2ADRA

Adr1 dna-binding domain from saccharomyces cerevisiae, nmr, 25 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRAFTRRDLLIRHAQKIHSGNLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A folding transition and novel zinc finger accessory domain in the transcription factor ADR1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulation
molecule keywords ADR1
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1998-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2adrA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2adrA02
2EN8A 1NCSA 2ELZA 2EP3A 2WBTA 1TF6A 4X9JA 5KL6A 2EM8A 1A1FA 2EM9A 2EN2A 1X6HA 2D9HA 2M9AA 1X6EA 2EPRA 2YTPA 2LCEA 2YTNA 4F2JC 5KL7A 1YUIA 2EN1A 3M99B 3MHSC 4IS1C 2EQ1A 2CSHA 1JK1A 1RMDA 2EMXA 4R2CA 4R2QA 2EM0A 1A1IA 2EN7A 2EMYA 4R2RA 2MKDA 2LV2A 2EOQA 1MEYC 2EMCA 2YTDA 2J7JA 2EQ3A 4R2DA 2RSIA 2EL4A 1F2IG 2EOOA 3MHHC 2BB8A 2EOIA 2EM3A 4R2EA 4WSGA 2YSOA 2YRMA 1A1GA 1KJKA 1A1JA 4FK5C 2MDGA 1A1LA 2EMFA 1YUJA 2EMAA 1B69A 2DGCA 2VRDA 2EMZA 1JK2A 1BBOA 2EQ0A 1X3CA 2MKNA 1TN9A 2NABA 2LO3A 3VHTB 1ZAAC 1Z1BA 4M9VC 2EPXA 2EM6A 2EOYA 2YU8A 4F6NA 1A1KA 2YTGA 2HGHA 2DLKA 2EMIA 2EMBA 2EM2A 2YTJA 4R2SA 2JPAA 2YTOA 2EPAA 2EN3A 2YSPA 2EN6A 2WBSA 3EPHA 2EJ4A 2EPUA 2EN4A 1AAYA 2CT1A 2EMKA 1DGCA 1ZU1A 2EMHA 2EOMA 1P47A 2EM4A 2DLQA 1X5WA 2EOJA 2CTDA 3EPLA 2EM5A 2EPZA 2EORA 1ZR9A 2YTIA 4IJDA 4GZNC 1WJPA 5KL4A 1G2FC 2WBUA 1G2DC 1X6FA 2YU5A 1UN6B 2EOSA 1UBDC 2YTEA 2I13A 4R2PA 2R1FA 2ADRA 2ELYA 2YRHA 2EPPA 2EOHA 2EE8A 2EPCA 2YTFA 2EOXA 2ENAA 2LVHA 2JP9A 2GLIA 1A1HA 4R2AA 1LLMC 4F6MA 3EPKA 2EL6A 2ENCA 2EOFA 3EPJA 2E72A 2LT7A 1YSAC 2YTQA 2RPCA 2DRPA 2ENHA 1TF3A 1BB8A 5KL2A 2DMIA 3UK3C 2A25A 2EM7A 2EMWA 5KL3A 2WCC3 2PRTA 2EMGA 2YRKA 2EOZA 2EMLA 2GHFA 2EL5A 5KL5A 2EOEA
chains in the Genus database with same CATH superfamily
2EN8A 5A6JA 4X9JA 2B7VA 1UHZA 3J7AG 3THOB 3AUZA 3JU0A 2EM9A 2JR1A 2M9AA 4F2JC 2YTNA 2FTXB 2IHR1 2EN1A 1J26A 5A69A 3J7Yp 4YY3E 2B7TA 4F9CB 4LF7E 2EM0A 3LMLA 4WX9A 1YPNA 2EMYA 2UXDE 4R2RA 2KHXA 2LV2A 2MKDA 4OX9E 5A6AA 4AQYE 1N33E 2LUQA 2YTDA 2EQ3A 4DR6E 4R2DA 2RSIA 2EL4A 5IXMB 4ZYEA 3F6HA 1F2IG 3MHHC 1EH6A 2EM3A 4R2EA 2YRMA 1A1JA 2I9IA 1A1LA 2EMFA 2EMAA 1B69A 4P7DA 2EQ0A 1X3CA 2MKNA 1TN9A 1ZAAC 3ECRA 4NXME 1QU6A 2EM6A 2YU8A 4K0KE 4GKKE 2HGHA 4DV2E 4YHHE 1BBGA 5IT9C 3L00A 5TSEA 2EJ4A 1AAYA 2EN4A 1QNTA 2CT1A 4DUZE 4LU9A 4P78A 1P47A 3ADLA 3ZOQB 1L4SA 2L33A 4KZSA 2RS6A 2UUBE 2EM5A 2EORA 4GEQB 4L5NC 4X8WA 2G7HA 2EPMX 1HNXE 2M4IA 2YU5A 2ODRC 2DB2A 1UBDC 2YTEA 1N3GA 4R2PA 2R1FA 4JI6E 1EH7A 4DMIA 5LMUE 2YRHA 2EE8A 2EOHA 4LF9E 2V8QB 4MLQA 4RHBB 1T38A 1IQSA 4JI7E 5T6JA 2ENCA 1IBKE 2B3TB 3C6MA 4HTGA 2LJUA 4F54A 4DR7E 3H09A 2M1SA 1X47A 1TF3A 4Q28A 2DMIA 3IWCA 3TQMA 3UK3C 3C6KA 2V86A 3HPZA 4JI1E 4LFCE 2PRTA 2MDRA 4LF5E 2EOZA 3C4BA 2EMLA 3VYYA 2EL5A 3KWRA 4ZYHA 2FGGA 2HHHE 2EP3A 2BBGA 1TF6A 2WBTA 5BR8E 3P1XA 1SR9A 2JY9A 2EM8A 1STUA 1X6HA 2D9HA 3EQ1A 5KL7A 2NUGA 2H36X 1WRJA 4GKJE 4X64E 3J80C 2LTSA 2CSHA 1YYWA 3HXLA 4KWYA 4R2QA 2K7IA 4B3ME 3OMLA 1EKZA 2B9DA 1N36E 2VQEE 4N4RB 2EOOA 4WFTA 2BB8A 2EOIA 3HTXA 4DV7E 2YSOA 1A1GA 1PDAA 2EPNA 2MDGA 4WYQB 2N3HA 1YUJA 2N3GA 1XNQE 1IBME 4O24A 4B3RE 1JK2A 1IQOA 3ADGA 2E5LE 5AASA 5AE2A 2ZM6E 1A1KA 4M0VA 2DLKA 2EMIA 2EMBA 2F8BA 2YTOA 2EN3A 2EPAA 3F6GA 5A2QC 1T4LB 2WBSA 2EPUA 4DV4E 4NZVA 1SFEA 2FV4B 4B3SE 1PJSA 4I8OA 4JI2E 2V89A 1ZR9A 2N8XA 2YTIA 1YFHA 1MGTA 1WHNA 3JAMC 1HNZE 3IWDA 3DF6A 1T39A 4B3TE 2L3JA 5AC5A 2EOSA 2MC5A 2NUEA 2KONA 2V87A 2EPCA 1AH5A 3QG5C 2EOXA 2L6MA 2JP9A 2GLIA 2UXBE 2EPOA 3J81C 2HC5A 2RSMA 3C4TA 4F6MA 2JOXA 2EL6A 2YTQA 2RPCA 4TUGA 1XNRE 5FLXC 1PJQA 5ADZA 4LFBE 4DR2E 2EM7A 4BHCA 2RS7A 4R03A 2E1MA 2EMGA 2MC6A 3T1HE 4JI3E 4MLVA 2UUAE 5KL5A 2EPLX 2EOEA 3KZZA 3BF2A 2GPIA 1IBLE 1RQ0A 2VF1A 5KL6A 4Q35B 1GZ6A 1A1FA 4X65E 2EN2A 2HJJA 1HNWE 4WXCA 1X6EA 2EPRA 4M30A 1YUIA 5DNYA 2EQ1A 4ZYDA 1RC7A 2L2NA 1XMOE 1RMDA 4R2CA 5IV8B 2LMZA 1A1IA 3RMPA 4JI5E 2EZ6A 2EN7A 2JXPA 2UU9E 2DSYA 4JI0E 1ZBQA 2EOQA 3FIGA 1MEYC 2EMCA 1XMQE 4KHPE 1O0WA 4O4KA 4BMJA 4JI8E 1T4NA 4WSGA 4X66E 4FK5C 3HPSA 1GTKA 2VRDA 2EMZA 3VK6A 3DJWA 1BBOA 5LMNE 2LO3A 2Q8UA 1Z1BA 4M9VC 2EPXA 2EOYA 4OOGC 2YTGA 4DV6E 4BS9A 2EM2A 4WPYA 2YSPA 4NXNE 2DIXA 2EN6A 3EPHA 2L8TA 2ODRD 1PKPA 1DGCA 2EOMA 1DI2A 4X62E 2EPZA 2LBSB 4RH8A 3HQ1A 4IJDA 4GZNC 4O5GA 3BBGA 5KL4A 3LLHA 2LUPB 2JOBA 2WBUA 2K4VA 1UN6B 4HEIA 5A6BD 2I13A 5LL6R 2L3CA 4L8NA 2ELYA 4F9BB 4DV1E 2VE7C 2EPPA 2YTFA 1YYOA 2ENAA 2YZTA 2EPKX 2JVAA 2NA2A 1A1HA 3IWBA 4R2AA 2LE2A 1FKAE 1GQEA 3EPKA 4LF4E 2EOFA 3EPJA 1YSAC 4BHBA 3MSWA 4F9AB 5AE3A 4DV0E 4LF6E 2V88A 5AE1A 4DUYE 4ZYGA 2DMYA 1X48A 2R76A 5KL3A 2WCC3 3JTZA 4LFAE 4DR4E 3ADIA 4F6NA 4LTYA 1NCSA 2ELZA 4DR1E 2L2KB 2V85A 5A6KA 2YWQA 4R8OA 4DV3E 5LLQA 2YTPA 1WHQA 2LCEA 1N34E 2F4VE 3M99B 3MHSC 1UILA 4IS1C 4LF8E 3KZYA 1JK1A 2EMXA 2LTRA 4WSPA 4JYAE 5AC4A 2JWOA 2J7JA 2RQLA 3VYXA 1KJKA 1PJTA 1IMUA 1DQ3A 2DGCA 3T1YE 2RTXA 2UUCE 2KOUA 2NABA 3VHTB 1NEIA 3AV0A 2WZOA 2L92A 2EWLA 4DR3E 5CFFE 2YTJA 4NHRA 4R2SA 2JPAA 4DV5E 3ADJA 4TUIA 1YYKA 4BBYA 2EMKA 1ZU1A 2EMHA 4WXDA 2EM4A 2YPNA 2DLQA 1X5WA 2EOJA 2LRSA 2CTDA 1ZBTA 3EPLA 1WJPA 1I94E 2NUFA 1G2FC 1FJGE 4JI4E 1G2DC 4BCAA 2UXCE 1X6FA 3K6QA 2ADRA 2LJHA 4DR5E 2M7QA 1X49A 2VQFE 4JV5E 1EH8A 2JYAA 3BGHA 2LVHA 1N32E 1T4OA 3OTOE 1LLMC 5F3WA 4DKKA 5IWAE 1YZ9A 2E72A 2LT7A 1HR0E 4BC9A 2L2MA 2V83A 2DRPA 2YT4A 2ENHA 1J5EE 1BB8A 3THNA 5KL2A 2A25A 2EMWA 4J8ZA 4BC7A 4O43A 4M2ZA 2CPNA 5A6BA 2YRKA 3BIDA 2GHFA 1KYQA 1WXRA
chains in the Genus database with same CATH topology
2EN8A 1NCSA 2ELZA 2EP3A 2WBTA 1TF6A 4X9JA 5KL6A 2EM8A 1A1FA 2EM9A 2EN2A 1X6HA 2D9HA 2M9AA 1X6EA 2EPRA 2YTPA 2LCEA 2YTNA 4F2JC 5KL7A 1YUIA 2EN1A 3M99B 3MHSC 4IS1C 2EQ1A 2CSHA 1JK1A 1RMDA 2EMXA 4R2CA 4R2QA 2EM0A 1A1IA 2EN7A 2EMYA 4R2RA 2MKDA 2LV2A 2EOQA 1MEYC 2EMCA 2YTDA 2J7JA 2EQ3A 4R2DA 2RSIA 2EL4A 1F2IG 2EOOA 3MHHC 2BB8A 2EOIA 2EM3A 4R2EA 4WSGA 2YSOA 2YRMA 1A1GA 1KJKA 1A1JA 4FK5C 2MDGA 1A1LA 2EMFA 1YUJA 2EMAA 1B69A 2DGCA 2VRDA 2EMZA 1JK2A 1BBOA 2EQ0A 1X3CA 2MKNA 1TN9A 2NABA 2LO3A 3VHTB 1ZAAC 1Z1BA 4M9VC 2EPXA 2EM6A 2EOYA 2YU8A 4F6NA 1A1KA 2YTGA 2HGHA 2DLKA 2EMIA 2EMBA 2EM2A 2YTJA 4R2SA 2JPAA 2YTOA 2EPAA 2EN3A 2YSPA 2EN6A 2WBSA 3EPHA 2EJ4A 2EPUA 2EN4A 1AAYA 2CT1A 2EMKA 1DGCA 1ZU1A 2EMHA 2EOMA 1P47A 2EM4A 2DLQA 1X5WA 2EOJA 2CTDA 3EPLA 2EM5A 2EPZA 2EORA 1ZR9A 2YTIA 4IJDA 4GZNC 1WJPA 5KL4A 1G2FC 2WBUA 1G2DC 1X6FA 2YU5A 1UN6B 2EOSA 1UBDC 2YTEA 2I13A 4R2PA 2R1FA 2ADRA 2ELYA 2YRHA 2EPPA 2EOHA 2EE8A 2EPCA 2YTFA 2EOXA 2ENAA 2LVHA 2JP9A 2GLIA 1A1HA 4R2AA 1LLMC 4F6MA 3EPKA 2EL6A 2ENCA 2EOFA 3EPJA 2E72A 2LT7A 1YSAC 2YTQA 2RPCA 2DRPA 2ENHA 1TF3A 1BB8A 5KL2A 2DMIA 3UK3C 2A25A 2EM7A 2EMWA 5KL3A 2WCC3 2PRTA 2EMGA 2YRKA 2EOZA 2EMLA 2GHFA 2EL5A 5KL5A 2EOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN8 A;  1NCS A;  2ELZ A;  2EP3 A;  2WBT A;  1TF6 A;  4X9J A;  5KL6 A;  2EM8 A;  1A1F A;  2EM9 A;  2EN2 A;  1X6H A;  2D9H A;  2M9A A;  1X6E A;  2EPR A;  2YTP A;  2LCE A;  2YTN A;  4F2J C;  5KL7 A;  1YUI A;  2EN1 A;  3M99 B;  3MHS C;  4IS1 C;  2EQ1 A;  2CSH A;  1JK1 A;  1RMD A;  2EMX A;  4R2C A;  4R2Q A;  2EM0 A;  1A1I A;  2EN7 A;  2EMY A;  4R2R A;  2MKD A;  2LV2 A;  2EOQ A;  1MEY C;  2EMC A;  2YTD A;  2J7J A;  2EQ3 A;  4R2D A;  2RSI A;  2EL4 A;  1F2I G;  2EOO A;  3MHH C;  2BB8 A;  2EOI A;  2EM3 A;  4R2E A;  4WSG A;  2YSO A;  2YRM A;  1A1G A;  1KJK A;  1A1J A;  4FK5 C;  2MDG A;  1A1L A;  2EMF A;  1YUJ A;  2EMA A;  1B69 A;  2DGC A;  2VRD A;  2EMZ A;  1JK2 A;  1BBO A;  2EQ0 A;  1X3C A;  2MKN A;  1TN9 A;  2NAB A;  2LO3 A;  3VHT B;  1ZAA C;  1Z1B A;  4M9V C;  2EPX A;  2EM6 A;  2EOY A;  2YU8 A;  4F6N A;  1A1K A;  2YTG A;  2HGH A;  2DLK A;  2EMI A;  2EMB A;  2EM2 A;  2YTJ A;  4R2S A;  2JPA A;  2YTO A;  2EPA A;  2EN3 A;  2YSP A;  2EN6 A;  2WBS A;  3EPH A;  2EJ4 A;  2EPU A;  2EN4 A;  1AAY A;  2CT1 A;  2EMK A;  1DGC A;  1ZU1 A;  2EMH A;  2EOM A;  1P47 A;  2EM4 A;  2DLQ A;  1X5W A;  2EOJ A;  2CTD A;  3EPL A;  2EM5 A;  2EPZ A;  2EOR A;  1ZR9 A;  2YTI A;  4IJD A;  4GZN C;  1WJP A;  5KL4 A;  1G2F C;  2WBU A;  1G2D C;  1X6F A;  2YU5 A;  1UN6 B;  2EOS A;  1UBD C;  2YTE A;  2I13 A;  4R2P A;  2R1F A;  2ADR A;  2ELY A;  2YRH A;  2EPP A;  2EOH A;  2EE8 A;  2EPC A;  2YTF A;  2EOX A;  2ENA A;  2LVH A;  2JP9 A;  2GLI A;  1A1H A;  4R2A A;  1LLM C;  4F6M A;  3EPK A;  2EL6 A;  2ENC A;  2EOF A;  3EPJ A;  2E72 A;  2LT7 A;  1YSA C;  2YTQ A;  2RPC A;  2DRP A;  2ENH A;  1TF3 A;  1BB8 A;  5KL2 A;  2DMI A;  3UK3 C;  2A25 A;  2EM7 A;  2EMW A;  5KL3 A;  2WCC 3;  2PRT A;  2EMG A;  2YRK A;  2EOZ A;  2EML A;  2GHF A;  2EL5 A;  5KL5 A;  2EOE A; 
#chains in the Genus database with same CATH topology
 2EN8 A;  5A6J A;  4X9J A;  2B7V A;  1UHZ A;  3J7A G;  3THO B;  3AUZ A;  3JU0 A;  2EM9 A;  2JR1 A;  2M9A A;  4F2J C;  2YTN A;  2FTX B;  2IHR 1;  2EN1 A;  1J26 A;  5A69 A;  3J7Y p;  4YY3 E;  2B7T A;  4F9C B;  4LF7 E;  2EM0 A;  3LML A;  4WX9 A;  1YPN A;  2EMY A;  2UXD E;  4R2R A;  2KHX A;  2LV2 A;  2MKD A;  4OX9 E;  5A6A A;  4AQY E;  1N33 E;  2LUQ A;  2YTD A;  2EQ3 A;  4DR6 E;  4R2D A;  2RSI A;  2EL4 A;  5IXM B;  4ZYE A;  3F6H A;  1F2I G;  3MHH C;  1EH6 A;  2EM3 A;  4R2E A;  2YRM A;  1A1J A;  2I9I A;  1A1L A;  2EMF A;  2EMA A;  1B69 A;  4P7D A;  2EQ0 A;  1X3C A;  2MKN A;  1TN9 A;  1ZAA C;  3ECR A;  4NXM E;  1QU6 A;  2EM6 A;  2YU8 A;  4K0K E;  4GKK E;  2HGH A;  4DV2 E;  4YHH E;  1BBG A;  5IT9 C;  3L00 A;  5TSE A;  2EJ4 A;  1AAY A;  2EN4 A;  1QNT A;  2CT1 A;  4DUZ E;  4LU9 A;  4P78 A;  1P47 A;  3ADL A;  3ZOQ B;  1L4S A;  2L33 A;  4KZS A;  2RS6 A;  2UUB E;  2EM5 A;  2EOR A;  4GEQ B;  4L5N C;  4X8W A;  2G7H A;  2EPM X;  1HNX E;  2M4I A;  2YU5 A;  2ODR C;  2DB2 A;  1UBD C;  2YTE A;  1N3G A;  4R2P A;  2R1F A;  4JI6 E;  1EH7 A;  4DMI A;  5LMU E;  2YRH A;  2EE8 A;  2EOH A;  4LF9 E;  2V8Q B;  4MLQ A;  4RHB B;  1T38 A;  1IQS A;  4JI7 E;  5T6J A;  2ENC A;  1IBK E;  2B3T B;  3C6M A;  4HTG A;  2LJU A;  4F54 A;  4DR7 E;  3H09 A;  2M1S A;  1X47 A;  1TF3 A;  4Q28 A;  2DMI A;  3IWC A;  3TQM A;  3UK3 C;  3C6K A;  2V86 A;  3HPZ A;  4JI1 E;  4LFC E;  2PRT A;  2MDR A;  4LF5 E;  2EOZ A;  3C4B A;  2EML A;  3VYY A;  2EL5 A;  3KWR A;  4ZYH A;  2FGG A;  2HHH E;  2EP3 A;  2BBG A;  1TF6 A;  2WBT A;  5BR8 E;  3P1X A;  1SR9 A;  2JY9 A;  2EM8 A;  1STU A;  1X6H A;  2D9H A;  3EQ1 A;  5KL7 A;  2NUG A;  2H36 X;  1WRJ A;  4GKJ E;  4X64 E;  3J80 C;  2LTS A;  2CSH A;  1YYW A;  3HXL A;  4KWY A;  4R2Q A;  2K7I A;  4B3M E;  3OML A;  1EKZ A;  2B9D A;  1N36 E;  2VQE E;  4N4R B;  2EOO A;  4WFT A;  2BB8 A;  2EOI A;  3HTX A;  4DV7 E;  2YSO A;  1A1G A;  1PDA A;  2EPN A;  2MDG A;  4WYQ B;  2N3H A;  1YUJ A;  2N3G A;  1XNQ E;  1IBM E;  4O24 A;  4B3R E;  1JK2 A;  1IQO A;  3ADG A;  2E5L E;  5AAS A;  5AE2 A;  2ZM6 E;  1A1K A;  4M0V A;  2DLK A;  2EMI A;  2EMB A;  2F8B A;  2YTO A;  2EN3 A;  2EPA A;  3F6G A;  5A2Q C;  1T4L B;  2WBS A;  2EPU A;  4DV4 E;  4NZV A;  1SFE A;  2FV4 B;  4B3S E;  1PJS A;  4I8O A;  4JI2 E;  2V89 A;  1ZR9 A;  2N8X A;  2YTI A;  1YFH A;  1MGT A;  1WHN A;  3JAM C;  1HNZ E;  3IWD A;  3DF6 A;  1T39 A;  4B3T E;  2L3J A;  5AC5 A;  2EOS A;  2MC5 A;  2NUE A;  2KON A;  2V87 A;  2EPC A;  1AH5 A;  3QG5 C;  2EOX A;  2L6M A;  2JP9 A;  2GLI A;  2UXB E;  2EPO A;  3J81 C;  2HC5 A;  2RSM A;  3C4T A;  4F6M A;  2JOX A;  2EL6 A;  2YTQ A;  2RPC A;  4TUG A;  1XNR E;  5FLX C;  1PJQ A;  5ADZ A;  4LFB E;  4DR2 E;  2EM7 A;  4BHC A;  2RS7 A;  4R03 A;  2E1M A;  2EMG A;  2MC6 A;  3T1H E;  4JI3 E;  4MLV A;  2UUA E;  5KL5 A;  2EPL X;  2EOE A;  3KZZ A;  3BF2 A;  2GPI A;  1IBL E;  1RQ0 A;  2VF1 A;  5KL6 A;  4Q35 B;  1GZ6 A;  1A1F A;  4X65 E;  2EN2 A;  2HJJ A;  1HNW E;  4WXC A;  1X6E A;  2EPR A;  4M30 A;  1YUI A;  5DNY A;  2EQ1 A;  4ZYD A;  1RC7 A;  2L2N A;  1XMO E;  1RMD A;  4R2C A;  5IV8 B;  2LMZ A;  1A1I A;  3RMP A;  4JI5 E;  2EZ6 A;  2EN7 A;  2JXP A;  2UU9 E;  2DSY A;  4JI0 E;  1ZBQ A;  2EOQ A;  3FIG A;  1MEY C;  2EMC A;  1XMQ E;  4KHP E;  1O0W A;  4O4K A;  4BMJ A;  4JI8 E;  1T4N A;  4WSG A;  4X66 E;  4FK5 C;  3HPS A;  1GTK A;  2VRD A;  2EMZ A;  3VK6 A;  3DJW A;  1BBO A;  5LMN E;  2LO3 A;  2Q8U A;  1Z1B A;  4M9V C;  2EPX A;  2EOY A;  4OOG C;  2YTG A;  4DV6 E;  4BS9 A;  2EM2 A;  4WPY A;  2YSP A;  4NXN E;  2DIX A;  2EN6 A;  3EPH A;  2L8T A;  2ODR D;  1PKP A;  1DGC A;  2EOM A;  1DI2 A;  4X62 E;  2EPZ A;  2LBS B;  4RH8 A;  3HQ1 A;  4IJD A;  4GZN C;  4O5G A;  3BBG A;  5KL4 A;  3LLH A;  2LUP B;  2JOB A;  2WBU A;  2K4V A;  1UN6 B;  4HEI A;  5A6B D;  2I13 A;  5LL6 R;  2L3C A;  4L8N A;  2ELY A;  4F9B B;  4DV1 E;  2VE7 C;  2EPP A;  2YTF A;  1YYO A;  2ENA A;  2YZT A;  2EPK X;  2JVA A;  2NA2 A;  1A1H A;  3IWB A;  4R2A A;  2LE2 A;  1FKA E;  1GQE A;  3EPK A;  4LF4 E;  2EOF A;  3EPJ A;  1YSA C;  4BHB A;  3MSW A;  4F9A B;  5AE3 A;  4DV0 E;  4LF6 E;  2V88 A;  5AE1 A;  4DUY E;  4ZYG A;  2DMY A;  1X48 A;  2R76 A;  5KL3 A;  2WCC 3;  3JTZ A;  4LFA E;  4DR4 E;  3ADI A;  4F6N A;  4LTY A;  1NCS A;  2ELZ A;  4DR1 E;  2L2K B;  2V85 A;  5A6K A;  2YWQ A;  4R8O A;  4DV3 E;  5LLQ A;  2YTP A;  1WHQ A;  2LCE A;  1N34 E;  2F4V E;  3M99 B;  3MHS C;  1UIL A;  4IS1 C;  4LF8 E;  3KZY A;  1JK1 A;  2EMX A;  2LTR A;  4WSP A;  4JYA E;  5AC4 A;  2JWO A;  2J7J A;  2RQL A;  3VYX A;  1KJK A;  1PJT A;  1IMU A;  1DQ3 A;  2DGC A;  3T1Y E;  2RTX A;  2UUC E;  2KOU A;  2NAB A;  3VHT B;  1NEI A;  3AV0 A;  2WZO A;  2L92 A;  2EWL A;  4DR3 E;  5CFF E;  2YTJ A;  4NHR A;  4R2S A;  2JPA A;  4DV5 E;  3ADJ A;  4TUI A;  1YYK A;  4BBY A;  2EMK A;  1ZU1 A;  2EMH A;  4WXD A;  2EM4 A;  2YPN A;  2DLQ A;  1X5W A;  2EOJ A;  2LRS A;  2CTD A;  1ZBT A;  3EPL A;  1WJP A;  1I94 E;  2NUF A;  1G2F C;  1FJG E;  4JI4 E;  1G2D C;  4BCA A;  2UXC E;  1X6F A;  3K6Q A;  2ADR A;  2LJH A;  4DR5 E;  2M7Q A;  1X49 A;  2VQF E;  4JV5 E;  1EH8 A;  2JYA A;  3BGH A;  2LVH A;  1N32 E;  1T4O A;  3OTO E;  1LLM C;  5F3W A;  4DKK A;  5IWA E;  1YZ9 A;  2E72 A;  2LT7 A;  1HR0 E;  4BC9 A;  2L2M A;  2V83 A;  2DRP A;  2YT4 A;  2ENH A;  1J5E E;  1BB8 A;  3THN A;  5KL2 A;  2A25 A;  2EMW A;  4J8Z A;  4BC7 A;  4O43 A;  4M2Z A;  2CPN A;  5A6B A;  2YRK A;  3BID A;  2GHF A;  1KYQ A;  1WXR A; 
#chains in the Genus database with same CATH homology
 2EN8 A;  1NCS A;  2ELZ A;  2EP3 A;  2WBT A;  1TF6 A;  4X9J A;  5KL6 A;  2EM8 A;  1A1F A;  2EM9 A;  2EN2 A;  1X6H A;  2D9H A;  2M9A A;  1X6E A;  2EPR A;  2YTP A;  2LCE A;  2YTN A;  4F2J C;  5KL7 A;  1YUI A;  2EN1 A;  3M99 B;  3MHS C;  4IS1 C;  2EQ1 A;  2CSH A;  1JK1 A;  1RMD A;  2EMX A;  4R2C A;  4R2Q A;  2EM0 A;  1A1I A;  2EN7 A;  2EMY A;  4R2R A;  2MKD A;  2LV2 A;  2EOQ A;  1MEY C;  2EMC A;  2YTD A;  2J7J A;  2EQ3 A;  4R2D A;  2RSI A;  2EL4 A;  1F2I G;  2EOO A;  3MHH C;  2BB8 A;  2EOI A;  2EM3 A;  4R2E A;  4WSG A;  2YSO A;  2YRM A;  1A1G A;  1KJK A;  1A1J A;  4FK5 C;  2MDG A;  1A1L A;  2EMF A;  1YUJ A;  2EMA A;  1B69 A;  2DGC A;  2VRD A;  2EMZ A;  1JK2 A;  1BBO A;  2EQ0 A;  1X3C A;  2MKN A;  1TN9 A;  2NAB A;  2LO3 A;  3VHT B;  1ZAA C;  1Z1B A;  4M9V C;  2EPX A;  2EM6 A;  2EOY A;  2YU8 A;  4F6N A;  1A1K A;  2YTG A;  2HGH A;  2DLK A;  2EMI A;  2EMB A;  2EM2 A;  2YTJ A;  4R2S A;  2JPA A;  2YTO A;  2EPA A;  2EN3 A;  2YSP A;  2EN6 A;  2WBS A;  3EPH A;  2EJ4 A;  2EPU A;  2EN4 A;  1AAY A;  2CT1 A;  2EMK A;  1DGC A;  1ZU1 A;  2EMH A;  2EOM A;  1P47 A;  2EM4 A;  2DLQ A;  1X5W A;  2EOJ A;  2CTD A;  3EPL A;  2EM5 A;  2EPZ A;  2EOR A;  1ZR9 A;  2YTI A;  4IJD A;  4GZN C;  1WJP A;  5KL4 A;  1G2F C;  2WBU A;  1G2D C;  1X6F A;  2YU5 A;  1UN6 B;  2EOS A;  1UBD C;  2YTE A;  2I13 A;  4R2P A;  2R1F A;  2ADR A;  2ELY A;  2YRH A;  2EPP A;  2EOH A;  2EE8 A;  2EPC A;  2YTF A;  2EOX A;  2ENA A;  2LVH A;  2JP9 A;  2GLI A;  1A1H A;  4R2A A;  1LLM C;  4F6M A;  3EPK A;  2EL6 A;  2ENC A;  2EOF A;  3EPJ A;  2E72 A;  2LT7 A;  1YSA C;  2YTQ A;  2RPC A;  2DRP A;  2ENH A;  1TF3 A;  1BB8 A;  5KL2 A;  2DMI A;  3UK3 C;  2A25 A;  2EM7 A;  2EMW A;  5KL3 A;  2WCC 3;  2PRT A;  2EMG A;  2YRK A;  2EOZ A;  2EML A;  2GHF A;  2EL5 A;  5KL5 A;  2EOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...