2V8QB

Crystal structure of the regulatory fragment of mammalian ampk in complexes with amp
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
83
structure length
73
Chain Sequence
GQEMYAFRSEERFKSPPILPPHLLQVILNKDTNPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
total genus 5
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.760 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v8qB00
2V8QB
chains in the Genus database with same CATH superfamily
1X6EA 2EMHA 4NXME 4BMJA 5LL6R 4X62E 5AASA 3C6MA 2EM2A 1AAYA 3BGHA 4WXDA 1BBOA 4MLVA 3HPSA 2EPRA 5A2QC 1T4NA 2EOHA 2N3GA 1X5WA 2EN8A 3C4TA 3P1XA 3T1YE 3C6KA 2LJHA 2UXBE 3BIDA 3JAMC 4RH8A 1WRJA 3HTXA 3TQMA 1PJTA 5KL3A 3EPLA 2F4VE 4RHBB 1XNRE 2EOZA 4HTGA 2EM8A 1N3GA 2EMCA 2JWOA 2L2MA 2YTQA 5A6BA 2L3CA 2V88A 1A1FA 3VYXA 4JV5E 2EPNA 1A1IA 2IHR1 1GZ6A 2B7VA 2HHHE 5A6AA 4LF8E 2NA2A 1O0WA 4BS9A 4GKJE 2M4IA 1QU6A 2DMIA 2HC5A 2R76A 2RQLA 2MKNA 5KL6A 2G7HA 2LMZA 5A6KA 2YTOA 1N33E 2UXDE 4WYQB 2NUGA 4R8OA 2BBGA 3VK6A 2M7QA 4OX9E 4JI3E 2V87A 2B7TA 4BHBA 2RPCA 2EN4A 4NZVA 4LU9A 2N3HA 2L3JA 2JVAA 2NUFA 2EN1A 4BC9A 2B3TB 4AQYE 2EPPA 1T38A 3C4BA 1RC7A 5LMNE 4LFCE 2CT1A 2ODRC 4R2CA 2ELYA 5ADZA 4R03A 3OTOE 2E5LE 3KZZA 4I8OA 4R2AA 3ADLA 2LVHA 5AE2A 2LUQA 3THOB 4WPYA 2YU5A 4R2SA 5A6JA 1MGTA 2WBSA 3IWDA 3AUZA 4JI8E 3KWRA 1WHQA 4M30A 1X6FA 4DKKA 3EPHA 1YFHA 4LF7E 2GHFA 4B3RE 5KL5A 2H36X 2EORA 4F6NA 1B69A 2YWQA 4DR7E 1DI2A 3J7AG 1IBME 2MC5A 2WBTA 2RTXA 1UILA 1MEYC 1KYQA 1PDAA 3ADIA 2EMLA 2VF1A 5AE1A 2B9DA 4JI0E 2EM9A 2EMZA 1IBLE 4ZYGA 4BBYA 1G2DC 4DR3E 3MHSC 1ZBTA 4DR6E 2EPLX 3EQ1A 4DV7E 3EPJA 2EOFA 4JI2E 4DUZE 4NHRA 2EOSA 2V8QB 2EMAA 1YUIA 1IMUA 4WX9A 1A1HA 4X9JA 2F8BA 3HPZA 2BB8A 5IWAE 1T4OA 4DV1E 4BCAA 2NABA 4M2ZA 2KHXA 4YY3E 4X8WA 1A1JA 2DRPA 1GQEA 4P7DA 3T1HE 2MDRA 5BR8E 2EPMX 4DR5E 1XMQE 2RSMA 1WJPA 3KZYA 4LF6E 1ZU1A 2JPAA 1LLMC 2EMGA 3ADJA 1X3CA 1UBDC 2EM7A 1IQSA 4LTYA 2EN6A 1TF3A 3H09A 4M0VA 4N4RB 4LF4E 2DIXA 4Q28A 1SFEA 2LTRA 5KL7A 4P78A 5AC4A 1HNXE 2NUEA 4ZYEA 1KJKA 2EQ0A 2EMBA 1FJGE 2UUBE 4K0KE 1P47A 4LF5E 2K4VA 1N32E 4J8ZA 5T6JA 3ZOQB 5A69A 1PJSA 1IBKE 2LO3A 2DMYA 1YYKA 1ZR9A 1YYOA 1XMOE 4F2JC 4M9VC 1HR0E 3DJWA 2WBUA 4KHPE 1UN6B 3MSWA 2GPIA 2UU9E 4LFBE 3ADGA 1EKZA 2EQ1A 2EPOA 2KONA 1TN9A 1ZAAC 1X48A 2J7JA 3EPKA 3VYYA 5FLXC 3FIGA 1SR9A 2UXCE 1QNTA 4IJDA 2EPKX 2FV4B 4WFTA 2EZ6A 5DNYA 4JI4E 4DV6E 4WSGA 2LUPB 2CSHA 4X66E 4JI5E 2EPUA 4DV2E 1J26A 2HGHA 2VE7C 2YTDA 2V86A 4R2PA 2EMKA 2LJUA 1X47A 2V83A 3IWCA 2YTNA 2I13A 2M9AA 1TF6A 4IS1C 2MKDA 1T39A 1ZBQA 2KOUA 4X65E 2L92A 2JXPA 2E72A 2ODRD 3F6HA 2ENHA 5IV8B 4F6MA 1YPNA 2LBSB 2D9HA 2EM6A 4YHHE 3J81C 4LF9E 1FKAE 2FGGA 2EMWA 4JI7E 3JTZA 1RMDA 2DSYA 2EM4A 2LCEA 2JP9A 3UK3C 2LV2A 1UHZA 2YU8A 2EN3A 1DGCA 2EOEA 2EOYA 2E1MA 1IQOA 2YZTA 4NXNE 1A1KA 3L00A 2YTJA 2EQ3A 2LTSA 1N36E 2EOXA 4BC7A 2M1SA 1X49A 2CTDA 3RMPA 1EH8A 3DF6A 2RS7A 5A6BD 2YPNA 2EOIA 3J7Yp 4O24A 1STUA 2EN7A 1XNQE 4DMIA 2L8TA 2RSIA 5CFFE 3M99B 4DR1E 1WXRA 2EM3A 2VRDA 1NEIA 2EMIA 1GTKA 2JOXA 4WXCA 4B3TE 2WCC3 2MC6A 2EOOA 1RQ0A 2K7IA 1J5EE 1NCSA 1DQ3A 3JU0A 1EH6A 2LRSA 4TUIA 2DGCA 2EL4A 3LLHA 1Z1BA 5IT9C 2L6MA 2YSOA 5KL4A 4WSPA 4F9CB 4F9BB 4DV5E 2EOMA 5KL2A 2ZM6E 4OOGC 4R2DA 4GEQB 5AE3A 3QG5C 2EM0A 2EMYA 3HXLA 3AV0A 1F2IG 2YRHA 4DV4E 4DR2E 2VQFE 2ADRA 4MLQA 1EH7A 2UUAE 2JOBA 5TSEA 2YT4A 3BBGA 4O5GA 2EMFA 4X64E 2EMXA 4R2EA 4B3SE 1BBGA 1PJQA 2YTIA 4JI6E 2EPAA 2FTXB 2Q8UA 2JY9A 2YTPA 2EWLA 3THNA 1YSAC 2EL5A 2LE2A 2JYAA 4R2QA 2YSPA 4O4KA 4B3ME 2DLKA 4HEIA 1T4LB 1YYWA 1PKPA 4R2RA 3OMLA 2EP3A 4O43A 2GLIA 2CPNA 2WZOA 2V89A 4KWYA 1YZ9A 3K6QA 4GKKE 4BHCA 3LMLA 3ECRA 1N34E 3IWBA 1A1LA 2L2NA 4KZSA 2HJJA 4ZYHA 4ZYDA 4F9AB 2YTEA 5IXMB 2YTFA 5LMUE 2EM5A 5F3WA 2L33A 2ENCA 1AH5A 3VHTB 1JK2A 4DV3E 3HQ1A 2EPZA 1JK1A 2JR1A 4GZNC 1X6HA 4LFAE 1L4SA 2VQEE 2MDGA 3MHHC 4FK5C 2A25A 2UUCE 1BB8A 2EJ4A 1A1GA 2DB2A 5LLQA 1WHNA 2RS6A 1I94E 1HNWE 1HNZE 2EN2A 4Q35B 4TUGA 2YRKA 2ENAA 3J80C 2EPXA 1G2FC 4L5NC 4F54A 4DUYE 1YUJA 4JYAE 3BF2A 2DLQA 2N8XA 2EE8A 5AC5A 4DV0E 2EPCA 2YRMA 2I9IA 2YTGA 4DR4E 2EL6A 2ELZA 2L2KB 2EOJA 2LT7A 2R1FA 2EOQA 2PRTA 3F6GA 4L8NA 2V85A 4JI1E
chains in the Genus database with same CATH topology
3ADIA 1J26A 2VF1A 4OOGC 2B9DA 5AE1A 2VE7C 4JI0E 2V86A 4NXME 4GEQB 4BMJA 5AE3A 1IBLE 5LL6R 4X62E 5AASA 1X47A 2V83A 4BBYA 4DR3E 3HXLA 1ZBTA 3AV0A 4DR6E 3IWCA 3HPSA 4DV7E 4JI2E 4DV4E 5A2QC 4DR2E 2VQFE 1T4NA 4DUZE 2N3GA 2UUAE 1ZBQA 3C4TA 2JOBA 2V8QB 3P1XA 3T1YE 2KOUA 4X65E 2LJHA 2YT4A 4B3SE 2L92A 4X64E 2UXBE 2F8BA 3HPZA 2ODRD 3F6HA 3JAMC 3HTXA 5IWAE 1T4OA 4JI1E 4JI6E 4DV1E 2FTXB 4BCAA 2F4VE 2JY9A 2LBSB 1XNRE 4M2ZA 2EWLA 2KHXA 4YY3E 4YHHE 4X8WA 2JWOA 3J81C 2L2MA 2L3CA 4LF9E 1FKAE 1GQEA 4P7DA 3T1HE 2LE2A 2MDRA 2V88A 4JV5E 2FGGA 5BR8E 3VYXA 4DR5E 4JI7E 1XMQE 2IHR1 4B3ME 2RSMA 3JTZA 1GZ6A 1T4LB 1YYWA 1PKPA 2B7VA 3OMLA 4LF6E 2HHHE 2DSYA 4LF8E 2NA2A 1O0WA 4BS9A 4GKJE 2M4IA 2NUGA 2CPNA 1QU6A 2WZOA 1UHZA 3ADJA 2V89A 2G7HA 2E1MA 2LMZA 3K6QA 1YZ9A 4LTYA 1N33E 2YZTA 2UXDE 4GKKE 4NXNE 4WYQB 2LTSA 4R8OA 3H09A 4M0VA 3LMLA 4BC7A 1N36E 2DIXA 3VK6A 1N34E 4LF4E 3IWBA 2M7QA 2M1SA 4Q28A 4JI3E 1X49A 2LTRA 4OX9E 2L2NA 4P78A 4KZSA 2V87A 2B7TA 1HNXE 2NUEA 4F9AB 3RMPA 4LU9A 2N3HA 2UUBE 1FJGE 4K0KE 2L3JA 4LF5E 3DF6A 2JVAA 2RS7A 2NUFA 2K4VA 3J7Yp 1N32E 4J8ZA 5T6JA 3ZOQB 4BC9A 5LMUE 2B3TB 1STUA 5F3WA 1IBKE 2L33A 4AQYE 1XNQE 2DMYA 4DMIA 4DV3E 3HQ1A 2L8TA 1YYKA 3C4BA 5CFFE 1YYOA 1XMOE 4DR1E 1RC7A 2JR1A 1HR0E 3DJWA 5LMNE 1WXRA 2ODRC 4LFAE 4LFCE 5ADZA 4KHPE 4R03A 2VQEE 3MSWA 2JOXA 3OTOE 2UU9E 2E5LE 2UUCE 4LFBE 4I8OA 3ADGA 3ADLA 1EKZA 2DB2A 5AE2A 4B3TE 2LUQA 1WHNA 2MC6A 1RQ0A 2RS6A 4WPYA 1I94E 1HNWE 1HNZE 2KONA 4TUGA 3IWDA 3AUZA 4JI8E 3KWRA 1WHQA 1X48A 3J80C 4M30A 1J5EE 4DKKA 4L5NC 4F54A 4DUYE 1DQ3A 3JU0A 3VYYA 5FLXC 2LRSA 3FIGA 4TUIA 4LF7E 4B3RE 4JYAE 2H36X 3LLHA 4DV0E 1SR9A 2UXCE 5IT9C 2L6MA 2FV4B 4WFTA 2EZ6A 4DR4E 4DR7E 5DNYA 4JI4E 4DV6E 2L2KB 4WSPA 2LUPB 1DI2A 3J7AG 4X66E 1IBME 4F9CB 4JI5E 4F9BB 4DV5E 2MC5A 2RTXA 3F6GA 1UILA 4L8NA 2V85A 2ZM6E 4DV2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8Q B; 
#chains in the Genus database with same CATH topology
 1X6E A;  2EMH A;  4NXM E;  4BMJ A;  5LL6 R;  4X62 E;  5AAS A;  3C6M A;  2EM2 A;  1AAY A;  3BGH A;  4WXD A;  1BBO A;  4MLV A;  3HPS A;  2EPR A;  5A2Q C;  1T4N A;  2EOH A;  2N3G A;  1X5W A;  2EN8 A;  3C4T A;  3P1X A;  3T1Y E;  3C6K A;  2LJH A;  2UXB E;  3BID A;  3JAM C;  4RH8 A;  1WRJ A;  3HTX A;  3TQM A;  1PJT A;  5KL3 A;  3EPL A;  2F4V E;  4RHB B;  1XNR E;  2EOZ A;  4HTG A;  2EM8 A;  1N3G A;  2EMC A;  2JWO A;  2L2M A;  2YTQ A;  5A6B A;  2L3C A;  2V88 A;  1A1F A;  3VYX A;  4JV5 E;  2EPN A;  1A1I A;  2IHR 1;  1GZ6 A;  2B7V A;  2HHH E;  5A6A A;  4LF8 E;  2NA2 A;  1O0W A;  4BS9 A;  4GKJ E;  2M4I A;  1QU6 A;  2DMI A;  2HC5 A;  2R76 A;  2RQL A;  2MKN A;  5KL6 A;  2G7H A;  2LMZ A;  5A6K A;  2YTO A;  1N33 E;  2UXD E;  4WYQ B;  2NUG A;  4R8O A;  2BBG A;  3VK6 A;  2M7Q A;  4OX9 E;  4JI3 E;  2V87 A;  2B7T A;  4BHB A;  2RPC A;  2EN4 A;  4NZV A;  4LU9 A;  2N3H A;  2L3J A;  2JVA A;  2NUF A;  2EN1 A;  4BC9 A;  2B3T B;  4AQY E;  2EPP A;  1T38 A;  3C4B A;  1RC7 A;  5LMN E;  4LFC E;  2CT1 A;  2ODR C;  4R2C A;  2ELY A;  5ADZ A;  4R03 A;  3OTO E;  2E5L E;  3KZZ A;  4I8O A;  4R2A A;  3ADL A;  2LVH A;  5AE2 A;  2LUQ A;  3THO B;  4WPY A;  2YU5 A;  4R2S A;  5A6J A;  1MGT A;  2WBS A;  3IWD A;  3AUZ A;  4JI8 E;  3KWR A;  1WHQ A;  4M30 A;  1X6F A;  4DKK A;  3EPH A;  1YFH A;  4LF7 E;  2GHF A;  4B3R E;  5KL5 A;  2H36 X;  2EOR A;  4F6N A;  1B69 A;  2YWQ A;  4DR7 E;  1DI2 A;  3J7A G;  1IBM E;  2MC5 A;  2WBT A;  2RTX A;  1UIL A;  1MEY C;  1KYQ A;  1PDA A;  3ADI A;  2EML A;  2VF1 A;  5AE1 A;  2B9D A;  4JI0 E;  2EM9 A;  2EMZ A;  1IBL E;  4ZYG A;  4BBY A;  1G2D C;  4DR3 E;  3MHS C;  1ZBT A;  4DR6 E;  2EPL X;  3EQ1 A;  4DV7 E;  3EPJ A;  2EOF A;  4JI2 E;  4DUZ E;  4NHR A;  2EOS A;  2V8Q B;  2EMA A;  1YUI A;  1IMU A;  4WX9 A;  1A1H A;  4X9J A;  2F8B A;  3HPZ A;  2BB8 A;  5IWA E;  1T4O A;  4DV1 E;  4BCA A;  2NAB A;  4M2Z A;  2KHX A;  4YY3 E;  4X8W A;  1A1J A;  2DRP A;  1GQE A;  4P7D A;  3T1H E;  2MDR A;  5BR8 E;  2EPM X;  4DR5 E;  1XMQ E;  2RSM A;  1WJP A;  3KZY A;  4LF6 E;  1ZU1 A;  2JPA A;  1LLM C;  2EMG A;  3ADJ A;  1X3C A;  1UBD C;  2EM7 A;  1IQS A;  4LTY A;  2EN6 A;  1TF3 A;  3H09 A;  4M0V A;  4N4R B;  4LF4 E;  2DIX A;  4Q28 A;  1SFE A;  2LTR A;  5KL7 A;  4P78 A;  5AC4 A;  1HNX E;  2NUE A;  4ZYE A;  1KJK A;  2EQ0 A;  2EMB A;  1FJG E;  2UUB E;  4K0K E;  1P47 A;  4LF5 E;  2K4V A;  1N32 E;  4J8Z A;  5T6J A;  3ZOQ B;  5A69 A;  1PJS A;  1IBK E;  2LO3 A;  2DMY A;  1YYK A;  1ZR9 A;  1YYO A;  1XMO E;  4F2J C;  4M9V C;  1HR0 E;  3DJW A;  2WBU A;  4KHP E;  1UN6 B;  3MSW A;  2GPI A;  2UU9 E;  4LFB E;  3ADG A;  1EKZ A;  2EQ1 A;  2EPO A;  2KON A;  1TN9 A;  1ZAA C;  1X48 A;  2J7J A;  3EPK A;  3VYY A;  5FLX C;  3FIG A;  1SR9 A;  2UXC E;  1QNT A;  4IJD A;  2EPK X;  2FV4 B;  4WFT A;  2EZ6 A;  5DNY A;  4JI4 E;  4DV6 E;  4WSG A;  2LUP B;  2CSH A;  4X66 E;  4JI5 E;  2EPU A;  4DV2 E;  1J26 A;  2HGH A;  2VE7 C;  2YTD A;  2V86 A;  4R2P A;  2EMK A;  2LJU A;  1X47 A;  2V83 A;  3IWC A;  2YTN A;  2I13 A;  2M9A A;  1TF6 A;  4IS1 C;  2MKD A;  1T39 A;  1ZBQ A;  2KOU A;  4X65 E;  2L92 A;  2JXP A;  2E72 A;  2ODR D;  3F6H A;  2ENH A;  5IV8 B;  4F6M A;  1YPN A;  2LBS B;  2D9H A;  2EM6 A;  4YHH E;  3J81 C;  4LF9 E;  1FKA E;  2FGG A;  2EMW A;  4JI7 E;  3JTZ A;  1RMD A;  2DSY A;  2EM4 A;  2LCE A;  2JP9 A;  3UK3 C;  2LV2 A;  1UHZ A;  2YU8 A;  2EN3 A;  1DGC A;  2EOE A;  2EOY A;  2E1M A;  1IQO A;  2YZT A;  4NXN E;  1A1K A;  3L00 A;  2YTJ A;  2EQ3 A;  2LTS A;  1N36 E;  2EOX A;  4BC7 A;  2M1S A;  1X49 A;  2CTD A;  3RMP A;  1EH8 A;  3DF6 A;  2RS7 A;  5A6B D;  2YPN A;  2EOI A;  3J7Y p;  4O24 A;  1STU A;  2EN7 A;  1XNQ E;  4DMI A;  2L8T A;  2RSI A;  5CFF E;  3M99 B;  4DR1 E;  1WXR A;  2EM3 A;  2VRD A;  1NEI A;  2EMI A;  1GTK A;  2JOX A;  4WXC A;  4B3T E;  2WCC 3;  2MC6 A;  2EOO A;  1RQ0 A;  2K7I A;  1J5E E;  1NCS A;  1DQ3 A;  3JU0 A;  1EH6 A;  2LRS A;  4TUI A;  2DGC A;  2EL4 A;  3LLH A;  1Z1B A;  5IT9 C;  2L6M A;  2YSO A;  5KL4 A;  4WSP A;  4F9C B;  4F9B B;  4DV5 E;  2EOM A;  5KL2 A;  2ZM6 E;  4OOG C;  4R2D A;  4GEQ B;  5AE3 A;  3QG5 C;  2EM0 A;  2EMY A;  3HXL A;  3AV0 A;  1F2I G;  2YRH A;  4DV4 E;  4DR2 E;  2VQF E;  2ADR A;  4MLQ A;  1EH7 A;  2UUA E;  2JOB A;  5TSE A;  2YT4 A;  3BBG A;  4O5G A;  2EMF A;  4X64 E;  2EMX A;  4R2E A;  4B3S E;  1BBG A;  1PJQ A;  2YTI A;  4JI6 E;  2EPA A;  2FTX B;  2Q8U A;  2JY9 A;  2YTP A;  2EWL A;  3THN A;  1YSA C;  2EL5 A;  2LE2 A;  2JYA A;  4R2Q A;  2YSP A;  4O4K A;  4B3M E;  2DLK A;  4HEI A;  1T4L B;  1YYW A;  1PKP A;  4R2R A;  3OML A;  2EP3 A;  4O43 A;  2GLI A;  2CPN A;  2WZO A;  2V89 A;  4KWY A;  1YZ9 A;  3K6Q A;  4GKK E;  4BHC A;  3LML A;  3ECR A;  1N34 E;  3IWB A;  1A1L A;  2L2N A;  4KZS A;  2HJJ A;  4ZYH A;  4ZYD A;  4F9A B;  2YTE A;  5IXM B;  2YTF A;  5LMU E;  2EM5 A;  5F3W A;  2L33 A;  2ENC A;  1AH5 A;  3VHT B;  1JK2 A;  4DV3 E;  3HQ1 A;  2EPZ A;  1JK1 A;  2JR1 A;  4GZN C;  1X6H A;  4LFA E;  1L4S A;  2VQE E;  2MDG A;  3MHH C;  4FK5 C;  2A25 A;  2UUC E;  1BB8 A;  2EJ4 A;  1A1G A;  2DB2 A;  5LLQ A;  1WHN A;  2RS6 A;  1I94 E;  1HNW E;  1HNZ E;  2EN2 A;  4Q35 B;  4TUG A;  2YRK A;  2ENA A;  3J80 C;  2EPX A;  1G2F C;  4L5N C;  4F54 A;  4DUY E;  1YUJ A;  4JYA E;  3BF2 A;  2DLQ A;  2N8X A;  2EE8 A;  5AC5 A;  4DV0 E;  2EPC A;  2YRM A;  2I9I A;  2YTG A;  4DR4 E;  2EL6 A;  2ELZ A;  2L2K B;  2EOJ A;  2LT7 A;  2R1F A;  2EOQ A;  2PRT A;  3F6G A;  4L8N A;  2V85 A;  4JI1 E; 
#chains in the Genus database with same CATH homology
 3ADI A;  1J26 A;  2VF1 A;  4OOG C;  2B9D A;  5AE1 A;  2VE7 C;  4JI0 E;  2V86 A;  4NXM E;  4GEQ B;  4BMJ A;  5AE3 A;  1IBL E;  5LL6 R;  4X62 E;  5AAS A;  1X47 A;  2V83 A;  4BBY A;  4DR3 E;  3HXL A;  1ZBT A;  3AV0 A;  4DR6 E;  3IWC A;  3HPS A;  4DV7 E;  4JI2 E;  4DV4 E;  5A2Q C;  4DR2 E;  2VQF E;  1T4N A;  4DUZ E;  2N3G A;  2UUA E;  1ZBQ A;  3C4T A;  2JOB A;  2V8Q B;  3P1X A;  3T1Y E;  2KOU A;  4X65 E;  2LJH A;  2YT4 A;  4B3S E;  2L92 A;  4X64 E;  2UXB E;  2F8B A;  3HPZ A;  2ODR D;  3F6H A;  3JAM C;  3HTX A;  5IWA E;  1T4O A;  4JI1 E;  4JI6 E;  4DV1 E;  2FTX B;  4BCA A;  2F4V E;  2JY9 A;  2LBS B;  1XNR E;  4M2Z A;  2EWL A;  2KHX A;  4YY3 E;  4YHH E;  4X8W A;  2JWO A;  3J81 C;  2L2M A;  2L3C A;  4LF9 E;  1FKA E;  1GQE A;  4P7D A;  3T1H E;  2LE2 A;  2MDR A;  2V88 A;  4JV5 E;  2FGG A;  5BR8 E;  3VYX A;  4DR5 E;  4JI7 E;  1XMQ E;  2IHR 1;  4B3M E;  2RSM A;  3JTZ A;  1GZ6 A;  1T4L B;  1YYW A;  1PKP A;  2B7V A;  3OML A;  4LF6 E;  2HHH E;  2DSY A;  4LF8 E;  2NA2 A;  1O0W A;  4BS9 A;  4GKJ E;  2M4I A;  2NUG A;  2CPN A;  1QU6 A;  2WZO A;  1UHZ A;  3ADJ A;  2V89 A;  2G7H A;  2E1M A;  2LMZ A;  3K6Q A;  1YZ9 A;  4LTY A;  1N33 E;  2YZT A;  2UXD E;  4GKK E;  4NXN E;  4WYQ B;  2LTS A;  4R8O A;  3H09 A;  4M0V A;  3LML A;  4BC7 A;  1N36 E;  2DIX A;  3VK6 A;  1N34 E;  4LF4 E;  3IWB A;  2M7Q A;  2M1S A;  4Q28 A;  4JI3 E;  1X49 A;  2LTR A;  4OX9 E;  2L2N A;  4P78 A;  4KZS A;  2V87 A;  2B7T A;  1HNX E;  2NUE A;  4F9A B;  3RMP A;  4LU9 A;  2N3H A;  2UUB E;  1FJG E;  4K0K E;  2L3J A;  4LF5 E;  3DF6 A;  2JVA A;  2RS7 A;  2NUF A;  2K4V A;  3J7Y p;  1N32 E;  4J8Z A;  5T6J A;  3ZOQ B;  4BC9 A;  5LMU E;  2B3T B;  1STU A;  5F3W A;  1IBK E;  2L33 A;  4AQY E;  1XNQ E;  2DMY A;  4DMI A;  4DV3 E;  3HQ1 A;  2L8T A;  1YYK A;  3C4B A;  5CFF E;  1YYO A;  1XMO E;  4DR1 E;  1RC7 A;  2JR1 A;  1HR0 E;  3DJW A;  5LMN E;  1WXR A;  2ODR C;  4LFA E;  4LFC E;  5ADZ A;  4KHP E;  4R03 A;  2VQE E;  3MSW A;  2JOX A;  3OTO E;  2UU9 E;  2E5L E;  2UUC E;  4LFB E;  4I8O A;  3ADG A;  3ADL A;  1EKZ A;  2DB2 A;  5AE2 A;  4B3T E;  2LUQ A;  1WHN A;  2MC6 A;  1RQ0 A;  2RS6 A;  4WPY A;  1I94 E;  1HNW E;  1HNZ E;  2KON A;  4TUG A;  3IWD A;  3AUZ A;  4JI8 E;  3KWR A;  1WHQ A;  1X48 A;  3J80 C;  4M30 A;  1J5E E;  4DKK A;  4L5N C;  4F54 A;  4DUY E;  1DQ3 A;  3JU0 A;  3VYY A;  5FLX C;  2LRS A;  3FIG A;  4TUI A;  4LF7 E;  4B3R E;  4JYA E;  2H36 X;  3LLH A;  4DV0 E;  1SR9 A;  2UXC E;  5IT9 C;  2L6M A;  2FV4 B;  4WFT A;  2EZ6 A;  4DR4 E;  4DR7 E;  5DNY A;  4JI4 E;  4DV6 E;  2L2K B;  4WSP A;  2LUP B;  1DI2 A;  3J7A G;  4X66 E;  1IBM E;  4F9C B;  4JI5 E;  4F9B B;  4DV5 E;  2MC5 A;  2RTX A;  3F6G A;  1UIL A;  4L8N A;  2V85 A;  2ZM6 E;  4DV2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...