2V8QB

Crystal structure of the regulatory fragment of mammalian ampk in complexes with amp
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
83
structure length
73
Chain Sequence
GQEMYAFRSEERFKSPPILPPHLLQVILNKDTNPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 5
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.760 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v8qB00
2V8QB
chains in the Genus database with same CATH superfamily
4R2PA 2V83A 1RC7A 1UBDC 4DV0E 4LU9A 4NXNE 1JK1A 2EZ6A 1NEIA 2FTXB 2YTFA 1Z1BA 2LMZA 2L3CA 5KL5A 2EMXA 4P78A 5A6KA 4M9VC 2RPCA 2EN6A 4LF7E 4B3ME 4LFCE 2EN2A 4MLVA 2EMLA 4AQYE 2DGCA 2EPUA 2EN4A 2HHHE 2B3TB 5KL7A 1A1FA 2UUBE 3EPLA 5A6BA 1TN9A 2DMYA 4JI8E 2ELZA 2GPIA 2BB8A 3K6QA 3JU0A 2FGGA 4BHBA 3AV0A 2ENHA 2DB2A 2RQLA 3HTXA 4RH8A 1ZBTA 1X6EA 4JI1E 3VYYA 4GEQB 4HEIA 3C4BA 4B3RE 2WZOA 5LL6R 4WX9A 2YT4A 5A69A 3IWBA 3HXLA 3F6HA 2RS7A 2ENCA 5A2QC 3H09A 3JAMC 4TUIA 3J7Yp 4JV5E 5AC4A 4X9JA 2MC6A 4R2QA 1EH8A 3C4TA 2NUEA 4LFAE 2YPNA 3MSWA 3ADLA 2DRPA 4BMJA 2UUAE 5AE1A 2GHFA 4B3SE 2N8XA 1HR0E 2EN7A 3IWCA 4WXDA 2F4VE 2EL5A 1A1IA 1XNQE 2EOXA 2LJUA 2RS6A 2EORA 1IBME 2UU9E 3T1YE 3AUZA 2EPKX 1BBGA 3F6GA 2DLQA 2LBSB 3HQ1A 5T6JA 1T39A 2YTJA 5BR8E 4X62E 4B3TE 4DR6E 4DR2E 2M7QA 1LLMC 4I8OA 1YFHA 1GQEA 2KHXA 4JI5E 1WHNA 4F9AB 5FLXC 2RTXA 2V85A 2EMZA 1L4SA 2JYAA 2K4VA 1TF3A 3OTOE 2LTRA 1X47A 2RSMA 1BB8A 1UHZA 2EPMX 2EL4A 3EQ1A 1J5EE 3KWRA 5AE2A 2V88A 2L3JA 1YYKA 4JYAE 5F3WA 4GZNC 5KL6A 1EH7A 2MKDA 4M0VA 4WYQB 4J8ZA 2EMIA 2EWLA 2I9IA 4R2EA 2NA2A 2EOOA 1YPNA 2YTNA 4LFBE 4R2DA 4JI2E 1MGTA 1RQ0A 3P1XA 2L2KB 2DLKA 2E5LE 3RMPA 3VK6A 5A6BD 2UXDE 2YZTA 2YRHA 3VHTB 1T4OA 2EM2A 4X65E 2MDGA 2NABA 2JOBA 4F6MA 2EMKA 2EM3A 2YTEA 3MHSC 5LMNE 4BCAA 2L2MA 2EPLX 1HNWE 4BC7A 4BS9A 2MDRA 1RMDA 2UXCE 4DV3E 1KYQA 1GZ6A 1IMUA 2JXPA 1A1LA 5KL2A 2EPZA 4DR1E 2EM5A 2WCC3 4KHPE 1A1GA 5IXMB 2EM9A 2EMGA 3FIGA 1XNRE 2B9DA 1ZBQA 1NCSA 4FK5C 2ELYA 1UILA 5AASA 2NUGA 2E72A 2M1SA 2D9HA 2YTIA 3J80C 5AC5A 1EH6A 2F8BA 1A1JA 3QG5C 5CFFE 2HJJA 2JVAA 4F9CB 4YY3E 3J81C 4DV1E 2ADRA 4WSPA 4Q35B 4F9BB 1YUJA 3ZOQB 2EOSA 1ZR9A 5A6JA 2JPAA 2EOQA 4JI0E 2EOFA 1T4NA 2PRTA 2ODRC 4WPYA 4NXME 2EMCA 4BC9A 2R76A 2RSIA 3KZYA 2EPXA 1JK2A 4JI7E 3L00A 2LCEA 2LE2A 2YTOA 1QU6A 2EPPA 2V8QB 1F2IG 1SR9A 2EPOA 4DR5E 1X6HA 2M4IA 5TSEA 2EPCA 3JTZA 2HC5A 5ADZA 2EOIA 5LMUE 4R2AA 1AH5A 3HPZA 4L8NA 2GLIA 1HNXE 2EOEA 2EOZA 4YHHE 5A6AA 1YZ9A 4WXCA 2B7VA 2JOXA 2ZM6E 4KWYA 2L6MA 1GTKA 5KL4A 1X49A 2LV2A 4IS1C 4X8WA 4F6NA 1I94E 1YYWA 1N3GA 5IWAE 5KL3A 1PDAA 3MHHC 2L8TA 5LLQA 3IWDA 4WFTA 4M30A 4O4KA 1AAYA 2DIXA 4TUGA 3EPJA 2JY9A 2EPNA 4M2ZA 3ADJA 3BIDA 2A25A 4HTGA 5AE3A 2CSHA 4BHCA 1KJKA 2NUFA 2EMAA 1YUIA 2R1FA 4DMIA 4LF4E 2YTGA 2YTPA 1N32E 2EM4A 4P7DA 2BBGA 4F2JC 2LUPB 2EMYA 4DR4E 1PKPA 2CPNA 3TQMA 4DV5E 2LRSA 1MEYC 1EKZA 2YWQA 1YSAC 2EM6A 2V86A 1STUA 1WXRA 4NHRA 2EOJA 2JWOA 4K0KE 2EQ3A 2DSYA 3LMLA 2YSPA 1IQOA 3THOB 4X64E 2JP9A 2WBSA 4BBYA 1WJPA 2EMBA 3C6MA 2K7IA 2YU8A 5IV8B 4OX9E 1PJSA 2LO3A 2MKNA 1A1HA 1IBLE 2B7TA 3BGHA 2EPRA 4OOGC 4DR7E 1FJGE 4DV2E 3J7AG 2E1MA 4O5GA 4R8OA 4F54A 4LTYA 2LVHA 1ZAAC 2EOHA 1YYOA 4LF8E 4LF5E 3C6KA 2VF1A 2EMHA 4Q28A 2UXBE 4R03A 2V89A 3LLHA 3THNA 2EJ4A 1N36E 5DNYA 3BBGA 4DV6E 4GKJE 1SFEA 2EL6A 1TF6A 2VQFE 1IBKE 1G2FC 2EE8A 1DI2A 4IJDA 1WHQA 2ENAA 2VE7C 2KONA 3ADIA 3UK3C 1DGCA 3KZZA 1PJTA 1QNTA 4X66E 2HGHA 2EQ0A 2V87A 3HPSA 4ZYEA 2KOUA 1ZU1A 2J7JA 1WRJA 4MLQA 3DF6A 2M9AA 1X48A 1BBOA 1T4LB 1X3CA 1X6FA 4DV7E 1N33E 1PJQA 2YTDA 3BF2A 2EN8A 1G2DC 2L92A 2EQ1A 2JR1A 2YSOA 2EM8A 2VQEE 1O0WA 2LJHA 1T38A 3ECRA 4DKKA 2CT1A 2LTSA 4DUYE 3DJWA 1A1KA 2UUCE 2YRMA 3M99B 2CTDA 4GKKE 4JI3E 2Q8UA 2H36X 1HNZE 3EPHA 4R2RA 2LUQA 2EOMA 2IHR1 4O43A 2WBTA 2WBUA 5IT9C 4L5NC 4NZVA 2EOYA 1N34E 2I13A 4KZSA 2EMFA 2EMWA 1IQSA 2LT7A 2EN3A 4JI6E 4ZYDA 1J26A 2L2NA 2DMIA 4R2SA 2FV4B 3ADGA 2ODRD 2EM0A 4DUZE 4LF9E 2L33A 3VYXA 2MC5A 4RHBB 1P47A 1DQ3A 4LF6E 4ZYGA 4R2CA 1X5WA 2N3GA 1XMQE 2EM7A 4ZYHA 3T1HE 2G7HA 2YRKA 4O24A 1FKAE 1UN6B 3EPKA 4JI4E 2N3HA 4N4RB 2YU5A 4DR3E 2EN1A 4DV4E 2EP3A 1B69A 4WSGA 1XMOE 2YTQA 2EPAA 3OMLA 2VRDA
chains in the Genus database with same CATH topology
3HPZA 3LLHA 4L8NA 1J5EE 2V83A 3KWRA 5AE2A 4DV0E 4YHHE 2V88A 1RC7A 1N36E 2L3JA 1HNXE 4LU9A 5DNYA 4NXNE 4DV6E 1YYKA 2B7VA 1YZ9A 4JYAE 4GKJE 5F3WA 2EZ6A 2FTXB 2JOXA 2LMZA 2L3CA 4M0VA 4WYQB 2VQFE 1IBKE 4P78A 4J8ZA 2ZM6E 2EWLA 2L6MA 1DI2A 2NA2A 4LF7E 1WHQA 4B3ME 4LFCE 1X49A 4AQYE 1I94E 4X8WA 1YYWA 4JI2E 4LFBE 2VE7C 5IWAE 2KONA 1RQ0A 2HHHE 2B3TB 3ADIA 3P1XA 2L8TA 2L2KB 2E5LE 4X66E 3VK6A 3RMPA 2UXDE 2YZTA 2UUBE 3IWDA 2V87A 4WFTA 3HPSA 4M30A 2DMYA 2KOUA 4JI8E 3K6QA 1T4OA 2DIXA 4TUGA 3DF6A 2FGGA 3JU0A 4X65E 2JY9A 3AV0A 1X48A 2DB2A 2JOBA 4M2ZA 1T4LB 3ADJA 3HTXA 5LMNE 4BCAA 5AE3A 1ZBTA 4DV7E 1N33E 2L2MA 4JI1E 1HNWE 4BC7A 3VYYA 4GEQB 3C4BA 2NUFA 4B3RE 2WZOA 5LL6R 4BS9A 2MDRA 4DMIA 2L92A 2YT4A 4LF4E 2JR1A 1N32E 3IWBA 2VQEE 2UXCE 3HXLA 4P7DA 4DV3E 3F6HA 1O0WA 2RS7A 5A2QC 2LJHA 1GZ6A 3H09A 2LTSA 4DKKA 3JAMC 3DJWA 4TUIA 4DUYE 2LUPB 2UUCE 3J7Yp 4DR1E 4DR4E 1PKPA 4JI3E 2CPNA 4GKKE 2H36X 2MC6A 4KHPE 4JV5E 1HNZE 4DV5E 3C4TA 2LRSA 2NUEA 3FIGA 1XNRE 4LFAE 2B9DA 1EKZA 2LUQA 3MSWA 3ADLA 1ZBQA 2IHR1 4BMJA 1UILA 2UUAE 5AASA 5AE1A 2V86A 1STUA 2M1SA 4B3SE 2NUGA 3J80C 2F8BA 5IT9C 1WXRA 5CFFE 1HR0E 2JVAA 4L5NC 2JWOA 1N34E 4F9CB 4YY3E 3IWCA 4KZSA 3J81C 4DV1E 4K0KE 4WSPA 2DSYA 4F9BB 2F4VE 4JI6E 3LMLA 1XNQE 3ZOQB 1J26A 4X64E 2L2NA 4BBYA 2RS6A 1IBME 2UU9E 3T1YE 2FV4B 3ADGA 3AUZA 2ODRD 4JI0E 4DUZE 1T4NA 4LF9E 2ODRC 4WPYA 2L33A 3F6GA 4OX9E 3VYXA 2MC5A 4NXME 2LBSB 3HQ1A 5T6JA 1DQ3A 4BC9A 1IBLE 4LF6E 5BR8E 2B7TA 4X62E 4OOGC 4B3TE 2N3GA 1XMQE 4JI7E 4DR7E 4DR6E 4DR2E 2M7QA 3T1HE 2LE2A 2G7HA 1QU6A 2V8QB 4DV2E 1FJGE 1SR9A 4DR5E 4I8OA 3J7AG 1GQEA 2E1MA 4R8OA 2KHXA 4F54A 2M4IA 4LTYA 1FKAE 4JI5E 1WHNA 4JI4E 4R03A 2N3HA 4F9AB 5FLXC 2RTXA 3JTZA 4DR3E 2V85A 1YYOA 4LF8E 4DV4E 2K4VA 4LF5E 3OTOE 2LTRA 1X47A 2VF1A 1XMOE 2RSMA 5ADZA 1UHZA 4Q28A 5LMUE 2UXBE 3OMLA 2V89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8Q B; 
#chains in the Genus database with same CATH topology
 4R2P A;  2V83 A;  1RC7 A;  1UBD C;  4DV0 E;  4LU9 A;  4NXN E;  1JK1 A;  2EZ6 A;  1NEI A;  2FTX B;  2YTF A;  1Z1B A;  2LMZ A;  2L3C A;  5KL5 A;  2EMX A;  4P78 A;  5A6K A;  4M9V C;  2RPC A;  2EN6 A;  4LF7 E;  4B3M E;  4LFC E;  2EN2 A;  4MLV A;  2EML A;  4AQY E;  2DGC A;  2EPU A;  2EN4 A;  2HHH E;  2B3T B;  5KL7 A;  1A1F A;  2UUB E;  3EPL A;  5A6B A;  1TN9 A;  2DMY A;  4JI8 E;  2ELZ A;  2GPI A;  2BB8 A;  3K6Q A;  3JU0 A;  2FGG A;  4BHB A;  3AV0 A;  2ENH A;  2DB2 A;  2RQL A;  3HTX A;  4RH8 A;  1ZBT A;  1X6E A;  4JI1 E;  3VYY A;  4GEQ B;  4HEI A;  3C4B A;  4B3R E;  2WZO A;  5LL6 R;  4WX9 A;  2YT4 A;  5A69 A;  3IWB A;  3HXL A;  3F6H A;  2RS7 A;  2ENC A;  5A2Q C;  3H09 A;  3JAM C;  4TUI A;  3J7Y p;  4JV5 E;  5AC4 A;  4X9J A;  2MC6 A;  4R2Q A;  1EH8 A;  3C4T A;  2NUE A;  4LFA E;  2YPN A;  3MSW A;  3ADL A;  2DRP A;  4BMJ A;  2UUA E;  5AE1 A;  2GHF A;  4B3S E;  2N8X A;  1HR0 E;  2EN7 A;  3IWC A;  4WXD A;  2F4V E;  2EL5 A;  1A1I A;  1XNQ E;  2EOX A;  2LJU A;  2RS6 A;  2EOR A;  1IBM E;  2UU9 E;  3T1Y E;  3AUZ A;  2EPK X;  1BBG A;  3F6G A;  2DLQ A;  2LBS B;  3HQ1 A;  5T6J A;  1T39 A;  2YTJ A;  5BR8 E;  4X62 E;  4B3T E;  4DR6 E;  4DR2 E;  2M7Q A;  1LLM C;  4I8O A;  1YFH A;  1GQE A;  2KHX A;  4JI5 E;  1WHN A;  4F9A B;  5FLX C;  2RTX A;  2V85 A;  2EMZ A;  1L4S A;  2JYA A;  2K4V A;  1TF3 A;  3OTO E;  2LTR A;  1X47 A;  2RSM A;  1BB8 A;  1UHZ A;  2EPM X;  2EL4 A;  3EQ1 A;  1J5E E;  3KWR A;  5AE2 A;  2V88 A;  2L3J A;  1YYK A;  4JYA E;  5F3W A;  4GZN C;  5KL6 A;  1EH7 A;  2MKD A;  4M0V A;  4WYQ B;  4J8Z A;  2EMI A;  2EWL A;  2I9I A;  4R2E A;  2NA2 A;  2EOO A;  1YPN A;  2YTN A;  4LFB E;  4R2D A;  4JI2 E;  1MGT A;  1RQ0 A;  3P1X A;  2L2K B;  2DLK A;  2E5L E;  3RMP A;  3VK6 A;  5A6B D;  2UXD E;  2YZT A;  2YRH A;  3VHT B;  1T4O A;  2EM2 A;  4X65 E;  2MDG A;  2NAB A;  2JOB A;  4F6M A;  2EMK A;  2EM3 A;  2YTE A;  3MHS C;  5LMN E;  4BCA A;  2L2M A;  2EPL X;  1HNW E;  4BC7 A;  4BS9 A;  2MDR A;  1RMD A;  2UXC E;  4DV3 E;  1KYQ A;  1GZ6 A;  1IMU A;  2JXP A;  1A1L A;  5KL2 A;  2EPZ A;  4DR1 E;  2EM5 A;  2WCC 3;  4KHP E;  1A1G A;  5IXM B;  2EM9 A;  2EMG A;  3FIG A;  1XNR E;  2B9D A;  1ZBQ A;  1NCS A;  4FK5 C;  2ELY A;  1UIL A;  5AAS A;  2NUG A;  2E72 A;  2M1S A;  2D9H A;  2YTI A;  3J80 C;  5AC5 A;  1EH6 A;  2F8B A;  1A1J A;  3QG5 C;  5CFF E;  2HJJ A;  2JVA A;  4F9C B;  4YY3 E;  3J81 C;  4DV1 E;  2ADR A;  4WSP A;  4Q35 B;  4F9B B;  1YUJ A;  3ZOQ B;  2EOS A;  1ZR9 A;  5A6J A;  2JPA A;  2EOQ A;  4JI0 E;  2EOF A;  1T4N A;  2PRT A;  2ODR C;  4WPY A;  4NXM E;  2EMC A;  4BC9 A;  2R76 A;  2RSI A;  3KZY A;  2EPX A;  1JK2 A;  4JI7 E;  3L00 A;  2LCE A;  2LE2 A;  2YTO A;  1QU6 A;  2EPP A;  2V8Q B;  1F2I G;  1SR9 A;  2EPO A;  4DR5 E;  1X6H A;  2M4I A;  5TSE A;  2EPC A;  3JTZ A;  2HC5 A;  5ADZ A;  2EOI A;  5LMU E;  4R2A A;  1AH5 A;  3HPZ A;  4L8N A;  2GLI A;  1HNX E;  2EOE A;  2EOZ A;  4YHH E;  5A6A A;  1YZ9 A;  4WXC A;  2B7V A;  2JOX A;  2ZM6 E;  4KWY A;  2L6M A;  1GTK A;  5KL4 A;  1X49 A;  2LV2 A;  4IS1 C;  4X8W A;  4F6N A;  1I94 E;  1YYW A;  1N3G A;  5IWA E;  5KL3 A;  1PDA A;  3MHH C;  2L8T A;  5LLQ A;  3IWD A;  4WFT A;  4M30 A;  4O4K A;  1AAY A;  2DIX A;  4TUG A;  3EPJ A;  2JY9 A;  2EPN A;  4M2Z A;  3ADJ A;  3BID A;  2A25 A;  4HTG A;  5AE3 A;  2CSH A;  4BHC A;  1KJK A;  2NUF A;  2EMA A;  1YUI A;  2R1F A;  4DMI A;  4LF4 E;  2YTG A;  2YTP A;  1N32 E;  2EM4 A;  4P7D A;  2BBG A;  4F2J C;  2LUP B;  2EMY A;  4DR4 E;  1PKP A;  2CPN A;  3TQM A;  4DV5 E;  2LRS A;  1MEY C;  1EKZ A;  2YWQ A;  1YSA C;  2EM6 A;  2V86 A;  1STU A;  1WXR A;  4NHR A;  2EOJ A;  2JWO A;  4K0K E;  2EQ3 A;  2DSY A;  3LML A;  2YSP A;  1IQO A;  3THO B;  4X64 E;  2JP9 A;  2WBS A;  4BBY A;  1WJP A;  2EMB A;  3C6M A;  2K7I A;  2YU8 A;  5IV8 B;  4OX9 E;  1PJS A;  2LO3 A;  2MKN A;  1A1H A;  1IBL E;  2B7T A;  3BGH A;  2EPR A;  4OOG C;  4DR7 E;  1FJG E;  4DV2 E;  3J7A G;  2E1M A;  4O5G A;  4R8O A;  4F54 A;  4LTY A;  2LVH A;  1ZAA C;  2EOH A;  1YYO A;  4LF8 E;  4LF5 E;  3C6K A;  2VF1 A;  2EMH A;  4Q28 A;  2UXB E;  4R03 A;  2V89 A;  3LLH A;  3THN A;  2EJ4 A;  1N36 E;  5DNY A;  3BBG A;  4DV6 E;  4GKJ E;  1SFE A;  2EL6 A;  1TF6 A;  2VQF E;  1IBK E;  1G2F C;  2EE8 A;  1DI2 A;  4IJD A;  1WHQ A;  2ENA A;  2VE7 C;  2KON A;  3ADI A;  3UK3 C;  1DGC A;  3KZZ A;  1PJT A;  1QNT A;  4X66 E;  2HGH A;  2EQ0 A;  2V87 A;  3HPS A;  4ZYE A;  2KOU A;  1ZU1 A;  2J7J A;  1WRJ A;  4MLQ A;  3DF6 A;  2M9A A;  1X48 A;  1BBO A;  1T4L B;  1X3C A;  1X6F A;  4DV7 E;  1N33 E;  1PJQ A;  2YTD A;  3BF2 A;  2EN8 A;  1G2D C;  2L92 A;  2EQ1 A;  2JR1 A;  2YSO A;  2EM8 A;  2VQE E;  1O0W A;  2LJH A;  1T38 A;  3ECR A;  4DKK A;  2CT1 A;  2LTS A;  4DUY E;  3DJW A;  1A1K A;  2UUC E;  2YRM A;  3M99 B;  2CTD A;  4GKK E;  4JI3 E;  2Q8U A;  2H36 X;  1HNZ E;  3EPH A;  4R2R A;  2LUQ A;  2EOM A;  2IHR 1;  4O43 A;  2WBT A;  2WBU A;  5IT9 C;  4L5N C;  4NZV A;  2EOY A;  1N34 E;  2I13 A;  4KZS A;  2EMF A;  2EMW A;  1IQS A;  2LT7 A;  2EN3 A;  4JI6 E;  4ZYD A;  1J26 A;  2L2N A;  2DMI A;  4R2S A;  2FV4 B;  3ADG A;  2ODR D;  2EM0 A;  4DUZ E;  4LF9 E;  2L33 A;  3VYX A;  2MC5 A;  4RHB B;  1P47 A;  1DQ3 A;  4LF6 E;  4ZYG A;  4R2C A;  1X5W A;  2N3G A;  1XMQ E;  2EM7 A;  4ZYH A;  3T1H E;  2G7H A;  2YRK A;  4O24 A;  1FKA E;  1UN6 B;  3EPK A;  4JI4 E;  2N3H A;  4N4R B;  2YU5 A;  4DR3 E;  2EN1 A;  4DV4 E;  2EP3 A;  1B69 A;  4WSG A;  1XMO E;  2YTQ A;  2EPA A;  3OML A;  2VRD A; 
#chains in the Genus database with same CATH homology
 3HPZ A;  3LLH A;  4L8N A;  1J5E E;  2V83 A;  3KWR A;  5AE2 A;  4DV0 E;  4YHH E;  2V88 A;  1RC7 A;  1N36 E;  2L3J A;  1HNX E;  4LU9 A;  5DNY A;  4NXN E;  4DV6 E;  1YYK A;  2B7V A;  1YZ9 A;  4JYA E;  4GKJ E;  5F3W A;  2EZ6 A;  2FTX B;  2JOX A;  2LMZ A;  2L3C A;  4M0V A;  4WYQ B;  2VQF E;  1IBK E;  4P78 A;  4J8Z A;  2ZM6 E;  2EWL A;  2L6M A;  1DI2 A;  2NA2 A;  4LF7 E;  1WHQ A;  4B3M E;  4LFC E;  1X49 A;  4AQY E;  1I94 E;  4X8W A;  1YYW A;  4JI2 E;  4LFB E;  2VE7 C;  5IWA E;  2KON A;  1RQ0 A;  2HHH E;  2B3T B;  3ADI A;  3P1X A;  2L8T A;  2L2K B;  2E5L E;  4X66 E;  3VK6 A;  3RMP A;  2UXD E;  2YZT A;  2UUB E;  3IWD A;  2V87 A;  4WFT A;  3HPS A;  4M30 A;  2DMY A;  2KOU A;  4JI8 E;  3K6Q A;  1T4O A;  2DIX A;  4TUG A;  3DF6 A;  2FGG A;  3JU0 A;  4X65 E;  2JY9 A;  3AV0 A;  1X48 A;  2DB2 A;  2JOB A;  4M2Z A;  1T4L B;  3ADJ A;  3HTX A;  5LMN E;  4BCA A;  5AE3 A;  1ZBT A;  4DV7 E;  1N33 E;  2L2M A;  4JI1 E;  1HNW E;  4BC7 A;  3VYY A;  4GEQ B;  3C4B A;  2NUF A;  4B3R E;  2WZO A;  5LL6 R;  4BS9 A;  2MDR A;  4DMI A;  2L92 A;  2YT4 A;  4LF4 E;  2JR1 A;  1N32 E;  3IWB A;  2VQE E;  2UXC E;  3HXL A;  4P7D A;  4DV3 E;  3F6H A;  1O0W A;  2RS7 A;  5A2Q C;  2LJH A;  1GZ6 A;  3H09 A;  2LTS A;  4DKK A;  3JAM C;  3DJW A;  4TUI A;  4DUY E;  2LUP B;  2UUC E;  3J7Y p;  4DR1 E;  4DR4 E;  1PKP A;  4JI3 E;  2CPN A;  4GKK E;  2H36 X;  2MC6 A;  4KHP E;  4JV5 E;  1HNZ E;  4DV5 E;  3C4T A;  2LRS A;  2NUE A;  3FIG A;  1XNR E;  4LFA E;  2B9D A;  1EKZ A;  2LUQ A;  3MSW A;  3ADL A;  1ZBQ A;  2IHR 1;  4BMJ A;  1UIL A;  2UUA E;  5AAS A;  5AE1 A;  2V86 A;  1STU A;  2M1S A;  4B3S E;  2NUG A;  3J80 C;  2F8B A;  5IT9 C;  1WXR A;  5CFF E;  1HR0 E;  2JVA A;  4L5N C;  2JWO A;  1N34 E;  4F9C B;  4YY3 E;  3IWC A;  4KZS A;  3J81 C;  4DV1 E;  4K0K E;  4WSP A;  2DSY A;  4F9B B;  2F4V E;  4JI6 E;  3LML A;  1XNQ E;  3ZOQ B;  1J26 A;  4X64 E;  2L2N A;  4BBY A;  2RS6 A;  1IBM E;  2UU9 E;  3T1Y E;  2FV4 B;  3ADG A;  3AUZ A;  2ODR D;  4JI0 E;  4DUZ E;  1T4N A;  4LF9 E;  2ODR C;  4WPY A;  2L33 A;  3F6G A;  4OX9 E;  3VYX A;  2MC5 A;  4NXM E;  2LBS B;  3HQ1 A;  5T6J A;  1DQ3 A;  4BC9 A;  1IBL E;  4LF6 E;  5BR8 E;  2B7T A;  4X62 E;  4OOG C;  4B3T E;  2N3G A;  1XMQ E;  4JI7 E;  4DR7 E;  4DR6 E;  4DR2 E;  2M7Q A;  3T1H E;  2LE2 A;  2G7H A;  1QU6 A;  2V8Q B;  4DV2 E;  1FJG E;  1SR9 A;  4DR5 E;  4I8O A;  3J7A G;  1GQE A;  2E1M A;  4R8O A;  2KHX A;  4F54 A;  2M4I A;  4LTY A;  1FKA E;  4JI5 E;  1WHN A;  4JI4 E;  4R03 A;  2N3H A;  4F9A B;  5FLX C;  2RTX A;  3JTZ A;  4DR3 E;  2V85 A;  1YYO A;  4LF8 E;  4DV4 E;  2K4V A;  4LF5 E;  3OTO E;  2LTR A;  1X47 A;  2VF1 A;  1XMO E;  2RSM A;  5ADZ A;  1UHZ A;  4Q28 A;  5LMU E;  2UXB E;  3OML A;  2V89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...