2ADRA

Adr1 dna-binding domain from saccharomyces cerevisiae, nmr, 25 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRAFTRRDLLIRHAQKIHSGNLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulation
molecule keywords ADR1
publication title A folding transition and novel zinc finger accessory domain in the transcription factor ADR1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1998-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2adrA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2adrA02
4IJDA 1UN6B 4X9JA 4F6NA 1A1GA 1MEYC 1A1FA 2EQ0A 2EM8A 2PRTA 2EMBA 2E72A 1ZU1A 2GLIA 2EN7A 1WJPA 2EOQA 2EM6A 2ADRA 1JK1A 2ENCA 1TF6A 1UBDC 2CSHA 2YTIA 4GZNC 2WBTA 1NCSA 2EN1A 2MKDA 1A1LA 2D9HA 2EM0A 1DGCA 2LCEA 4R2RA 2R1FA 2EMCA 4R2PA 5KL4A 2EM5A 2EPPA 2EPCA 2EOEA 3EPKA 2ENHA 2LT7A 2YTNA 2VRDA 2EMGA 2YSPA 1F2IG 2EPRA 2DLKA 2EMKA 2YRKA 2CT1A 2GHFA 1KJKA 1BB8A 1YUJA 2EL6A 4F2JC 1BBOA 2EPAA 2YTOA 1TN9A 2EPXA 2YU8A 5KL5A 1AAYA 2YTJA 2EM9A 2EMIA 2EOYA 2DGCA 2J7JA 2HGHA 2EN8A 2WBSA 1YUIA 1P47A 4M9VC 2EOMA 1X6EA 1JK2A 2A25A 3EPLA 1YSAC 3EPHA 4R2QA 2EORA 2RPCA 2DLQA 2EMLA 2LO3A 1X3CA 3UK3C 2YU5A 3M99B 2EL5A 2EJ4A 2MKNA 2EM3A 2EMHA 1Z1BA 2EN2A 2EQ1A 3VHTB 1G2FC 1ZR9A 1LLMC 1TF3A 1ZAAC 2YRHA 1A1IA 2WBUA 2YTPA 1X5WA 2YTDA 2YTQA 2EM7A 2LV2A 2EQ3A 5KL3A 2EOFA 1X6FA 2ELYA 2EOJA 2YTGA 5KL2A 2CTDA 1G2DC 2JP9A 1A1HA 2EMAA 2JPAA 2EOSA 3EPJA 2LVHA 2EP3A 2EMZA 4R2EA 2EN3A 2EOZA 2EL4A 4R2AA 2M9AA 2EMWA 4R2SA 2WCC3 4F6MA 1RMDA 2YRMA 2EMYA 2EMXA 2YTEA 2EMFA 2EPUA 4R2DA 2NABA 4R2CA 2EM4A 2YTFA 1B69A 2EOOA 2RSIA 1A1KA 2EN6A 2ENAA 2DRPA 2EN4A 2DMIA 5KL7A 4IS1C 1A1JA 2EOXA 2EOHA 2I13A 4WSGA 1X6HA 5KL6A 2MDGA 4FK5C 2YSOA 3MHSC 2EPZA 2EOIA 2EE8A 2EM2A 2ELZA 2BB8A 3MHHC
chains in the Genus database with same CATH superfamily
4DR2E 4IJDA 3C4BA 4RHBB 3BBGA 1WHNA 2EM8A 3K6QA 2PRTA 4DV5E 1ZU1A 2UXCE 2EOQA 1N36E 3J7Yp 1WXRA 4R2RA 4MLVA 5A6AA 5AE3A 1PKPA 2EPCA 2L2NA 2NA2A 1KYQA 2EPRA 1N32E 2EMKA 1X48A 2MDRA 4KHPE 5A6JA 1KJKA 1BB8A 1YUJA 3HPZA 5A6BA 2KONA 4GEQB 2LJHA 4F2JC 1WHQA 1TN9A 2EPXA 5KL5A 2RQLA 2YTJA 3ZOQB 1FJGE 2EOYA 4B3SE 1T4LB 1O0WA 4M9VC 2EPNA 3TQMA 1J5EE 1YSAC 3EPLA 4F54A 2V88A 2RPCA 3VYXA 3HXLA 3RMPA 1X3CA 2YU5A 3M99B 2EL5A 4I8OA 5AE1A 1UILA 3KZYA 1X49A 5LMUE 1G2FC 2L3JA 2K4VA 4JI1E 1DI2A 2FV4B 5KL3A 2EOFA 2LE2A 4DV6E 1N3GA 1IMUA 2DB2A 5IXMB 2EOSA 4BMJA 4DR7E 5TSEA 3ADGA 4ZYHA 4L8NA 1PDAA 4BBYA 4JI3E 2NUGA 2LTSA 3BF2A 3F6HA 2EL4A 4R2AA 2UU9E 4LF9E 1T38A 3DF6A 2EPOA 2EPUA 1EH6A 4R2DA 3ECRA 2EN6A 2M4IA 4R03A 4KWYA 2V83A 2F8BA 2JYAA 1X6HA 4FK5C 4DKKA 4LFBE 3J7AG 2GPIA 1XMQE 2DIXA 2BB8A 1UN6B 1A1GA 2EQ0A 5AC4A 4ZYEA 1GZ6A 2EMBA 3T1YE 3KWRA 4M30A 2EN7A 1WJPA 3MSWA 1X47A 2EM6A 5AE2A 4DV7E 1UBDC 2YTIA 4GZNC 2NUEA 2MKDA 2D9HA 5F3WA 2M7QA 2UXBE 2EM5A 3J80C 2JWOA 4JI6E 2VRDA 2EMGA 2YSPA 3IWDA 2DLKA 2LRSA 2YRKA 1YYOA 4NHRA 5ADZA 4B3RE 1SR9A 2EL6A 2JXPA 1BBOA 2EPAA 2RS6A 4Q35B 3IWBA 4DR3E 2EMIA 2N8XA 3JU0A 5IWAE 4WFTA 2J7JA 4DMIA 1P47A 1JK2A 2A25A 4AQYE 1STUA 1EH8A 5LMNE 2LO3A 1FKAE 3EQ1A 2UUBE 3THNA 5LL6R 1PJSA 2EQ1A 3VHTB 1ZAAC 1ZR9A 2YRHA 4HTGA 1A1IA 4TUGA 1IBME 4NXNE 1T39A 2DSYA 2ELYA 2LUQA 2EOJA 2YZTA 4OOGC 5CFFE 5KL2A 1YYKA 4GKJE 5AC5A 2UXDE 2VQEE 2MC6A 5A2QC 2LVHA 4DR6E 4DV3E 4JI5E 4DR5E 4BS9A 2EMZA 5IT9C 1HNWE 4M0VA 1XNQE 1YYWA 1UHZA 4LFAE 2M9AA 2E1MA 2VE7C 4GKKE 2EMYA 2YTEA 2EMFA 2JR1A 1NEIA 2LMZA 4LF8E 4X66E 2YTFA 1A1KA 2ODRD 1IQSA 2E5LE 2JY9A 4YHHE 2HHHE 4WSGA 2L2MA 4OX9E 2YSOA 3MHSC 2EOIA 2CPNA 4LFCE 2EE8A 3VYYA 2EM2A 2DGCA 3L00A 5A69A 4X9JA 3BGHA 1MEYC 1A1FA 2EPLX 2B7TA 4DR4E 4LF4E 1IQOA 1SFEA 2E72A 1L4SA 2B7VA 2ADRA 3IWCA 1IBKE 2F4VE 4DV4E 1TF6A 1N34E 4WXDA 2L33A 4RH8A 3T1HE 2WBTA 2JVAA 2MC5A 2N3HA 2YT4A 4F9BB 2EM0A 2EZ6A 2EPMX 3VK6A 2EMCA 4R2PA 1BBGA 3KZZA 4JYAE 2EPPA 4WPYA 3EPKA 4M2ZA 4O5GA 2LT7A 2YTNA 5LLQA 1PJQA 4P7DA 4ZYGA 1RC7A 3C6MA 4HEIA 1RQ0A 4R8OA 3ADLA 4P78A 4N4RB 4JI2E 2EM9A 2L6MA 4WXCA 4DUYE 4YY3E 2H36X 3FIGA 2VQFE 2JOBA 2WBSA 4K0KE 2N3GA 1HR0E 2EOMA 3ADJA 1QU6A 1X6EA 4R2QA 2JOXA 4B3TE 2RSMA 1IBLE 2Q8UA 4X62E 2EJ4A 1GTKA 2EM3A 4DV2E 5IV8B 4LF6E 4Q28A 2EN2A 5BR8E 2EWLA 1LLMC 5A6BD 2YTPA 1DQ3A 2YTDA 4JI7E 5A6KA 2EM7A 5DNYA 1X6FA 2CTDA 4WYQB 4BC9A 4X8WA 2UUAE 3ADIA 3EPJA 2LJUA 2EP3A 2ZM6E 1I94E 4R2EA 4DUZE 2EN3A 4LTYA 2L92A 2EMWA 2LUPB 3LMLA 4F6MA 1RMDA 2YRMA 4F9CB 1YPNA 2HC5A 2EMXA 2B3TB 4MLQA 3HQ1A 1EH7A 2EM4A 2RSIA 3HPSA 4LF7E 5AASA 1J26A 1MGTA 2DRPA 2EN4A 2DMIA 2EOHA 2YPNA 4J8ZA 2FTXB 4L5NC 2EPZA 3JAMC 1GQEA 4O43A 2YTOA 2ELZA 3MHHC 4F6NA 1T4NA 3OTOE 4LU9A 2GLIA 1JK1A 2L8TA 2ENCA 4BHCA 1HNXE 2CSHA 2M1SA 1NCSA 1YFHA 2UUCE 2EN1A 3HTXA 2LBSB 1A1LA 1DGCA 2LCEA 3H09A 4DV1E 4JI0E 2R1FA 2V85A 4ZYDA 2G7HA 3QG5C 5KL4A 3DJWA 1EKZA 1HNZE 2EOEA 1T4OA 2ENHA 3OMLA 1F2IG 2L3CA 2L2KB 2R76A 3BIDA 2CT1A 2EPKX 2GHFA 2IHR1 2FGGA 4JV5E 2I9IA 2KOUA 3P1XA 2YU8A 1AAYA 2HJJA 2BBGA 1ZBTA 2HGHA 2EN8A 1YUIA 1XNRE 3EPHA 2EORA 2WZOA 2LTRA 2YWQA 2DLQA 2EMLA 3UK3C 2B9DA 2DMYA 1PJTA 4WSPA 4DR1E 2EMHA 2NUFA 3F6GA 1Z1BA 1XMOE 4BCAA 2MKNA 4JI4E 2ODRC 3AUZA 1TF3A 2WBUA 4B3ME 2V86A 1X5WA 3C6KA 1QNTA 4LF5E 2YTQA 4X64E 2LV2A 3C4TA 2EQ3A 2YTGA 4BHBA 1G2DC 1YZ9A 2JP9A 1A1HA 2EMAA 2V8QB 3LLHA 2JPAA 4NXME 5T6JA 2V87A 4KZSA 2EOZA 4R2SA 4WX9A 2WCC3 1AH5A 4X65E 1ZBQA 3JTZA 4JI8E 2NABA 4NZVA 1B69A 2EOOA 2ENAA 2RS7A 4BC7A 5KL7A 4IS1C 4TUIA 1A1JA 1N33E 1WRJA 2EOXA 2I13A 2K7IA 4F9AB 3THOB 2KHXA 2RTXA 3AV0A 2V89A 3J81C 4DV0E 5KL6A 2MDGA 4O4KA 5FLXC 2VF1A 4O24A 4R2CA
chains in the Genus database with same CATH topology
4IJDA 1UN6B 4X9JA 4F6NA 1A1GA 1MEYC 1A1FA 2EQ0A 2EM8A 2PRTA 2EMBA 2E72A 1ZU1A 2GLIA 2EN7A 1WJPA 2EOQA 2EM6A 2ADRA 1JK1A 2ENCA 1TF6A 1UBDC 2CSHA 2YTIA 4GZNC 2WBTA 1NCSA 2EN1A 2MKDA 1A1LA 2D9HA 2EM0A 1DGCA 2LCEA 4R2RA 2R1FA 2EMCA 4R2PA 5KL4A 2EM5A 2EPPA 2EPCA 2EOEA 3EPKA 2ENHA 2LT7A 2YTNA 2VRDA 2EMGA 2YSPA 1F2IG 2EPRA 2DLKA 2EMKA 2YRKA 2CT1A 2GHFA 1KJKA 1BB8A 1YUJA 2EL6A 4F2JC 1BBOA 2EPAA 2YTOA 1TN9A 2EPXA 2YU8A 5KL5A 1AAYA 2YTJA 2EM9A 2EMIA 2EOYA 2DGCA 2J7JA 2HGHA 2EN8A 2WBSA 1YUIA 1P47A 4M9VC 2EOMA 1X6EA 1JK2A 2A25A 3EPLA 1YSAC 3EPHA 4R2QA 2EORA 2RPCA 2DLQA 2EMLA 2LO3A 1X3CA 3UK3C 2YU5A 3M99B 2EL5A 2EJ4A 2MKNA 2EM3A 2EMHA 1Z1BA 2EN2A 2EQ1A 3VHTB 1G2FC 1ZR9A 1LLMC 1TF3A 1ZAAC 2YRHA 1A1IA 2WBUA 2YTPA 1X5WA 2YTDA 2YTQA 2EM7A 2LV2A 2EQ3A 5KL3A 2EOFA 1X6FA 2ELYA 2EOJA 2YTGA 5KL2A 2CTDA 1G2DC 2JP9A 1A1HA 2EMAA 2JPAA 2EOSA 3EPJA 2LVHA 2EP3A 2EMZA 4R2EA 2EN3A 2EOZA 2EL4A 4R2AA 2M9AA 2EMWA 4R2SA 2WCC3 4F6MA 1RMDA 2YRMA 2EMYA 2EMXA 2YTEA 2EMFA 2EPUA 4R2DA 2NABA 4R2CA 2EM4A 2YTFA 1B69A 2EOOA 2RSIA 1A1KA 2EN6A 2ENAA 2DRPA 2EN4A 2DMIA 5KL7A 4IS1C 1A1JA 2EOXA 2EOHA 2I13A 4WSGA 1X6HA 5KL6A 2MDGA 4FK5C 2YSOA 3MHSC 2EPZA 2EOIA 2EE8A 2EM2A 2ELZA 2BB8A 3MHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  1UN6 B;  4X9J A;  4F6N A;  1A1G A;  1MEY C;  1A1F A;  2EQ0 A;  2EM8 A;  2PRT A;  2EMB A;  2E72 A;  1ZU1 A;  2GLI A;  2EN7 A;  1WJP A;  2EOQ A;  2EM6 A;  2ADR A;  1JK1 A;  2ENC A;  1TF6 A;  1UBD C;  2CSH A;  2YTI A;  4GZN C;  2WBT A;  1NCS A;  2EN1 A;  2MKD A;  1A1L A;  2D9H A;  2EM0 A;  1DGC A;  2LCE A;  4R2R A;  2R1F A;  2EMC A;  4R2P A;  5KL4 A;  2EM5 A;  2EPP A;  2EPC A;  2EOE A;  3EPK A;  2ENH A;  2LT7 A;  2YTN A;  2VRD A;  2EMG A;  2YSP A;  1F2I G;  2EPR A;  2DLK A;  2EMK A;  2YRK A;  2CT1 A;  2GHF A;  1KJK A;  1BB8 A;  1YUJ A;  2EL6 A;  4F2J C;  1BBO A;  2EPA A;  2YTO A;  1TN9 A;  2EPX A;  2YU8 A;  5KL5 A;  1AAY A;  2YTJ A;  2EM9 A;  2EMI A;  2EOY A;  2DGC A;  2J7J A;  2HGH A;  2EN8 A;  2WBS A;  1YUI A;  1P47 A;  4M9V C;  2EOM A;  1X6E A;  1JK2 A;  2A25 A;  3EPL A;  1YSA C;  3EPH A;  4R2Q A;  2EOR A;  2RPC A;  2DLQ A;  2EML A;  2LO3 A;  1X3C A;  3UK3 C;  2YU5 A;  3M99 B;  2EL5 A;  2EJ4 A;  2MKN A;  2EM3 A;  2EMH A;  1Z1B A;  2EN2 A;  2EQ1 A;  3VHT B;  1G2F C;  1ZR9 A;  1LLM C;  1TF3 A;  1ZAA C;  2YRH A;  1A1I A;  2WBU A;  2YTP A;  1X5W A;  2YTD A;  2YTQ A;  2EM7 A;  2LV2 A;  2EQ3 A;  5KL3 A;  2EOF A;  1X6F A;  2ELY A;  2EOJ A;  2YTG A;  5KL2 A;  2CTD A;  1G2D C;  2JP9 A;  1A1H A;  2EMA A;  2JPA A;  2EOS A;  3EPJ A;  2LVH A;  2EP3 A;  2EMZ A;  4R2E A;  2EN3 A;  2EOZ A;  2EL4 A;  4R2A A;  2M9A A;  2EMW A;  4R2S A;  2WCC 3;  4F6M A;  1RMD A;  2YRM A;  2EMY A;  2EMX A;  2YTE A;  2EMF A;  2EPU A;  4R2D A;  2NAB A;  4R2C A;  2EM4 A;  2YTF A;  1B69 A;  2EOO A;  2RSI A;  1A1K A;  2EN6 A;  2ENA A;  2DRP A;  2EN4 A;  2DMI A;  5KL7 A;  4IS1 C;  1A1J A;  2EOX A;  2EOH A;  2I13 A;  4WSG A;  1X6H A;  5KL6 A;  2MDG A;  4FK5 C;  2YSO A;  3MHS C;  2EPZ A;  2EOI A;  2EE8 A;  2EM2 A;  2ELZ A;  2BB8 A;  3MHH C; 
#chains in the Genus database with same CATH topology
 4DR2 E;  4IJD A;  3C4B A;  4RHB B;  3BBG A;  1WHN A;  2EM8 A;  3K6Q A;  2PRT A;  4DV5 E;  1ZU1 A;  2UXC E;  2EOQ A;  1N36 E;  3J7Y p;  1WXR A;  4R2R A;  4MLV A;  5A6A A;  5AE3 A;  1PKP A;  2EPC A;  2L2N A;  2NA2 A;  1KYQ A;  2EPR A;  1N32 E;  2EMK A;  1X48 A;  2MDR A;  4KHP E;  5A6J A;  1KJK A;  1BB8 A;  1YUJ A;  3HPZ A;  5A6B A;  2KON A;  4GEQ B;  2LJH A;  4F2J C;  1WHQ A;  1TN9 A;  2EPX A;  5KL5 A;  2RQL A;  2YTJ A;  3ZOQ B;  1FJG E;  2EOY A;  4B3S E;  1T4L B;  1O0W A;  4M9V C;  2EPN A;  3TQM A;  1J5E E;  1YSA C;  3EPL A;  4F54 A;  2V88 A;  2RPC A;  3VYX A;  3HXL A;  3RMP A;  1X3C A;  2YU5 A;  3M99 B;  2EL5 A;  4I8O A;  5AE1 A;  1UIL A;  3KZY A;  1X49 A;  5LMU E;  1G2F C;  2L3J A;  2K4V A;  4JI1 E;  1DI2 A;  2FV4 B;  5KL3 A;  2EOF A;  2LE2 A;  4DV6 E;  1N3G A;  1IMU A;  2DB2 A;  5IXM B;  2EOS A;  4BMJ A;  4DR7 E;  5TSE A;  3ADG A;  4ZYH A;  4L8N A;  1PDA A;  4BBY A;  4JI3 E;  2NUG A;  2LTS A;  3BF2 A;  3F6H A;  2EL4 A;  4R2A A;  2UU9 E;  4LF9 E;  1T38 A;  3DF6 A;  2EPO A;  2EPU A;  1EH6 A;  4R2D A;  3ECR A;  2EN6 A;  2M4I A;  4R03 A;  4KWY A;  2V83 A;  2F8B A;  2JYA A;  1X6H A;  4FK5 C;  4DKK A;  4LFB E;  3J7A G;  2GPI A;  1XMQ E;  2DIX A;  2BB8 A;  1UN6 B;  1A1G A;  2EQ0 A;  5AC4 A;  4ZYE A;  1GZ6 A;  2EMB A;  3T1Y E;  3KWR A;  4M30 A;  2EN7 A;  1WJP A;  3MSW A;  1X47 A;  2EM6 A;  5AE2 A;  4DV7 E;  1UBD C;  2YTI A;  4GZN C;  2NUE A;  2MKD A;  2D9H A;  5F3W A;  2M7Q A;  2UXB E;  2EM5 A;  3J80 C;  2JWO A;  4JI6 E;  2VRD A;  2EMG A;  2YSP A;  3IWD A;  2DLK A;  2LRS A;  2YRK A;  1YYO A;  4NHR A;  5ADZ A;  4B3R E;  1SR9 A;  2EL6 A;  2JXP A;  1BBO A;  2EPA A;  2RS6 A;  4Q35 B;  3IWB A;  4DR3 E;  2EMI A;  2N8X A;  3JU0 A;  5IWA E;  4WFT A;  2J7J A;  4DMI A;  1P47 A;  1JK2 A;  2A25 A;  4AQY E;  1STU A;  1EH8 A;  5LMN E;  2LO3 A;  1FKA E;  3EQ1 A;  2UUB E;  3THN A;  5LL6 R;  1PJS A;  2EQ1 A;  3VHT B;  1ZAA C;  1ZR9 A;  2YRH A;  4HTG A;  1A1I A;  4TUG A;  1IBM E;  4NXN E;  1T39 A;  2DSY A;  2ELY A;  2LUQ A;  2EOJ A;  2YZT A;  4OOG C;  5CFF E;  5KL2 A;  1YYK A;  4GKJ E;  5AC5 A;  2UXD E;  2VQE E;  2MC6 A;  5A2Q C;  2LVH A;  4DR6 E;  4DV3 E;  4JI5 E;  4DR5 E;  4BS9 A;  2EMZ A;  5IT9 C;  1HNW E;  4M0V A;  1XNQ E;  1YYW A;  1UHZ A;  4LFA E;  2M9A A;  2E1M A;  2VE7 C;  4GKK E;  2EMY A;  2YTE A;  2EMF A;  2JR1 A;  1NEI A;  2LMZ A;  4LF8 E;  4X66 E;  2YTF A;  1A1K A;  2ODR D;  1IQS A;  2E5L E;  2JY9 A;  4YHH E;  2HHH E;  4WSG A;  2L2M A;  4OX9 E;  2YSO A;  3MHS C;  2EOI A;  2CPN A;  4LFC E;  2EE8 A;  3VYY A;  2EM2 A;  2DGC A;  3L00 A;  5A69 A;  4X9J A;  3BGH A;  1MEY C;  1A1F A;  2EPL X;  2B7T A;  4DR4 E;  4LF4 E;  1IQO A;  1SFE A;  2E72 A;  1L4S A;  2B7V A;  2ADR A;  3IWC A;  1IBK E;  2F4V E;  4DV4 E;  1TF6 A;  1N34 E;  4WXD A;  2L33 A;  4RH8 A;  3T1H E;  2WBT A;  2JVA A;  2MC5 A;  2N3H A;  2YT4 A;  4F9B B;  2EM0 A;  2EZ6 A;  2EPM X;  3VK6 A;  2EMC A;  4R2P A;  1BBG A;  3KZZ A;  4JYA E;  2EPP A;  4WPY A;  3EPK A;  4M2Z A;  4O5G A;  2LT7 A;  2YTN A;  5LLQ A;  1PJQ A;  4P7D A;  4ZYG A;  1RC7 A;  3C6M A;  4HEI A;  1RQ0 A;  4R8O A;  3ADL A;  4P78 A;  4N4R B;  4JI2 E;  2EM9 A;  2L6M A;  4WXC A;  4DUY E;  4YY3 E;  2H36 X;  3FIG A;  2VQF E;  2JOB A;  2WBS A;  4K0K E;  2N3G A;  1HR0 E;  2EOM A;  3ADJ A;  1QU6 A;  1X6E A;  4R2Q A;  2JOX A;  4B3T E;  2RSM A;  1IBL E;  2Q8U A;  4X62 E;  2EJ4 A;  1GTK A;  2EM3 A;  4DV2 E;  5IV8 B;  4LF6 E;  4Q28 A;  2EN2 A;  5BR8 E;  2EWL A;  1LLM C;  5A6B D;  2YTP A;  1DQ3 A;  2YTD A;  4JI7 E;  5A6K A;  2EM7 A;  5DNY A;  1X6F A;  2CTD A;  4WYQ B;  4BC9 A;  4X8W A;  2UUA E;  3ADI A;  3EPJ A;  2LJU A;  2EP3 A;  2ZM6 E;  1I94 E;  4R2E A;  4DUZ E;  2EN3 A;  4LTY A;  2L92 A;  2EMW A;  2LUP B;  3LML A;  4F6M A;  1RMD A;  2YRM A;  4F9C B;  1YPN A;  2HC5 A;  2EMX A;  2B3T B;  4MLQ A;  3HQ1 A;  1EH7 A;  2EM4 A;  2RSI A;  3HPS A;  4LF7 E;  5AAS A;  1J26 A;  1MGT A;  2DRP A;  2EN4 A;  2DMI A;  2EOH A;  2YPN A;  4J8Z A;  2FTX B;  4L5N C;  2EPZ A;  3JAM C;  1GQE A;  4O43 A;  2YTO A;  2ELZ A;  3MHH C;  4F6N A;  1T4N A;  3OTO E;  4LU9 A;  2GLI A;  1JK1 A;  2L8T A;  2ENC A;  4BHC A;  1HNX E;  2CSH A;  2M1S A;  1NCS A;  1YFH A;  2UUC E;  2EN1 A;  3HTX A;  2LBS B;  1A1L A;  1DGC A;  2LCE A;  3H09 A;  4DV1 E;  4JI0 E;  2R1F A;  2V85 A;  4ZYD A;  2G7H A;  3QG5 C;  5KL4 A;  3DJW A;  1EKZ A;  1HNZ E;  2EOE A;  1T4O A;  2ENH A;  3OML A;  1F2I G;  2L3C A;  2L2K B;  2R76 A;  3BID A;  2CT1 A;  2EPK X;  2GHF A;  2IHR 1;  2FGG A;  4JV5 E;  2I9I A;  2KOU A;  3P1X A;  2YU8 A;  1AAY A;  2HJJ A;  2BBG A;  1ZBT A;  2HGH A;  2EN8 A;  1YUI A;  1XNR E;  3EPH A;  2EOR A;  2WZO A;  2LTR A;  2YWQ A;  2DLQ A;  2EML A;  3UK3 C;  2B9D A;  2DMY A;  1PJT A;  4WSP A;  4DR1 E;  2EMH A;  2NUF A;  3F6G A;  1Z1B A;  1XMO E;  4BCA A;  2MKN A;  4JI4 E;  2ODR C;  3AUZ A;  1TF3 A;  2WBU A;  4B3M E;  2V86 A;  1X5W A;  3C6K A;  1QNT A;  4LF5 E;  2YTQ A;  4X64 E;  2LV2 A;  3C4T A;  2EQ3 A;  2YTG A;  4BHB A;  1G2D C;  1YZ9 A;  2JP9 A;  1A1H A;  2EMA A;  2V8Q B;  3LLH A;  2JPA A;  4NXM E;  5T6J A;  2V87 A;  4KZS A;  2EOZ A;  4R2S A;  4WX9 A;  2WCC 3;  1AH5 A;  4X65 E;  1ZBQ A;  3JTZ A;  4JI8 E;  2NAB A;  4NZV A;  1B69 A;  2EOO A;  2ENA A;  2RS7 A;  4BC7 A;  5KL7 A;  4IS1 C;  4TUI A;  1A1J A;  1N33 E;  1WRJ A;  2EOX A;  2I13 A;  2K7I A;  4F9A B;  3THO B;  2KHX A;  2RTX A;  3AV0 A;  2V89 A;  3J81 C;  4DV0 E;  5KL6 A;  2MDG A;  4O4K A;  5FLX C;  2VF1 A;  4O24 A;  4R2C A; 
#chains in the Genus database with same CATH homology
 4IJD A;  1UN6 B;  4X9J A;  4F6N A;  1A1G A;  1MEY C;  1A1F A;  2EQ0 A;  2EM8 A;  2PRT A;  2EMB A;  2E72 A;  1ZU1 A;  2GLI A;  2EN7 A;  1WJP A;  2EOQ A;  2EM6 A;  2ADR A;  1JK1 A;  2ENC A;  1TF6 A;  1UBD C;  2CSH A;  2YTI A;  4GZN C;  2WBT A;  1NCS A;  2EN1 A;  2MKD A;  1A1L A;  2D9H A;  2EM0 A;  1DGC A;  2LCE A;  4R2R A;  2R1F A;  2EMC A;  4R2P A;  5KL4 A;  2EM5 A;  2EPP A;  2EPC A;  2EOE A;  3EPK A;  2ENH A;  2LT7 A;  2YTN A;  2VRD A;  2EMG A;  2YSP A;  1F2I G;  2EPR A;  2DLK A;  2EMK A;  2YRK A;  2CT1 A;  2GHF A;  1KJK A;  1BB8 A;  1YUJ A;  2EL6 A;  4F2J C;  1BBO A;  2EPA A;  2YTO A;  1TN9 A;  2EPX A;  2YU8 A;  5KL5 A;  1AAY A;  2YTJ A;  2EM9 A;  2EMI A;  2EOY A;  2DGC A;  2J7J A;  2HGH A;  2EN8 A;  2WBS A;  1YUI A;  1P47 A;  4M9V C;  2EOM A;  1X6E A;  1JK2 A;  2A25 A;  3EPL A;  1YSA C;  3EPH A;  4R2Q A;  2EOR A;  2RPC A;  2DLQ A;  2EML A;  2LO3 A;  1X3C A;  3UK3 C;  2YU5 A;  3M99 B;  2EL5 A;  2EJ4 A;  2MKN A;  2EM3 A;  2EMH A;  1Z1B A;  2EN2 A;  2EQ1 A;  3VHT B;  1G2F C;  1ZR9 A;  1LLM C;  1TF3 A;  1ZAA C;  2YRH A;  1A1I A;  2WBU A;  2YTP A;  1X5W A;  2YTD A;  2YTQ A;  2EM7 A;  2LV2 A;  2EQ3 A;  5KL3 A;  2EOF A;  1X6F A;  2ELY A;  2EOJ A;  2YTG A;  5KL2 A;  2CTD A;  1G2D C;  2JP9 A;  1A1H A;  2EMA A;  2JPA A;  2EOS A;  3EPJ A;  2LVH A;  2EP3 A;  2EMZ A;  4R2E A;  2EN3 A;  2EOZ A;  2EL4 A;  4R2A A;  2M9A A;  2EMW A;  4R2S A;  2WCC 3;  4F6M A;  1RMD A;  2YRM A;  2EMY A;  2EMX A;  2YTE A;  2EMF A;  2EPU A;  4R2D A;  2NAB A;  4R2C A;  2EM4 A;  2YTF A;  1B69 A;  2EOO A;  2RSI A;  1A1K A;  2EN6 A;  2ENA A;  2DRP A;  2EN4 A;  2DMI A;  5KL7 A;  4IS1 C;  1A1J A;  2EOX A;  2EOH A;  2I13 A;  4WSG A;  1X6H A;  5KL6 A;  2MDG A;  4FK5 C;  2YSO A;  3MHS C;  2EPZ A;  2EOI A;  2EE8 A;  2EM2 A;  2ELZ A;  2BB8 A;  3MHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...