2V8QB

Crystal structure of the regulatory fragment of mammalian ampk in complexes with amp
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
83
structure length
73
Chain Sequence
GQEMYAFRSEERFKSPPILPPHLLQVILNKDTNPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 5
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.760 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v8qB00
2V8QB
chains in the Genus database with same CATH superfamily
4JI2E 4ZYHA 2EPLX 4R2QA 4F6MA 1DGCA 2JPAA 1WHNA 4OOGC 2YPNA 4FK5C 1T4OA 4MLVA 3F6GA 1MEYC 2ELYA 1T4LB 3VHTB 2WBUA 4BC7A 2EMLA 4DV1E 2BB8A 1X49A 2EOYA 2WBSA 2RSMA 4WYQB 2EOHA 1N34E 2B7TA 2EMYA 2YSOA 4O43A 3VK6A 1N3GA 4TUGA 1HNXE 4RH8A 2NABA 3FIGA 2LJUA 4R2PA 1PJSA 5IXMB 1T39A 4DV6E 2GPIA 1WRJA 5A6AA 4R03A 2FTXB 2ODRC 2EOZA 4O5GA 3C4BA 2CSHA 3M99B 2CT1A 2E72A 1STUA 1N32E 2EMHA 3HPZA 4P78A 1XNQE 2M7QA 1X3CA 1ZBTA 2EM3A 2EQ1A 4F6NA 4LF6E 2YU8A 3ADGA 4BS9A 1PDAA 2EMAA 1RC7A 1YYOA 1QNTA 1UILA 3K6QA 1RQ0A 2DB2A 4BHBA 1A1HA 4NXME 3VYXA 2EM8A 4X8WA 1G2DC 2RQLA 2LVHA 4DV4E 5KL5A 3OMLA 5AE3A 1N36E 3ADJA 5A6KA 3IWCA 2YRKA 4DR3E 4R2EA 1A1LA 2EPZA 2EMGA 2LTSA 5AC4A 2NA2A 2EN1A 1YSAC 4GEQB 2LUPB 1T4NA 3THOB 2UUCE 2EN7A 2V86A 4B3RE 3IWDA 1RMDA 4JI4E 4BHCA 4GKKE 2YT4A 4WFTA 1AAYA 4LF9E 1SR9A 4DKKA 1EH8A 4DR6E 5AE1A 1TF6A 2UXDE 3OTOE 3J7Yp 2DLQA 5A6BD 2ZM6E 2MKDA 4NHRA 2LTRA 2V85A 3BIDA 1O0WA 2YRMA 2EOEA 4WSGA 4DR5E 3EPJA 2EMXA 2E1MA 3DF6A 4IS1C 2EMZA 3ZOQB 5A6BA 1XNRE 2MDGA 4LFAE 1UN6B 4WX9A 4O24A 4X65E 2G7HA 1IQOA 4ZYEA 2EPXA 1TN9A 4GKJE 2MC5A 3JAMC 5KL4A 2EJ4A 5TSEA 4ZYGA 2UUBE 4BBYA 3T1YE 4O4KA 1HNWE 3DJWA 4DV3E 4BCAA 3EQ1A 3AV0A 2YTGA 2EOQA 3EPLA 4KWYA 2V88A 1NCSA 4B3TE 4JYAE 3BBGA 2JOBA 5A69A 1A1KA 2EM0A 1EH7A 1IQSA 2M4IA 2EMWA 3MHSC 2YZTA 2EMCA 1YYWA 4DV7E 5A2QC 4KHPE 2MC6A 1IMUA 2YTNA 1BBOA 2VE7C 2EL6A 2L2KB 1N33E 2B9DA 2MDRA 2YTDA 4DV0E 2JP9A 2A25A 5IT9C 3VYYA 4DUZE 3KZZA 2JXPA 3P1XA 1X47A 2YRHA 2EM4A 1JK1A 5KL3A 2L92A 3JU0A 2YTQA 4JI0E 2LRSA 4R2DA 2L33A 2FGGA 2F8BA 1PKPA 2EM7A 3BF2A 4AQYE 5LLQA 1X6EA 1PJQA 1B69A 3QG5C 2DIXA 2UU9E 4F54A 4GZNC 4LFCE 4JI7E 1DI2A 4N4RB 2EM5A 4LF4E 2V83A 1A1GA 2JOXA 2J7JA 1YPNA 2YTJA 2L8TA 3TQMA 4BC9A 4JI6E 2R1FA 1KJKA 1HNZE 2EPUA 2RS7A 2EP3A 4YY3E 2DMYA 1A1FA 5KL2A 2EL5A 4YHHE 1X48A 1GQEA 1ZAAC 4ZYDA 1FJGE 3RMPA 2JY9A 4X62E 2RSIA 3AUZA 2LT7A 2EOMA 2PRTA 1ZR9A 4MLQA 1DQ3A 2YU5A 1IBME 2VRDA 2H36X 1YYKA 2DMIA 4NZVA 2L3CA 2DSYA 4F2JC 2YTPA 5BR8E 4DV2E 3T1HE 4DR4E 2EQ3A 2EOOA 3JTZA 3C6KA 4R2CA 2V87A 2R76A 2EMBA 3IWBA 2D9HA 2VF1A 4WSPA 4M30A 2IHR1 3HTXA 4JI8E 4DUYE 4B3SE 2LCEA 1YZ9A 2NUGA 1A1JA 3HXLA 3KZYA 2M1SA 4WXCA 1P47A 3KWRA 1A1IA 1J5EE 5LL6R 2LBSB 2B7VA 2LJHA 5DNYA 3EPHA 4M9VC 4R2SA 4LTYA 1GZ6A 2EPRA 4X66E 2NUFA 2JWOA 2LMZA 1TF3A 1FKAE 4HTGA 4F9BB 4M2ZA 2V89A 2YTIA 2L2MA 4KZSA 2YTOA 1MGTA 2EN6A 2HJJA 4DR1E 2VQEE 2L6MA 2LUQA 2KONA 1EKZA 1BB8A 3UK3C 4R2AA 2Q8UA 2UUAE 2EPNA 2GHFA 3HQ1A 2CPNA 4OX9E 2EM6A 4WXDA 5FLXC 5LMNE 1XMQE 2EPMX 4LF5E 4X9JA 4L5NC 2UXBE 2EPPA 2ELZA 4JV5E 4RHBB 2JYAA 3L00A 1X6FA 1SFEA 2I13A 4R2RA 4DR7E 2EN4A 5AC5A 3HPSA 4IJDA 4TUIA 4I8OA 4JI1E 2VQFE 3J7AG 2K4VA 2V8QB 2RTXA 1JK2A 2RPCA 5ADZA 2B3TB 2YWQA 1G2FC 5AE2A 2EPOA 2K7IA 3J80C 1BBGA 2L2NA 2N3HA 2DGCA 2N8XA 5IWAE 1ZBQA 2YTFA 1Z1BA 2LV2A 2LE2A 2EL4A 5F3WA 1EH6A 4F9AB 3ECRA 2WCC3 4F9CB 2WZOA 1WXRA 1QU6A 4WPYA 3F6HA 2JR1A 2EOJA 2L3JA 3THNA 1KYQA 2JVAA 1X5WA 2E5LE 1GTKA 4B3ME 2EMKA 4DV5E 1PJTA 2RS6A 1L4SA 2HHHE 4LU9A 2DLKA 4R8OA 2ENAA 2EN3A 2GLIA 3C6MA 2EE8A 3LMLA 2M9AA 3ADLA 2N3GA 2DRPA 1UHZA 3BGHA 4X64E 3MSWA 2HC5A 5KL7A 5IV8B 2UXCE 3ADIA 4P7DA 3J81C 1YUIA 1I94E 1NEIA 1X6HA 2EOSA 1F2IG 4L8NA 2LO3A 4DR2E 2WBTA 2EOFA 2ENHA 4J8ZA 1ZU1A 3C4TA 2EORA 2EPKX 1IBKE 2ENCA 3EPKA 4HEIA 5T6JA 2ODRD 1HR0E 2HGHA 2EN2A 1IBLE 2NUEA 1AH5A 4NXNE 2EWLA 4Q28A 2EOXA 3LLHA 2EM9A 1UBDC 4K0KE 1XMOE 1YFHA 1WJPA 5KL6A 4LFBE 2EZ6A 2KOUA 1YUJA 2FV4B 4DMIA 2ADRA 2EN8A 4JI3E 2EPAA 3H09A 2EMIA 2EMFA 4Q35B 1J26A 1WHQA 2YTEA 4LF7E 4BMJA 2I9IA 2EOIA 2EM2A 4M0VA 3MHHC 2YSPA 2MKNA 1T38A 2EQ0A 2F4VE 5A6JA 2CTDA 2BBGA 2EPCA 1LLMC 5AASA 4LF8E 2KHXA 5LMUE 5CFFE 4JI5E
chains in the Genus database with same CATH topology
2B3TB 1O0WA 4JI2E 5AE2A 4DR5E 1DQ3A 3J80C 2E1MA 1IBME 3DF6A 3ZOQB 1XNRE 1WHNA 2L2NA 2N3HA 4OOGC 4LFAE 2H36X 2KHXA 5IWAE 1T4OA 4X65E 1YYKA 1ZBQA 2G7HA 2L3CA 2LE2A 2DSYA 3F6GA 5F3WA 5BR8E 4F9AB 1T4LB 4GKJE 4F9CB 2MC5A 4BC7A 4DV2E 3JAMC 2WZOA 3T1HE 1WXRA 4DR4E 1QU6A 3JTZA 4WPYA 3F6HA 4DV1E 2JR1A 2V87A 2L3JA 1X49A 2JVAA 2UUBE 2RSMA 3IWBA 4WYQB 4BBYA 2VF1A 4WSPA 4M30A 3T1YE 1N34E 1HNWE 2E5LE 2B7TA 2IHR1 3DJWA 4JI8E 3VK6A 4DV3E 3HTXA 4BCAA 4B3ME 3AV0A 4TUGA 1HNXE 4DV5E 2RS6A 3FIGA 4DUYE 2V88A 2HHHE 4B3SE 1YZ9A 4LU9A 2NUGA 4R8OA 4B3TE 4JYAE 3HXLA 2JOBA 4DV6E 3LMLA 2M1SA 2M4IA 3ADLA 2N3GA 4R03A 1UHZA 2FTXB 2YZTA 2ODRC 3KWRA 3C4BA 1YYWA 4X64E 3MSWA 1J5EE 4DV7E 5A2QC 5LL6R 4KHPE 2MC6A 1STUA 1N32E 2VE7C 2LBSB 2L2KB 2UXCE 3ADIA 2B7VA 2LJHA 2B9DA 2MDRA 4P7DA 3HPZA 4P78A 5DNYA 3J81C 4DV0E 1I94E 1XNQE 2M7QA 4L8NA 1ZBTA 5IT9C 4DR2E 4LTYA 3VYYA 1GZ6A 4DUZE 4X66E 2NUFA 2JWOA 4LF6E 4J8ZA 3P1XA 1X47A 3C4TA 2LMZA 3ADGA 4BS9A 1FKAE 1IBKE 2L92A 3JU0A 1RC7A 4F9BB 1YYOA 4M2ZA 1N33E 2V89A 1UILA 3K6QA 4JI0E 1RQ0A 2LRSA 2DB2A 2L33A 5T6JA 2L2MA 5CFFE 4KZSA 2FGGA 2ODRD 1HR0E 4NXME 2F8BA 3VYXA 1PKPA 1IBLE 2NUEA 4X8WA 4AQYE 4DR1E 4NXNE 2EWLA 2VQEE 2L6MA 4DV4E 2LUQA 2KONA 4Q28A 1EKZA 2DIXA 3LLHA 3OMLA 5AE3A 4F54A 3ADJA 1N36E 2UU9E 4LFCE 3IWCA 4JI7E 1DI2A 4K0KE 4DR3E 1XMOE 2UUAE 4LF4E 2V83A 3HQ1A 4OX9E 2LTSA 2CPNA 4LFBE 2JOXA 2EZ6A 2KOUA 2NA2A 2FV4B 2L8TA 4DMIA 4GEQB 4JI3E 5FLXC 2LUPB 1T4NA 5LMNE 4BC9A 1XMQE 4JI6E 3H09A 2UUCE 4LF5E 1J26A 1WHQA 2V86A 1HNZE 3IWDA 2RS7A 4L5NC 4YY3E 4JI4E 2DMYA 4LF7E 4B3RE 4BMJA 2UXBE 4GKKE 4YHHE 4JV5E 2YT4A 4WFTA 4LF9E 1X48A 4M0VA 1SR9A 4DKKA 1GQEA 4DR7E 4DR6E 5AE1A 2UXDE 1FJGE 3HPSA 4TUIA 3RMPA 2JY9A 4X62E 3J7Yp 3OTOE 2F4VE 4I8OA 4JI1E 2VQFE 3J7AG 2ZM6E 2K4VA 2V8QB 2RTXA 3AUZA 5AASA 5ADZA 4LF8E 2LTRA 5LMUE 2V85A 4JI5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8Q B; 
#chains in the Genus database with same CATH topology
 4JI2 E;  4ZYH A;  2EPL X;  4R2Q A;  4F6M A;  1DGC A;  2JPA A;  1WHN A;  4OOG C;  2YPN A;  4FK5 C;  1T4O A;  4MLV A;  3F6G A;  1MEY C;  2ELY A;  1T4L B;  3VHT B;  2WBU A;  4BC7 A;  2EML A;  4DV1 E;  2BB8 A;  1X49 A;  2EOY A;  2WBS A;  2RSM A;  4WYQ B;  2EOH A;  1N34 E;  2B7T A;  2EMY A;  2YSO A;  4O43 A;  3VK6 A;  1N3G A;  4TUG A;  1HNX E;  4RH8 A;  2NAB A;  3FIG A;  2LJU A;  4R2P A;  1PJS A;  5IXM B;  1T39 A;  4DV6 E;  2GPI A;  1WRJ A;  5A6A A;  4R03 A;  2FTX B;  2ODR C;  2EOZ A;  4O5G A;  3C4B A;  2CSH A;  3M99 B;  2CT1 A;  2E72 A;  1STU A;  1N32 E;  2EMH A;  3HPZ A;  4P78 A;  1XNQ E;  2M7Q A;  1X3C A;  1ZBT A;  2EM3 A;  2EQ1 A;  4F6N A;  4LF6 E;  2YU8 A;  3ADG A;  4BS9 A;  1PDA A;  2EMA A;  1RC7 A;  1YYO A;  1QNT A;  1UIL A;  3K6Q A;  1RQ0 A;  2DB2 A;  4BHB A;  1A1H A;  4NXM E;  3VYX A;  2EM8 A;  4X8W A;  1G2D C;  2RQL A;  2LVH A;  4DV4 E;  5KL5 A;  3OML A;  5AE3 A;  1N36 E;  3ADJ A;  5A6K A;  3IWC A;  2YRK A;  4DR3 E;  4R2E A;  1A1L A;  2EPZ A;  2EMG A;  2LTS A;  5AC4 A;  2NA2 A;  2EN1 A;  1YSA C;  4GEQ B;  2LUP B;  1T4N A;  3THO B;  2UUC E;  2EN7 A;  2V86 A;  4B3R E;  3IWD A;  1RMD A;  4JI4 E;  4BHC A;  4GKK E;  2YT4 A;  4WFT A;  1AAY A;  4LF9 E;  1SR9 A;  4DKK A;  1EH8 A;  4DR6 E;  5AE1 A;  1TF6 A;  2UXD E;  3OTO E;  3J7Y p;  2DLQ A;  5A6B D;  2ZM6 E;  2MKD A;  4NHR A;  2LTR A;  2V85 A;  3BID A;  1O0W A;  2YRM A;  2EOE A;  4WSG A;  4DR5 E;  3EPJ A;  2EMX A;  2E1M A;  3DF6 A;  4IS1 C;  2EMZ A;  3ZOQ B;  5A6B A;  1XNR E;  2MDG A;  4LFA E;  1UN6 B;  4WX9 A;  4O24 A;  4X65 E;  2G7H A;  1IQO A;  4ZYE A;  2EPX A;  1TN9 A;  4GKJ E;  2MC5 A;  3JAM C;  5KL4 A;  2EJ4 A;  5TSE A;  4ZYG A;  2UUB E;  4BBY A;  3T1Y E;  4O4K A;  1HNW E;  3DJW A;  4DV3 E;  4BCA A;  3EQ1 A;  3AV0 A;  2YTG A;  2EOQ A;  3EPL A;  4KWY A;  2V88 A;  1NCS A;  4B3T E;  4JYA E;  3BBG A;  2JOB A;  5A69 A;  1A1K A;  2EM0 A;  1EH7 A;  1IQS A;  2M4I A;  2EMW A;  3MHS C;  2YZT A;  2EMC A;  1YYW A;  4DV7 E;  5A2Q C;  4KHP E;  2MC6 A;  1IMU A;  2YTN A;  1BBO A;  2VE7 C;  2EL6 A;  2L2K B;  1N33 E;  2B9D A;  2MDR A;  2YTD A;  4DV0 E;  2JP9 A;  2A25 A;  5IT9 C;  3VYY A;  4DUZ E;  3KZZ A;  2JXP A;  3P1X A;  1X47 A;  2YRH A;  2EM4 A;  1JK1 A;  5KL3 A;  2L92 A;  3JU0 A;  2YTQ A;  4JI0 E;  2LRS A;  4R2D A;  2L33 A;  2FGG A;  2F8B A;  1PKP A;  2EM7 A;  3BF2 A;  4AQY E;  5LLQ A;  1X6E A;  1PJQ A;  1B69 A;  3QG5 C;  2DIX A;  2UU9 E;  4F54 A;  4GZN C;  4LFC E;  4JI7 E;  1DI2 A;  4N4R B;  2EM5 A;  4LF4 E;  2V83 A;  1A1G A;  2JOX A;  2J7J A;  1YPN A;  2YTJ A;  2L8T A;  3TQM A;  4BC9 A;  4JI6 E;  2R1F A;  1KJK A;  1HNZ E;  2EPU A;  2RS7 A;  2EP3 A;  4YY3 E;  2DMY A;  1A1F A;  5KL2 A;  2EL5 A;  4YHH E;  1X48 A;  1GQE A;  1ZAA C;  4ZYD A;  1FJG E;  3RMP A;  2JY9 A;  4X62 E;  2RSI A;  3AUZ A;  2LT7 A;  2EOM A;  2PRT A;  1ZR9 A;  4MLQ A;  1DQ3 A;  2YU5 A;  1IBM E;  2VRD A;  2H36 X;  1YYK A;  2DMI A;  4NZV A;  2L3C A;  2DSY A;  4F2J C;  2YTP A;  5BR8 E;  4DV2 E;  3T1H E;  4DR4 E;  2EQ3 A;  2EOO A;  3JTZ A;  3C6K A;  4R2C A;  2V87 A;  2R76 A;  2EMB A;  3IWB A;  2D9H A;  2VF1 A;  4WSP A;  4M30 A;  2IHR 1;  3HTX A;  4JI8 E;  4DUY E;  4B3S E;  2LCE A;  1YZ9 A;  2NUG A;  1A1J A;  3HXL A;  3KZY A;  2M1S A;  4WXC A;  1P47 A;  3KWR A;  1A1I A;  1J5E E;  5LL6 R;  2LBS B;  2B7V A;  2LJH A;  5DNY A;  3EPH A;  4M9V C;  4R2S A;  4LTY A;  1GZ6 A;  2EPR A;  4X66 E;  2NUF A;  2JWO A;  2LMZ A;  1TF3 A;  1FKA E;  4HTG A;  4F9B B;  4M2Z A;  2V89 A;  2YTI A;  2L2M A;  4KZS A;  2YTO A;  1MGT A;  2EN6 A;  2HJJ A;  4DR1 E;  2VQE E;  2L6M A;  2LUQ A;  2KON A;  1EKZ A;  1BB8 A;  3UK3 C;  4R2A A;  2Q8U A;  2UUA E;  2EPN A;  2GHF A;  3HQ1 A;  2CPN A;  4OX9 E;  2EM6 A;  4WXD A;  5FLX C;  5LMN E;  1XMQ E;  2EPM X;  4LF5 E;  4X9J A;  4L5N C;  2UXB E;  2EPP A;  2ELZ A;  4JV5 E;  4RHB B;  2JYA A;  3L00 A;  1X6F A;  1SFE A;  2I13 A;  4R2R A;  4DR7 E;  2EN4 A;  5AC5 A;  3HPS A;  4IJD A;  4TUI A;  4I8O A;  4JI1 E;  2VQF E;  3J7A G;  2K4V A;  2V8Q B;  2RTX A;  1JK2 A;  2RPC A;  5ADZ A;  2B3T B;  2YWQ A;  1G2F C;  5AE2 A;  2EPO A;  2K7I A;  3J80 C;  1BBG A;  2L2N A;  2N3H A;  2DGC A;  2N8X A;  5IWA E;  1ZBQ A;  2YTF A;  1Z1B A;  2LV2 A;  2LE2 A;  2EL4 A;  5F3W A;  1EH6 A;  4F9A B;  3ECR A;  2WCC 3;  4F9C B;  2WZO A;  1WXR A;  1QU6 A;  4WPY A;  3F6H A;  2JR1 A;  2EOJ A;  2L3J A;  3THN A;  1KYQ A;  2JVA A;  1X5W A;  2E5L E;  1GTK A;  4B3M E;  2EMK A;  4DV5 E;  1PJT A;  2RS6 A;  1L4S A;  2HHH E;  4LU9 A;  2DLK A;  4R8O A;  2ENA A;  2EN3 A;  2GLI A;  3C6M A;  2EE8 A;  3LML A;  2M9A A;  3ADL A;  2N3G A;  2DRP A;  1UHZ A;  3BGH A;  4X64 E;  3MSW A;  2HC5 A;  5KL7 A;  5IV8 B;  2UXC E;  3ADI A;  4P7D A;  3J81 C;  1YUI A;  1I94 E;  1NEI A;  1X6H A;  2EOS A;  1F2I G;  4L8N A;  2LO3 A;  4DR2 E;  2WBT A;  2EOF A;  2ENH A;  4J8Z A;  1ZU1 A;  3C4T A;  2EOR A;  2EPK X;  1IBK E;  2ENC A;  3EPK A;  4HEI A;  5T6J A;  2ODR D;  1HR0 E;  2HGH A;  2EN2 A;  1IBL E;  2NUE A;  1AH5 A;  4NXN E;  2EWL A;  4Q28 A;  2EOX A;  3LLH A;  2EM9 A;  1UBD C;  4K0K E;  1XMO E;  1YFH A;  1WJP A;  5KL6 A;  4LFB E;  2EZ6 A;  2KOU A;  1YUJ A;  2FV4 B;  4DMI A;  2ADR A;  2EN8 A;  4JI3 E;  2EPA A;  3H09 A;  2EMI A;  2EMF A;  4Q35 B;  1J26 A;  1WHQ A;  2YTE A;  4LF7 E;  4BMJ A;  2I9I A;  2EOI A;  2EM2 A;  4M0V A;  3MHH C;  2YSP A;  2MKN A;  1T38 A;  2EQ0 A;  2F4V E;  5A6J A;  2CTD A;  2BBG A;  2EPC A;  1LLM C;  5AAS A;  4LF8 E;  2KHX A;  5LMU E;  5CFF E;  4JI5 E; 
#chains in the Genus database with same CATH homology
 2B3T B;  1O0W A;  4JI2 E;  5AE2 A;  4DR5 E;  1DQ3 A;  3J80 C;  2E1M A;  1IBM E;  3DF6 A;  3ZOQ B;  1XNR E;  1WHN A;  2L2N A;  2N3H A;  4OOG C;  4LFA E;  2H36 X;  2KHX A;  5IWA E;  1T4O A;  4X65 E;  1YYK A;  1ZBQ A;  2G7H A;  2L3C A;  2LE2 A;  2DSY A;  3F6G A;  5F3W A;  5BR8 E;  4F9A B;  1T4L B;  4GKJ E;  4F9C B;  2MC5 A;  4BC7 A;  4DV2 E;  3JAM C;  2WZO A;  3T1H E;  1WXR A;  4DR4 E;  1QU6 A;  3JTZ A;  4WPY A;  3F6H A;  4DV1 E;  2JR1 A;  2V87 A;  2L3J A;  1X49 A;  2JVA A;  2UUB E;  2RSM A;  3IWB A;  4WYQ B;  4BBY A;  2VF1 A;  4WSP A;  4M30 A;  3T1Y E;  1N34 E;  1HNW E;  2E5L E;  2B7T A;  2IHR 1;  3DJW A;  4JI8 E;  3VK6 A;  4DV3 E;  3HTX A;  4BCA A;  4B3M E;  3AV0 A;  4TUG A;  1HNX E;  4DV5 E;  2RS6 A;  3FIG A;  4DUY E;  2V88 A;  2HHH E;  4B3S E;  1YZ9 A;  4LU9 A;  2NUG A;  4R8O A;  4B3T E;  4JYA E;  3HXL A;  2JOB A;  4DV6 E;  3LML A;  2M1S A;  2M4I A;  3ADL A;  2N3G A;  4R03 A;  1UHZ A;  2FTX B;  2YZT A;  2ODR C;  3KWR A;  3C4B A;  1YYW A;  4X64 E;  3MSW A;  1J5E E;  4DV7 E;  5A2Q C;  5LL6 R;  4KHP E;  2MC6 A;  1STU A;  1N32 E;  2VE7 C;  2LBS B;  2L2K B;  2UXC E;  3ADI A;  2B7V A;  2LJH A;  2B9D A;  2MDR A;  4P7D A;  3HPZ A;  4P78 A;  5DNY A;  3J81 C;  4DV0 E;  1I94 E;  1XNQ E;  2M7Q A;  4L8N A;  1ZBT A;  5IT9 C;  4DR2 E;  4LTY A;  3VYY A;  1GZ6 A;  4DUZ E;  4X66 E;  2NUF A;  2JWO A;  4LF6 E;  4J8Z A;  3P1X A;  1X47 A;  3C4T A;  2LMZ A;  3ADG A;  4BS9 A;  1FKA E;  1IBK E;  2L92 A;  3JU0 A;  1RC7 A;  4F9B B;  1YYO A;  4M2Z A;  1N33 E;  2V89 A;  1UIL A;  3K6Q A;  4JI0 E;  1RQ0 A;  2LRS A;  2DB2 A;  2L33 A;  5T6J A;  2L2M A;  5CFF E;  4KZS A;  2FGG A;  2ODR D;  1HR0 E;  4NXM E;  2F8B A;  3VYX A;  1PKP A;  1IBL E;  2NUE A;  4X8W A;  4AQY E;  4DR1 E;  4NXN E;  2EWL A;  2VQE E;  2L6M A;  4DV4 E;  2LUQ A;  2KON A;  4Q28 A;  1EKZ A;  2DIX A;  3LLH A;  3OML A;  5AE3 A;  4F54 A;  3ADJ A;  1N36 E;  2UU9 E;  4LFC E;  3IWC A;  4JI7 E;  1DI2 A;  4K0K E;  4DR3 E;  1XMO E;  2UUA E;  4LF4 E;  2V83 A;  3HQ1 A;  4OX9 E;  2LTS A;  2CPN A;  4LFB E;  2JOX A;  2EZ6 A;  2KOU A;  2NA2 A;  2FV4 B;  2L8T A;  4DMI A;  4GEQ B;  4JI3 E;  5FLX C;  2LUP B;  1T4N A;  5LMN E;  4BC9 A;  1XMQ E;  4JI6 E;  3H09 A;  2UUC E;  4LF5 E;  1J26 A;  1WHQ A;  2V86 A;  1HNZ E;  3IWD A;  2RS7 A;  4L5N C;  4YY3 E;  4JI4 E;  2DMY A;  4LF7 E;  4B3R E;  4BMJ A;  2UXB E;  4GKK E;  4YHH E;  4JV5 E;  2YT4 A;  4WFT A;  4LF9 E;  1X48 A;  4M0V A;  1SR9 A;  4DKK A;  1GQE A;  4DR7 E;  4DR6 E;  5AE1 A;  2UXD E;  1FJG E;  3HPS A;  4TUI A;  3RMP A;  2JY9 A;  4X62 E;  3J7Y p;  3OTO E;  2F4V E;  4I8O A;  4JI1 E;  2VQF E;  3J7A G;  2ZM6 E;  2K4V A;  2V8Q B;  2RTX A;  3AUZ A;  5AAS A;  5ADZ A;  4LF8 E;  2LTR A;  5LMU E;  2V85 A;  4JI5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...