 4J8ZA 3BBGA 2I13A 4NHRA 1X47A 2EMIA 1X3CA 2GLIA 3MHSC 1PDAA 2EPOA 2N3HA 2JYAA 2UUAE 4YHHE 1PJSA 3JU0A 3JAMC 3H09A 2CPNA 2FV4B 2B7VA 3ADLA 2V86A 2EN6A
chains in the Genus database with same CATH topology
1X5WA 2YSPA 2YRKA 2EMKA 5KL6A 2EM4A 2EM8A 2R1FA 1A1IA 2EOMA 2LCEA 2M9AA 4IS1C 2EM2A 2YTJA 2WCC3 2EMXA 5KL5A 2CSHA 2YTQA 2GHFA 1NCSA 2EQ0A 2YTGA 2YTNA 2VRDA 1A1HA 2DRPA 2YU5A 2CT1A 4R2PA 2EM9A 2MKNA 2EM5A 2DLKA 2YTPA 1RMDA 4R2EA 2WBUA 1TF3A 3VHTB 2EQ1A 2CTDA 1JK1A 2WBTA 2DLQA 2YSOA 2EPAA 4IJDA 1ZAAC 2WBSA 2EOYA 2LVHA 3EPLA 2EQ3A 2NABA 2EMAA 2EMBA 5KL3A 2EMHA 2EN3A 2EMCA 2EPZA 1KJKA 2RPCA 3MHHC 4F2JC 1UBDC 2ELYA 2EOSA 2MKDA 3UK3C 1Z1BA 4FK5C 2EE8A 2EM6A 1YUIA 2YTEA 2D9HA 1G2FC 2EOQA 1MEYC 1A1FA 2DGCA 2EL5A 4F6MA 2ELZA 2A25A 2EPXA 4R2RA 3EPKA 1TF6A 1LLMC 2EPUA 2LV2A 2EMLA 2JP9A 2DMIA 1JK2A 2JPAA 2EOZA 2EL6A 1BB8A 2EOXA 2EMZA 2EM7A 2YTFA 4R2AA 1TN9A 4X9JA 2EOHA 2EPPA 4F6NA 3M99B 1DGCA 2EP3A 2MDGA 2YU8A 2EOFA 2J7JA 2EN7A 2EOEA 2BB8A 2ENCA 4R2SA 2LT7A 2EM0A 2HGHA 1A1LA 2ADRA 1X6HA 5KL7A 4R2CA 1UN6B 2LO3A 2E72A 2ENHA 4R2QA 1F2IG 1A1JA 2YRMA 1ZU1A 2YTDA 2YTOA 5KL2A 1P47A 1X6EA 2EL4A 2RSIA 1YUJA 2EPRA 2EMYA 2YTIA 2EOIA 2EPCA 2EN2A 2EMGA 2YRHA 3EPJA 2EORA 1WJPA 2EN1A 1AAYA 2EJ4A 2EM3A 2PRTA 1A1KA 4GZNC 2EOOA 4R2DA 4M9VC 2EMWA 2EN4A 2I13A 4WSGA 2ENAA 1YSAC 2EMIA 1G2DC 2EN8A 1X3CA 2GLIA 3EPHA 3MHSC 5KL4A 1ZR9A 1B69A 1X6FA 2EMFA 1BBOA 1A1GA 2EN6A 2EOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X5W A;  2YSP A;  2YRK A;  2EMK A;  5KL6 A;  2EM4 A;  2EM8 A;  2R1F A;  1A1I A;  2EOM A;  2LCE A;  2M9A A;  4IS1 C;  2EM2 A;  2YTJ A;  2WCC 3;  2EMX A;  5KL5 A;  2CSH A;  2YTQ A;  2GHF A;  1NCS A;  2EQ0 A;  2YTG A;  2YTN A;  2VRD A;  1A1H A;  2DRP A;  2YU5 A;  2CT1 A;  4R2P A;  2EM9 A;  2MKN A;  2EM5 A;  2DLK A;  2YTP A;  1RMD A;  4R2E A;  2WBU A;  1TF3 A;  3VHT B;  2EQ1 A;  2CTD A;  1JK1 A;  2WBT A;  2DLQ A;  2YSO A;  2EPA A;  4IJD A;  1ZAA C;  2WBS A;  2EOY A;  2LVH A;  3EPL A;  2EQ3 A;  2NAB A;  2EMA A;  2EMB A;  5KL3 A;  2EMH A;  2EN3 A;  2EMC A;  2EPZ A;  1KJK A;  2RPC A;  3MHH C;  4F2J C;  1UBD C;  2ELY A;  2EOS A;  2MKD A;  3UK3 C;  1Z1B A;  4FK5 C;  2EE8 A;  2EM6 A;  1YUI A;  2YTE A;  2D9H A;  1G2F C;  2EOQ A;  1MEY C;  1A1F A;  2DGC A;  2EL5 A;  4F6M A;  2ELZ A;  2A25 A;  2EPX A;  4R2R A;  3EPK A;  1TF6 A;  1LLM C;  2EPU A;  2LV2 A;  2EML A;  2JP9 A;  2DMI A;  1JK2 A;  2JPA A;  2EOZ A;  2EL6 A;  1BB8 A;  2EOX A;  2EMZ A;  2EM7 A;  2YTF A;  4R2A A;  1TN9 A;  4X9J A;  2EOH A;  2EPP A;  4F6N A;  3M99 B;  1DGC A;  2EP3 A;  2MDG A;  2YU8 A;  2EOF A;  2J7J A;  2EN7 A;  2EOE A;  2BB8 A;  2ENC A;  4R2S A;  2LT7 A;  2EM0 A;  2HGH A;  1A1L A;  2ADR A;  1X6H A;  5KL7 A;  4R2C A;  1UN6 B;  2LO3 A;  2E72 A;  2ENH A;  4R2Q A;  1F2I G;  1A1J A;  2YRM A;  1ZU1 A;  2YTD A;  2YTO A;  5KL2 A;  1P47 A;  1X6E A;  2EL4 A;  2RSI A;  1YUJ A;  2EPR A;  2EMY A;  2YTI A;  2EOI A;  2EPC A;  2EN2 A;  2EMG A;  2YRH A;  3EPJ A;  2EOR A;  1WJP A;  2EN1 A;  1AAY A;  2EJ4 A;  2EM3 A;  2PRT A;  1A1K A;  4GZN C;  2EOO A;  4R2D A;  4M9V C;  2EMW A;  2EN4 A;  2I13 A;  4WSG A;  2ENA A;  1YSA C;  2EMI A;  1G2D C;  2EN8 A;  1X3C A;  2GLI A;  3EPH A;  3MHS C;  5KL4 A;  1ZR9 A;  1B69 A;  1X6F A;  2EMF A;  1BBO A;  1A1G A;  2EN6 A;  2EOJ A; 
#chains in the Genus database with same CATH topology
 4WYQ B;  2LTS A;  4TUG A;  1X5W A;  2RS6 A;  4BHB A;  2EMK A;  2EM4 A;  5LMU E;  2KHX A;  2LCE A;  3FIG A;  4JI7 E;  1X48 A;  2EQ0 A;  4OOG C;  4L8N A;  2YTG A;  2YU5 A;  3JTZ A;  4B3R E;  2MKN A;  4RH8 A;  2EM5 A;  1RMD A;  4WFT A;  2DLQ A;  2YSO A;  2EPA A;  4GEQ B;  4JI8 E;  5F3W A;  3HTX A;  2LVH A;  1DI2 A;  2EQ3 A;  2NAB A;  4LF9 E;  2EMA A;  4ZYD A;  2EMB A;  5KL3 A;  2I9I A;  3C6K A;  3ADI A;  2YPN A;  4ZYE A;  3MHH C;  1YYK A;  4FK5 C;  2RTX A;  1T4O A;  2D9H A;  1G2F C;  5ADZ A;  4DV3 E;  2FTX B;  2B3T B;  4R03 A;  3EPK A;  3LML A;  4MLQ A;  5A6A A;  2LV2 A;  2VE7 C;  2ZM6 E;  2L2N A;  2LTR A;  3DF6 A;  2DMI A;  2N8X A;  3C4T A;  2B9D A;  5A6B D;  3HPZ A;  3AV0 A;  2EMZ A;  2K4V A;  4DUY E;  2EZ6 A;  1TN9 A;  4X9J A;  2EOH A;  4BBY A;  3AUZ A;  3TQM A;  2MDG A;  2YU8 A;  2MC6 A;  3T1H E;  2BB8 A;  2ENC A;  4JYA E;  3BF2 A;  2EM0 A;  1QU6 A;  2WZO A;  4WPY A;  1RC7 A;  2HC5 A;  2LO3 A;  3P1X A;  5BR8 E;  4BC7 A;  4R2Q A;  1F2I G;  1MGT A;  2NUE A;  2YTD A;  1NEI A;  4P7D A;  4I8O A;  4P78 A;  2YTI A;  2EN2 A;  2EMG A;  1WJP A;  2EN1 A;  1AAY A;  4LF8 E;  2JY9 A;  3QG5 C;  4DV1 E;  3HXL A;  4MLV A;  4R2D A;  4LFA E;  2IHR 1;  2EN4 A;  5A6J A;  4DR4 E;  4M0V A;  1STU A;  1L4S A;  2UXB E;  1ZR9 A;  5AC5 A;  3BID A;  4O4K A;  2M1S A;  3BGH A;  1UHZ A;  4R8O A;  4DMI A;  1HNX E;  4N4R B;  5IXM B;  2YRK A;  2V89 A;  3HQ1 A;  4NZV A;  1ZBQ A;  5KL6 A;  2ODR D;  2R1F A;  4LF7 E;  1DQ3 A;  1WXR A;  4M2Z A;  3KZY A;  2YTJ A;  4DV0 E;  4F54 A;  2CSH A;  2JOX A;  2GHF A;  1NCS A;  3RMP A;  2DB2 A;  2UXC E;  2M7Q A;  1XMQ E;  2DRP A;  4R2P A;  4B3T E;  2EM9 A;  1J5E E;  2WBU A;  1TF3 A;  2G7H A;  4X62 E;  1T38 A;  1JK1 A;  2WBT A;  4DV5 E;  3KWR A;  4O24 A;  2DSY A;  2V88 A;  3EPL A;  4WX9 A;  2EPK X;  3DJW A;  2EN3 A;  1IQO A;  2MKD A;  5DNY A;  1Z1B A;  3T1Y E;  2EM6 A;  4ZYH A;  2YTE A;  3VYX A;  2EOQ A;  1IBK E;  4JV5 E;  1J26 A;  5AC4 A;  4AQY E;  2DGC A;  2EL5 A;  4LFC E;  1KYQ A;  4OX9 E;  2EPX A;  1LLM C;  2EML A;  1JK2 A;  2EOZ A;  3KZZ A;  4X8W A;  2EL6 A;  2H36 X;  1BB8 A;  2R76 A;  2UXD E;  2EOX A;  2YT4 A;  2YTF A;  2LJH A;  4BMJ A;  2ODR C;  4DR7 E;  4F6N A;  5IV8 B;  2NUG A;  1HNZ E;  3ZOQ B;  2EOF A;  4HEI A;  2J7J A;  4WXC A;  4JI6 E;  3LLH A;  5IT9 C;  2EPL X;  2F4V E;  2HGH A;  1A1L A;  2L2K B;  1SR9 A;  2ADR A;  3J81 C;  4BC9 A;  2LUQ A;  4F9B B;  4R2C A;  1YPN A;  3F6G A;  2F8B A;  1QNT A;  2V8Q B;  1A1J A;  2V85 A;  1X6E A;  2RSI A;  2EPR A;  2EMY A;  4DV4 E;  4WSP A;  2YRH A;  2EOR A;  2LE2 A;  1GZ6 A;  4BCA A;  1A1K A;  4GZN C;  4M9V C;  3F6H A;  4WSG A;  1N36 E;  1BBG A;  1YSA C;  4DR3 E;  2RS7 A;  2NUF A;  2BBG A;  5AE3 A;  2L6M A;  1X6F A;  2N3G A;  2HHH E;  1T4N A;  1A1G A;  5A2Q C;  4WXD A;  2EOJ A;  4TUI A;  3IWB A;  1FKA E;  3VK6 A;  1PJQ A;  5FLX C;  5LMN E;  1A1I A;  1N3G A;  2M9A A;  2EMX A;  2RSM A;  3ADG A;  1N33 E;  2L3C A;  4Q35 B;  4BS9 A;  2DIX A;  2VRD A;  1A1H A;  4JI5 E;  4O43 A;  5A6B A;  1N32 E;  2EPM X;  3VHT B;  2EQ1 A;  2L3J A;  3VYY A;  1UIL A;  1O0W A;  3L00 A;  4BHC A;  4LU9 A;  4IJD A;  2NA2 A;  1ZAA C;  2WBS A;  2EOY A;  3J80 C;  2LBS B;  2EMH A;  2EMC A;  1KJK A;  2RPC A;  4NXM E;  2M4I A;  2EE8 A;  1ZBT A;  2LMZ A;  5LLQ A;  1N34 E;  1RQ0 A;  1MEY C;  2V87 A;  1A1F A;  4F6M A;  1SFE A;  2ELZ A;  2RQL A;  2A25 A;  4X64 E;  4R2R A;  1TF6 A;  4GKK E;  2LUP B;  2UUC E;  4DKK A;  4DR2 E;  3K6Q A;  2L33 A;  4F9C B;  4X65 E;  3THO B;  1GQE A;  2YZT A;  3C4B A;  2EM7 A;  5LL6 R;  3OML A;  5AAS A;  1IMU A;  1XNQ E;  4DV2 E;  4LF6 E;  1GTK A;  2LRS A;  1YYW A;  1DGC A;  2EP3 A;  2GPI A;  1YYO A;  2YWQ A;  2EOE A;  2KOU A;  2VQF E;  1IBM E;  4R2S A;  1EH8 A;  3J7A G;  5KL7 A;  2ENH A;  3IWC A;  2DMY A;  2YRM A;  1ZU1 A;  3THN A;  2YTO A;  5KL2 A;  1P47 A;  1YUJ A;  2V83 A;  2EOI A;  2EPC A;  4RHB B;  2JXP A;  4LF5 E;  1XNR E;  2PRT A;  2UUB E;  2UU9 E;  2EOO A;  2EMW A;  1T39 A;  1YFH A;  2ENA A;  5A69 A;  3J7Y p;  1G2D C;  2KON A;  2EN8 A;  3EPH A;  5KL4 A;  1IBL E;  2JOB A;  2JVA A;  2E1M A;  2VQE E;  1B69 A;  4L5N C;  2EMF A;  1BBO A;  4DR5 E;  4YY3 E;  4JI0 E;  3ECR A;  5CFF E;  2YSP A;  3MSW A;  3IWD A;  4X66 E;  2EM8 A;  1X49 A;  2EOM A;  4IS1 C;  2EM2 A;  1IQS A;  2WCC 3;  5KL5 A;  2YTQ A;  4DR1 E;  1PJT A;  2YTN A;  2HJJ A;  2CT1 A;  4B3S E;  1I94 E;  4K0K E;  2MDR A;  2YTP A;  2DLK A;  4R2E A;  4GKJ E;  3OTO E;  4JI3 E;  2K7I A;  5AE1 A;  2CTD A;  1EKZ A;  4JI4 E;  4F9A B;  1PKP A;  2LJU A;  4DV7 E;  2L8T A;  4DR6 E;  2EPZ A;  3C6M A;  3ADJ A;  3EQ1 A;  4KHP E;  4F2J C;  1UBD C;  2ELY A;  2EOS A;  3UK3 C;  1YUI A;  5TSE A;  1YZ9 A;  4M30 A;  4B3M E;  2EPU A;  2EWL A;  4HTG A;  5IWA E;  1AH5 A;  2JP9 A;  1T4L B;  1EH7 A;  2JPA A;  4KWY A;  1WRJ A;  2L92 A;  2E5L E;  4LFB E;  1FJG E;  4R2A A;  1WHN A;  2L2M A;  4Q28 A;  5T6J A;  2EPP A;  3M99 B;  4JI1 E;  4LTY A;  2VF1 A;  2EN7 A;  1WHQ A;  2LT7 A;  1HNW E;  2FGG A;  4DUZ E;  2JWO A;  1X6H A;  4KZS A;  1UN6 B;  2E72 A;  5A6K A;  4LF4 E;  2JR1 A;  4NXN E;  2MC5 A;  2Q8U A;  1XMO E;  4DV6 E;  2EL4 A;  4ZYG A;  4O5G A;  3EPJ A;  4JI2 E;  3HPS A;  2EJ4 A;  2EM3 A;  1HR0 E;  2EPN A;  1EH6 A;  5AE2 A;  2B7T A;  4J8Z A;  3BBG A;  2I13 A;  4NHR A;  1X47 A;  2EMI A;  1X3C A;  2GLI A;  3MHS C;  1PDA A;  2EPO A;  2N3H A;  2JYA A;  2UUA E;  4YHH E;  1PJS A;  3JU0 A;  3JAM C;  3H09 A;  2CPN A;  2FV4 B;  2B7V A;  3ADL A;  2V86 A;  2EN6 A; 
#chains in the Genus database with same CATH homology
 1X5W A;  2YSP A;  2YRK A;  2EMK A;  5KL6 A;  2EM4 A;  2EM8 A;  2R1F A;  1A1I A;  2EOM A;  2LCE A;  2M9A A;  4IS1 C;  2EM2 A;  2YTJ A;  2WCC 3;  2EMX A;  5KL5 A;  2CSH A;  2YTQ A;  2GHF A;  1NCS A;  2EQ0 A;  2YTG A;  2YTN A;  2VRD A;  1A1H A;  2DRP A;  2YU5 A;  2CT1 A;  4R2P A;  2EM9 A;  2MKN A;  2EM5 A;  2DLK A;  2YTP A;  1RMD A;  4R2E A;  2WBU A;  1TF3 A;  3VHT B;  2EQ1 A;  2CTD A;  1JK1 A;  2WBT A;  2DLQ A;  2YSO A;  2EPA A;  4IJD A;  1ZAA C;  2WBS A;  2EOY A;  2LVH A;  3EPL A;  2EQ3 A;  2NAB A;  2EMA A;  2EMB A;  5KL3 A;  2EMH A;  2EN3 A;  2EMC A;  2EPZ A;  1KJK A;  2RPC A;  3MHH C;  4F2J C;  1UBD C;  2ELY A;  2EOS A;  2MKD A;  3UK3 C;  1Z1B A;  4FK5 C;  2EE8 A;  2EM6 A;  1YUI A;  2YTE A;  2D9H A;  1G2F C;  2EOQ A;  1MEY C;  1A1F A;  2DGC A;  2EL5 A;  4F6M A;  2ELZ A;  2A25 A;  2EPX A;  4R2R A;  3EPK A;  1TF6 A;  1LLM C;  2EPU A;  2LV2 A;  2EML A;  2JP9 A;  2DMI A;  1JK2 A;  2JPA A;  2EOZ A;  2EL6 A;  1BB8 A;  2EOX A;  2EMZ A;  2EM7 A;  2YTF A;  4R2A A;  1TN9 A;  4X9J A;  2EOH A;  2EPP A;  4F6N A;  3M99 B;  1DGC A;  2EP3 A;  2MDG A;  2YU8 A;  2EOF A;  2J7J A;  2EN7 A;  2EOE A;  2BB8 A;  2ENC A;  4R2S A;  2LT7 A;  2EM0 A;  2HGH A;  1A1L A;  2ADR A;  1X6H A;  5KL7 A;  4R2C A;  1UN6 B;  2LO3 A;  2E72 A;  2ENH A;  4R2Q A;  1F2I G;  1A1J A;  2YRM A;  1ZU1 A;  2YTD A;  2YTO A;  5KL2 A;  1P47 A;  1X6E A;  2EL4 A;  2RSI A;  1YUJ A;  2EPR A;  2EMY A;  2YTI A;  2EOI A;  2EPC A;  2EN2 A;  2EMG A;  2YRH A;  3EPJ A;  2EOR A;  1WJP A;  2EN1 A;  1AAY A;  2EJ4 A;  2EM3 A;  2PRT A;  1A1K A;  4GZN C;  2EOO A;  4R2D A;  4M9V C;  2EMW A;  2EN4 A;  2I13 A;  4WSG A;  2ENA A;  1YSA C;  2EMI A;  1G2D C;  2EN8 A;  1X3C A;  2GLI A;  3EPH A;  3MHS C;  5KL4 A;  1ZR9 A;  1B69 A;  1X6F A;  2EMF A;  1BBO A;  1A1G A;  2EN6 A;  2EOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...