2V8QB

Crystal structure of the regulatory fragment of mammalian ampk in complexes with amp
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
83
structure length
73
Chain Sequence
b'GQEMYAFRSEERFKSPPILPPHLLQVILNKDTNPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 5
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.760 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v8qB00
2V8QB
chains in the Genus database with same CATH superfamily
2L33A 2JOBA 2DIXA 1IBME 1A1IA 1DI2A 4DR7E 4F54A 1PJTA 4N4RB 1KJKA 2YWQA 4JI4E 2LJUA 2IHR1 2EL4A 4B3RE 1T39A 2WCC3 2JXPA 4ZYGA 4IJDA 1G2FC 2V89A 4R2AA 2H36X 2EMCA 4DV3E 4JI5E 4P78A 2EPXA 4YY3E 3F6HA 2VQFE 2EM7A 2EOHA 1UHZA 3P1XA 1RQ0A 1SR9A 2FGGA 4JYAE 2DB2A 2M7QA 2EMGA 2EM9A 3AUZA 3EPLA 3IWCA 3KWRA 4MLQA 2JR1A 3MSWA 2L92A 2EOJA 4DR6E 4WXDA 2YZTA 4BHCA 1ZAAC 2YSPA 1NEIA 4RHBB 3VK6A 2EMHA 2EPOA 1L4SA 1RC7A 3TQMA 2L6MA 1FKAE 4B3ME 4NXME 2MC5A 4KWYA 2DRPA 5KL7A 5KL2A 1FJGE 2EOIA 1UN6B 2ODRD 1N36E 2EM2A 2Q8UA 4BMJA 1IMUA 2VF1A 2LUPB 1BBOA 1YYOA 2LTRA 3RMPA 3QG5C 5AASA 1GTKA 5F3WA 2EPZA 5LL6R 2EPMX 4P7DA 2HC5A 2EPRA 3BF2A 1X47A 1HNXE 4YHHE 2GPIA 4ZYHA 4R2RA 3J7AG 2UXDE 5KL5A 2NUEA 3EPKA 5AE2A 2EQ0A 1A1FA 2E72A 3C6KA 2YTEA 4DMIA 5LMNE 2EM0A 4DR3E 1AAYA 3ADGA 2RSIA 4F2JC 4ZYDA 5IWAE 4NXNE 2VRDA 3HPZA 4WPYA 3LMLA 2EJ4A 2K7IA 2UUCE 2EQ3A 2LT7A 2YTOA 1X3CA 2YTGA 2RS7A 4JI8E 3JTZA 1A1KA 1MEYC 2UUBE 2ODRC 3H09A 3UK3C 1X5WA 3VYXA 4GZNC 2M4IA 3C4BA 1AH5A 5A2QC 4DV0E 1WHQA 2YTQA 4WFTA 2N3GA 4WSPA 4WYQB 1YZ9A 1MGTA 2KOUA 1YYWA 5A69A 4LF9E 2EN8A 2L3CA 3JU0A 2MKDA 3T1YE 4M0VA 1EH8A 2FTXB 2LJHA 2JOXA 4K0KE 3J81C 2GHFA 3FIGA 4WX9A 1YUJA 2EN4A 2EOQA 4WXCA 2WBUA 3ADJA 2EOZA 2L8TA 3HTXA 1F2IG 5KL3A 1T38A 4F6NA 2JY9A 1HNZE 2R1FA 2RPCA 1IBLE 4X9JA 2VE7C 4I8OA 1SFEA 3AV0A 2NA2A 2CT1A 2UXCE 4JI6E 1IBKE 2LMZA 1BBGA 4TUIA 2YTPA 1YSAC 2J7JA 2LRSA 4R2DA 4R03A 2EPUA 2YT4A 4O43A 1I94E 4F9BB 1A1LA 1IQOA 5KL4A 3ADLA 5A6BD 1A1JA 4TUGA 1Z1BA 2EOXA 3K6QA 3HPSA 2CPNA 3KZYA 2RSMA 4R8OA 2B9DA 5T6JA 2FV4B 2EPKX 2F4VE 2YRHA 4BS9A 1DGCA 1J26A 4J8ZA 1PDAA 2YTFA 4F9CB 2EM8A 3MHHC 2ELZA 4BHBA 4DUZE 2L2MA 1EH6A 2RS6A 2BB8A 1NCSA 1BB8A 1XNRE 1PKPA 2RTXA 2DMYA 4F6MA 2YRKA 2B7VA 2EP3A 4HEIA 1UBDC 2ELYA 2G7HA 2CSHA 4BC7A 2EOFA 1GZ6A 4DV2E 4DR4E 2EMKA 2JPAA 2EN6A 2EPNA 2EZ6A 2V8QB 4DV7E 2EMLA 4L8NA 1T4OA 4LF7E 5DNYA 3M99B 2WZOA 3J80C 1G2DC 4JI7E 2V83A 3C6MA 2YRMA 4Q35B 2LBSB 4M30A 2V85A 4GKKE 5BR8E 2JYAA 4DR2E 2N3HA 4DV1E 2NUFA 4X65E 1XMOE 4JI3E 4LTYA 2ENAA 4R2EA 5LLQA 4DV5E 4R2CA 2JVAA 2EMXA 1HNWE 2EMYA 1UILA 2V86A 2F8BA 2YU5A 2EMWA 2L2NA 2MC6A 4LFAE 2EMZA 1O0WA 4JI1E 3JAMC 1WXRA 2EM5A 2R76A 1STUA 2LUQA 2EPLX 4X66E 3EPHA 2WBTA 2EN7A 3BGHA 1TN9A 4JV5E 5A6BA 1GQEA 1XMQE 4LFCE 2GLIA 2UU9E 2EOMA 5TSEA 2HHHE 2WBSA 2DSYA 4OOGC 2EM6A 2LVHA 1J5EE 2KHXA 3EPJA 3THOB 2L3JA 1JK1A 2JP9A 1QNTA 2UUAE 1T4NA 2EM4A 1TF3A 2A25A 1X6FA 4X62E 1A1HA 1X49A 1IQSA 4R2PA 2L2KB 1N3GA 2EL5A 2N8XA 4KHPE 2EN2A 4B3SE 2UXBE 1P47A 2RQLA 2YTDA 3L00A 5A6KA 1N32E 3DF6A 4LU9A 1WHNA 4JI0E 2B7TA 3EQ1A 1JK2A 2I13A 3F6GA 2M9AA 4LFBE 4GEQB 2YPNA 4F9AB 2ZM6E 4RH8A 4O5GA 2ENCA 4Q28A 5IV8B 1YYKA 4AQYE 4LF5E 2EQ1A 4DKKA 5AE1A 3VYYA 1ZR9A 1RMDA 3IWBA 4NZVA 2NUGA 2VQEE 4BC9A 2E5LE 4FK5C 3BIDA 1PJQA 1HR0E 3ADIA 2M1SA 5A6AA 3ECRA 1PJSA 2I9IA 5AC5A 2LTSA 4GKJE 2DMIA 1YPNA 4ZYEA 1YUIA 2V88A 4DUYE 1B69A 3HQ1A 2YTNA 2HGHA 1T4LB 1EH7A 3VHTB 2DLKA 2EL6A 3KZZA 1X6HA 2NABA 5AE3A 4KZSA 1WJPA 4DR5E 2K4VA 5AC4A 3LLHA 2JWOA 1N34E 2EORA 2EM3A 5LMUE 2MDGA 1N33E 2E1MA 2EMFA 5IT9C 2ENHA 2DGCA 4MLVA 2EPPA 2HJJA 3BBGA 2EPAA 2KONA 2LV2A 1ZU1A 2MDRA 4WSGA 5A6JA 4IS1C 1A1GA 5KL6A 4LF8E 2EMIA 4R2QA 3T1HE 3OMLA 2EWLA 1TF6A 1XNQE 3OTOE 3THNA 4L5NC 4OX9E 1DQ3A 4JI2E 2EOOA 2CTDA 2EMAA 4DR1E 1X6EA 2YSOA 1EKZA 4BCAA 4O4KA 2PRTA 2YU8A 4NHRA 4M9VC 1WRJA 2MKNA 5ADZA 2LO3A 3HXLA 2EPCA 1ZBQA 2EN3A 3MHSC 2EN1A 3IWDA 4X8WA 1YFHA 4R2SA 2EE8A 2LE2A 2D9HA 4LF4E 1KYQA 4DV4E 5CFFE 2ADRA 2DLQA 2EOYA 2YTJA 2EOSA 2EMBA 1LLMC 5FLXC 3C4TA 4M2ZA 1X48A 4X64E 3J7Yp 4B3TE 2V87A 2LCEA 1ZBTA 4O24A 5IXMB 1QU6A 4DV6E 4HTGA 3DJWA 2EOEA 4LF6E 2B3TB 3ZOQB 2YTIA 4BBYA 2BBGA
chains in the Genus database with same CATH topology
2L33A 1GZ6A 4DV2E 4LF5E 4DR4E 4DKKA 5AE1A 2JOBA 2DIXA 3VYYA 1IBME 3IWBA 2RS7A 2VQEE 2EZ6A 4BC9A 2NUGA 2E5LE 1DI2A 2V8QB 4JI8E 4F54A 3JTZA 4DV7E 4DR7E 1HR0E 3ADIA 2M1SA 2UUBE 4L8NA 2ODRC 1T4OA 4LF7E 5DNYA 3H09A 4JI4E 3VYXA 2IHR1 2LTSA 2M4IA 2WZOA 3C4BA 5A2QC 3J80C 4DV0E 4B3RE 4GKJE 1WHQA 2V88A 4DUYE 4WFTA 2N3GA 4JI7E 4WSPA 4WYQB 1YZ9A 2KOUA 3HQ1A 2V89A 2V83A 1YYWA 1T4LB 4LF9E 2H36X 4DV3E 2L3CA 3JU0A 2LBSB 4P78A 4M30A 4JI5E 2V85A 5BR8E 3T1YE 4YY3E 4M0VA 4DR2E 2N3HA 4DV1E 2NUFA 4X65E 2FTXB 3F6HA 2VQFE 5AE3A 2LJHA 1XMOE 4KZSA 4JI3E 4LTYA 2JOXA 4K0KE 4DV5E 3J81C 2JVAA 4DR5E 1UHZA 2K4VA 3FIGA 3P1XA 3LLHA 1RQ0A 2JWOA 1N34E 1SR9A 2FGGA 1HNWE 5LMUE 4JYAE 2DB2A 3ADJA 2M7QA 1N33E 1UILA 2E1MA 2L8TA 3AUZA 2V86A 2F8BA 3IWCA 2MC6A 2L2NA 3KWRA 3HTXA 5IT9C 2JR1A 4LFAE 1O0WA 3MSWA 2L92A 4DR6E 2JY9A 4JI1E 3JAMC 1WXRA 2YZTA 1HNZE 1STUA 2KONA 4GKKE 2MDRA 1IBLE 2LUQA 2VE7C 4I8OA 3VK6A 4LF8E 3T1HE 4X66E 3AV0A 2NA2A 3OMLA 2EWLA 4JV5E 2UXCE 1XNQE 3OTOE 4BBYA 1GQEA 4L5NC 1DQ3A 1XMQE 1IBKE 2LMZA 4JI6E 1RC7A 4JI2E 4LFCE 4TUIA 2L6MA 1FKAE 4B3ME 4NXME 2MC5A 4DR1E 2UU9E 2HHHE 1EKZA 1FJGE 4OX9E 2LRSA 4BCAA 4R03A 2YT4A 2DSYA 4OOGC 2ODRD 1I94E 4F9BB 1N36E 3ADLA 4BMJA 1J5EE 2VF1A 2KHXA 5ADZA 2LUPB 2L3JA 3HXLA 1YYOA 2LTRA 1ZBQA 4TUGA 3RMPA 3K6QA 5AASA 2UUAE 5F3WA 3IWDA 4X8WA 3HPSA 2CPNA 5LL6R 1T4NA 2LE2A 2RSMA 4P7DA 4R8OA 4LF4E 1X47A 1HNXE 2B9DA 5T6JA 4DV4E 2FV4B 5CFFE 4YHHE 2F4VE 4X62E 4BS9A 5FLXC 1X49A 4J8ZA 4F9CB 3J7AG 1J26A 2UXDE 3C4TA 4M2ZA 2L2KB 4DUZE 2L2MA 1X48A 2NUEA 2RS6A 4X64E 4KHPE 3J7Yp 5AE2A 4B3SE 4B3TE 1XNRE 2UXBE 1PKPA 2V87A 2RTXA 4DMIA 5LMNE 1ZBTA 4DR3E 3ADGA 1N32E 3DF6A 2DMYA 1WHNA 4LU9A 4JI0E 1QU6A 4DV6E 5IWAE 3DJWA 4NXNE 4LF6E 2B7VA 2B7TA 2B3TB 3HPZA 4WPYA 3ZOQB 3F6GA 3LMLA 4LFBE 4GEQB 4F9AB 2G7HA 2ZM6E 1YYKA 4Q28A 4BC7A 2UUCE 4AQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8Q B; 
#chains in the Genus database with same CATH topology
 2L33 A;  2JOB A;  2DIX A;  1IBM E;  1A1I A;  1DI2 A;  4DR7 E;  4F54 A;  1PJT A;  4N4R B;  1KJK A;  2YWQ A;  4JI4 E;  2LJU A;  2IHR 1;  2EL4 A;  4B3R E;  1T39 A;  2WCC 3;  2JXP A;  4ZYG A;  4IJD A;  1G2F C;  2V89 A;  4R2A A;  2H36 X;  2EMC A;  4DV3 E;  4JI5 E;  4P78 A;  2EPX A;  4YY3 E;  3F6H A;  2VQF E;  2EM7 A;  2EOH A;  1UHZ A;  3P1X A;  1RQ0 A;  1SR9 A;  2FGG A;  4JYA E;  2DB2 A;  2M7Q A;  2EMG A;  2EM9 A;  3AUZ A;  3EPL A;  3IWC A;  3KWR A;  4MLQ A;  2JR1 A;  3MSW A;  2L92 A;  2EOJ A;  4DR6 E;  4WXD A;  2YZT A;  4BHC A;  1ZAA C;  2YSP A;  1NEI A;  4RHB B;  3VK6 A;  2EMH A;  2EPO A;  1L4S A;  1RC7 A;  3TQM A;  2L6M A;  1FKA E;  4B3M E;  4NXM E;  2MC5 A;  4KWY A;  2DRP A;  5KL7 A;  5KL2 A;  1FJG E;  2EOI A;  1UN6 B;  2ODR D;  1N36 E;  2EM2 A;  2Q8U A;  4BMJ A;  1IMU A;  2VF1 A;  2LUP B;  1BBO A;  1YYO A;  2LTR A;  3RMP A;  3QG5 C;  5AAS A;  1GTK A;  5F3W A;  2EPZ A;  5LL6 R;  2EPM X;  4P7D A;  2HC5 A;  2EPR A;  3BF2 A;  1X47 A;  1HNX E;  4YHH E;  2GPI A;  4ZYH A;  4R2R A;  3J7A G;  2UXD E;  5KL5 A;  2NUE A;  3EPK A;  5AE2 A;  2EQ0 A;  1A1F A;  2E72 A;  3C6K A;  2YTE A;  4DMI A;  5LMN E;  2EM0 A;  4DR3 E;  1AAY A;  3ADG A;  2RSI A;  4F2J C;  4ZYD A;  5IWA E;  4NXN E;  2VRD A;  3HPZ A;  4WPY A;  3LML A;  2EJ4 A;  2K7I A;  2UUC E;  2EQ3 A;  2LT7 A;  2YTO A;  1X3C A;  2YTG A;  2RS7 A;  4JI8 E;  3JTZ A;  1A1K A;  1MEY C;  2UUB E;  2ODR C;  3H09 A;  3UK3 C;  1X5W A;  3VYX A;  4GZN C;  2M4I A;  3C4B A;  1AH5 A;  5A2Q C;  4DV0 E;  1WHQ A;  2YTQ A;  4WFT A;  2N3G A;  4WSP A;  4WYQ B;  1YZ9 A;  1MGT A;  2KOU A;  1YYW A;  5A69 A;  4LF9 E;  2EN8 A;  2L3C A;  3JU0 A;  2MKD A;  3T1Y E;  4M0V A;  1EH8 A;  2FTX B;  2LJH A;  2JOX A;  4K0K E;  3J81 C;  2GHF A;  3FIG A;  4WX9 A;  1YUJ A;  2EN4 A;  2EOQ A;  4WXC A;  2WBU A;  3ADJ A;  2EOZ A;  2L8T A;  3HTX A;  1F2I G;  5KL3 A;  1T38 A;  4F6N A;  2JY9 A;  1HNZ E;  2R1F A;  2RPC A;  1IBL E;  4X9J A;  2VE7 C;  4I8O A;  1SFE A;  3AV0 A;  2NA2 A;  2CT1 A;  2UXC E;  4JI6 E;  1IBK E;  2LMZ A;  1BBG A;  4TUI A;  2YTP A;  1YSA C;  2J7J A;  2LRS A;  4R2D A;  4R03 A;  2EPU A;  2YT4 A;  4O43 A;  1I94 E;  4F9B B;  1A1L A;  1IQO A;  5KL4 A;  3ADL A;  5A6B D;  1A1J A;  4TUG A;  1Z1B A;  2EOX A;  3K6Q A;  3HPS A;  2CPN A;  3KZY A;  2RSM A;  4R8O A;  2B9D A;  5T6J A;  2FV4 B;  2EPK X;  2F4V E;  2YRH A;  4BS9 A;  1DGC A;  1J26 A;  4J8Z A;  1PDA A;  2YTF A;  4F9C B;  2EM8 A;  3MHH C;  2ELZ A;  4BHB A;  4DUZ E;  2L2M A;  1EH6 A;  2RS6 A;  2BB8 A;  1NCS A;  1BB8 A;  1XNR E;  1PKP A;  2RTX A;  2DMY A;  4F6M A;  2YRK A;  2B7V A;  2EP3 A;  4HEI A;  1UBD C;  2ELY A;  2G7H A;  2CSH A;  4BC7 A;  2EOF A;  1GZ6 A;  4DV2 E;  4DR4 E;  2EMK A;  2JPA A;  2EN6 A;  2EPN A;  2EZ6 A;  2V8Q B;  4DV7 E;  2EML A;  4L8N A;  1T4O A;  4LF7 E;  5DNY A;  3M99 B;  2WZO A;  3J80 C;  1G2D C;  4JI7 E;  2V83 A;  3C6M A;  2YRM A;  4Q35 B;  2LBS B;  4M30 A;  2V85 A;  4GKK E;  5BR8 E;  2JYA A;  4DR2 E;  2N3H A;  4DV1 E;  2NUF A;  4X65 E;  1XMO E;  4JI3 E;  4LTY A;  2ENA A;  4R2E A;  5LLQ A;  4DV5 E;  4R2C A;  2JVA A;  2EMX A;  1HNW E;  2EMY A;  1UIL A;  2V86 A;  2F8B A;  2YU5 A;  2EMW A;  2L2N A;  2MC6 A;  4LFA E;  2EMZ A;  1O0W A;  4JI1 E;  3JAM C;  1WXR A;  2EM5 A;  2R76 A;  1STU A;  2LUQ A;  2EPL X;  4X66 E;  3EPH A;  2WBT A;  2EN7 A;  3BGH A;  1TN9 A;  4JV5 E;  5A6B A;  1GQE A;  1XMQ E;  4LFC E;  2GLI A;  2UU9 E;  2EOM A;  5TSE A;  2HHH E;  2WBS A;  2DSY A;  4OOG C;  2EM6 A;  2LVH A;  1J5E E;  2KHX A;  3EPJ A;  3THO B;  2L3J A;  1JK1 A;  2JP9 A;  1QNT A;  2UUA E;  1T4N A;  2EM4 A;  1TF3 A;  2A25 A;  1X6F A;  4X62 E;  1A1H A;  1X49 A;  1IQS A;  4R2P A;  2L2K B;  1N3G A;  2EL5 A;  2N8X A;  4KHP E;  2EN2 A;  4B3S E;  2UXB E;  1P47 A;  2RQL A;  2YTD A;  3L00 A;  5A6K A;  1N32 E;  3DF6 A;  4LU9 A;  1WHN A;  4JI0 E;  2B7T A;  3EQ1 A;  1JK2 A;  2I13 A;  3F6G A;  2M9A A;  4LFB E;  4GEQ B;  2YPN A;  4F9A B;  2ZM6 E;  4RH8 A;  4O5G A;  2ENC A;  4Q28 A;  5IV8 B;  1YYK A;  4AQY E;  4LF5 E;  2EQ1 A;  4DKK A;  5AE1 A;  3VYY A;  1ZR9 A;  1RMD A;  3IWB A;  4NZV A;  2NUG A;  2VQE E;  4BC9 A;  2E5L E;  4FK5 C;  3BID A;  1PJQ A;  1HR0 E;  3ADI A;  2M1S A;  5A6A A;  3ECR A;  1PJS A;  2I9I A;  5AC5 A;  2LTS A;  4GKJ E;  2DMI A;  1YPN A;  4ZYE A;  1YUI A;  2V88 A;  4DUY E;  1B69 A;  3HQ1 A;  2YTN A;  2HGH A;  1T4L B;  1EH7 A;  3VHT B;  2DLK A;  2EL6 A;  3KZZ A;  1X6H A;  2NAB A;  5AE3 A;  4KZS A;  1WJP A;  4DR5 E;  2K4V A;  5AC4 A;  3LLH A;  2JWO A;  1N34 E;  2EOR A;  2EM3 A;  5LMU E;  2MDG A;  1N33 E;  2E1M A;  2EMF A;  5IT9 C;  2ENH A;  2DGC A;  4MLV A;  2EPP A;  2HJJ A;  3BBG A;  2EPA A;  2KON A;  2LV2 A;  1ZU1 A;  2MDR A;  4WSG A;  5A6J A;  4IS1 C;  1A1G A;  5KL6 A;  4LF8 E;  2EMI A;  4R2Q A;  3T1H E;  3OML A;  2EWL A;  1TF6 A;  1XNQ E;  3OTO E;  3THN A;  4L5N C;  4OX9 E;  1DQ3 A;  4JI2 E;  2EOO A;  2CTD A;  2EMA A;  4DR1 E;  1X6E A;  2YSO A;  1EKZ A;  4BCA A;  4O4K A;  2PRT A;  2YU8 A;  4NHR A;  4M9V C;  1WRJ A;  2MKN A;  5ADZ A;  2LO3 A;  3HXL A;  2EPC A;  1ZBQ A;  2EN3 A;  3MHS C;  2EN1 A;  3IWD A;  4X8W A;  1YFH A;  4R2S A;  2EE8 A;  2LE2 A;  2D9H A;  4LF4 E;  1KYQ A;  4DV4 E;  5CFF E;  2ADR A;  2DLQ A;  2EOY A;  2YTJ A;  2EOS A;  2EMB A;  1LLM C;  5FLX C;  3C4T A;  4M2Z A;  1X48 A;  4X64 E;  3J7Y p;  4B3T E;  2V87 A;  2LCE A;  1ZBT A;  4O24 A;  5IXM B;  1QU6 A;  4DV6 E;  4HTG A;  3DJW A;  2EOE A;  4LF6 E;  2B3T B;  3ZOQ B;  2YTI A;  4BBY A;  2BBG A; 
#chains in the Genus database with same CATH homology
 2L33 A;  1GZ6 A;  4DV2 E;  4LF5 E;  4DR4 E;  4DKK A;  5AE1 A;  2JOB A;  2DIX A;  3VYY A;  1IBM E;  3IWB A;  2RS7 A;  2VQE E;  2EZ6 A;  4BC9 A;  2NUG A;  2E5L E;  1DI2 A;  2V8Q B;  4JI8 E;  4F54 A;  3JTZ A;  4DV7 E;  4DR7 E;  1HR0 E;  3ADI A;  2M1S A;  2UUB E;  4L8N A;  2ODR C;  1T4O A;  4LF7 E;  5DNY A;  3H09 A;  4JI4 E;  3VYX A;  2IHR 1;  2LTS A;  2M4I A;  2WZO A;  3C4B A;  5A2Q C;  3J80 C;  4DV0 E;  4B3R E;  4GKJ E;  1WHQ A;  2V88 A;  4DUY E;  4WFT A;  2N3G A;  4JI7 E;  4WSP A;  4WYQ B;  1YZ9 A;  2KOU A;  3HQ1 A;  2V89 A;  2V83 A;  1YYW A;  1T4L B;  4LF9 E;  2H36 X;  4DV3 E;  2L3C A;  3JU0 A;  2LBS B;  4P78 A;  4M30 A;  4JI5 E;  2V85 A;  5BR8 E;  3T1Y E;  4YY3 E;  4M0V A;  4DR2 E;  2N3H A;  4DV1 E;  2NUF A;  4X65 E;  2FTX B;  3F6H A;  2VQF E;  5AE3 A;  2LJH A;  1XMO E;  4KZS A;  4JI3 E;  4LTY A;  2JOX A;  4K0K E;  4DV5 E;  3J81 C;  2JVA A;  4DR5 E;  1UHZ A;  2K4V A;  3FIG A;  3P1X A;  3LLH A;  1RQ0 A;  2JWO A;  1N34 E;  1SR9 A;  2FGG A;  1HNW E;  5LMU E;  4JYA E;  2DB2 A;  3ADJ A;  2M7Q A;  1N33 E;  1UIL A;  2E1M A;  2L8T A;  3AUZ A;  2V86 A;  2F8B A;  3IWC A;  2MC6 A;  2L2N A;  3KWR A;  3HTX A;  5IT9 C;  2JR1 A;  4LFA E;  1O0W A;  3MSW A;  2L92 A;  4DR6 E;  2JY9 A;  4JI1 E;  3JAM C;  1WXR A;  2YZT A;  1HNZ E;  1STU A;  2KON A;  4GKK E;  2MDR A;  1IBL E;  2LUQ A;  2VE7 C;  4I8O A;  3VK6 A;  4LF8 E;  3T1H E;  4X66 E;  3AV0 A;  2NA2 A;  3OML A;  2EWL A;  4JV5 E;  2UXC E;  1XNQ E;  3OTO E;  4BBY A;  1GQE A;  4L5N C;  1DQ3 A;  1XMQ E;  1IBK E;  2LMZ A;  4JI6 E;  1RC7 A;  4JI2 E;  4LFC E;  4TUI A;  2L6M A;  1FKA E;  4B3M E;  4NXM E;  2MC5 A;  4DR1 E;  2UU9 E;  2HHH E;  1EKZ A;  1FJG E;  4OX9 E;  2LRS A;  4BCA A;  4R03 A;  2YT4 A;  2DSY A;  4OOG C;  2ODR D;  1I94 E;  4F9B B;  1N36 E;  3ADL A;  4BMJ A;  1J5E E;  2VF1 A;  2KHX A;  5ADZ A;  2LUP B;  2L3J A;  3HXL A;  1YYO A;  2LTR A;  1ZBQ A;  4TUG A;  3RMP A;  3K6Q A;  5AAS A;  2UUA E;  5F3W A;  3IWD A;  4X8W A;  3HPS A;  2CPN A;  5LL6 R;  1T4N A;  2LE2 A;  2RSM A;  4P7D A;  4R8O A;  4LF4 E;  1X47 A;  1HNX E;  2B9D A;  5T6J A;  4DV4 E;  2FV4 B;  5CFF E;  4YHH E;  2F4V E;  4X62 E;  4BS9 A;  5FLX C;  1X49 A;  4J8Z A;  4F9C B;  3J7A G;  1J26 A;  2UXD E;  3C4T A;  4M2Z A;  2L2K B;  4DUZ E;  2L2M A;  1X48 A;  2NUE A;  2RS6 A;  4X64 E;  4KHP E;  3J7Y p;  5AE2 A;  4B3S E;  4B3T E;  1XNR E;  2UXB E;  1PKP A;  2V87 A;  2RTX A;  4DMI A;  5LMN E;  1ZBT A;  4DR3 E;  3ADG A;  1N32 E;  3DF6 A;  2DMY A;  1WHN A;  4LU9 A;  4JI0 E;  1QU6 A;  4DV6 E;  5IWA E;  3DJW A;  4NXN E;  4LF6 E;  2B7V A;  2B7T A;  2B3T B;  3HPZ A;  4WPY A;  3ZOQ B;  3F6G A;  3LML A;  4LFB E;  4GEQ B;  4F9A B;  2G7H A;  2ZM6 E;  1YYK A;  4Q28 A;  4BC7 A;  2UUC E;  4AQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...