2V8QB

Crystal structure of the regulatory fragment of mammalian ampk in complexes with amp
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
83
structure length
73
Chain Sequence
GQEMYAFRSEERFKSPPILPPHLLQVILNKDTNPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 5
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.760 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v8qB00
2V8QB
chains in the Genus database with same CATH superfamily
1XMOE 5KL2A 3VK6A 4F9BB 4M2ZA 2EQ3A 2FGGA 2EMYA 1X6EA 1N33E 3HPSA 1ZR9A 4JI2E 1EKZA 2PRTA 2LE2A 3C4BA 4J8ZA 1YZ9A 4Q28A 2YTNA 4F9CB 1N32E 2EOQA 2EOFA 4O4KA 1DGCA 3JU0A 3BGHA 2R76A 1X47A 2DB2A 4R2QA 4DV6E 1N36E 4LF6E 2EMKA 2EM6A 2ELYA 2JOBA 2EPOA 4LF5E 3J7AG 4B3ME 1L4SA 2FTXB 5FLXC 3J7Yp 1TF6A 2B7VA 1T4LB 4B3SE 4DV5E 4BS9A 4YHHE 5KL3A 2EN8A 3IWCA 1MGTA 1JK1A 2RSMA 2EN3A 2EMIA 3LMLA 4ZYHA 5A6JA 1HNWE 2EM9A 2YU8A 4F6NA 2MDGA 4M30A 4YY3E 4DR3E 1T4NA 2K4VA 2E5LE 1YYKA 2ELZA 2EOYA 1DI2A 1P47A 3K6QA 2HC5A 4JI8E 1WXRA 3F6HA 2EPKX 4ZYGA 2BB8A 2DIXA 1ZU1A 2LVHA 4LTYA 4BCAA 2JR1A 4R2AA 4DV3E 4X62E 2R1FA 4R8OA 3ZOQB 2EPRA 1MEYC 1EH8A 2LTSA 2EOHA 2DMYA 2J7JA 3RMPA 4F9AB 2DMIA 2LV2A 2Q8UA 3DF6A 2EPZA 2EN4A 2HHHE 2ENCA 2NUGA 2NUFA 1XNRE 4K0KE 4IJDA 4O43A 4BC9A 4R2DA 3JAMC 2GHFA 1UBDC 2EPCA 5IWAE 1G2DC 2YTDA 1X5WA 1TF3A 4WXCA 1X49A 2LBSB 1N34E 1YPNA 5BR8E 4JI6E 4JI4E 2EM4A 4O5GA 2UXBE 5TSEA 3IWBA 2EWLA 3HTXA 2UUCE 5A69A 2LUQA 2L2NA 2YTOA 2N3HA 2ODRC 2V83A 1ZBQA 4DKKA 1GQEA 2B3TB 2EOJA 4BMJA 1IQOA 3ECRA 2L92A 2EMGA 3VYXA 4LFCE 3HXLA 2B7TA 3J80C 4GKKE 2EM3A 2MKDA 4JI3E 4M9VC 1UN6B 3BIDA 4I8OA 1BBGA 4X64E 2VRDA 1GTKA 2YTGA 4LFAE 3C6MA 2EM0A 4TUGA 4X8WA 1T38A 4LF4E 2YTQA 5CFFE 3MHHC 2MDRA 3FIGA 2EPMX 2G7HA 2HGHA 4BHCA 2WCC3 2EMXA 3EPJA 2YRKA 2YSOA 4DR2E 1B69A 4IS1C 2I9IA 2CT1A 4NXNE 4BBYA 5KL4A 2LUPB 2MKNA 4JI5E 2DLKA 2RPCA 1KYQA 2RS6A 2WBUA 4HTGA 4F2JC 5AASA 1WHNA 2ZM6E 1BBOA 1IBME 4LF8E 2V8QB 3P1XA 2YU5A 2L3CA 3VHTB 2LCEA 2EE8A 2E72A 5A2QC 1UILA 4F54A 1YYOA 3MSWA 4B3TE 5ADZA 5KL5A 2JWOA 4KWYA 2VQFE 3EPLA 1FKAE 2EMBA 1UHZA 2EQ1A 2YRMA 1ZBTA 1RC7A 3ADJA 2LMZA 4P7DA 4P78A 2LJHA 2UUAE 1WRJA 4DMIA 4R2CA 2JPAA 4JI7E 3HQ1A 4LF9E 2YT4A 3IWDA 4MLQA 3OTOE 2EMLA 2JVAA 4DV2E 4LF7E 2V86A 2NABA 2EORA 2N3GA 2RS7A 4R2EA 4FK5C 4OX9E 2MC5A 5IXMB 2VQEE 2EL6A 1WJPA 5LMUE 3ADIA 2L8TA 4JI0E 4Q35B 1A1LA 2D9HA 2EZ6A 2IHR1 1NCSA 3QG5C 5IV8B 4GKJE 2EM2A 4KZSA 1XNQE 4AQYE 1A1JA 3J81C 4R2PA 2L2KB 2EN7A 4RH8A 2ADRA 3EQ1A 1J5EE 2EL5A 4L5NC 2EM5A 2FV4B 3KZZA 1IQSA 1F2IG 2YTIA 2EOXA 1RQ0A 4JI1E 4NXME 1KJKA 2KHXA 2EN2A 4DUYE 5F3WA 2ODRD 1HR0E 1A1HA 1PKPA 2EP3A 4X9JA 2EOIA 1X48A 3EPKA 1YFHA 2KOUA 1AH5A 1YSAC 2L6MA 5DNYA 4JV5E 2YZTA 1NEIA 1O0WA 2LJUA 4DUZE 1HNXE 4NZVA 2CSHA 2CTDA 3M99B 1YUJA 2EPPA 2VF1A 4F6MA 2RSIA 2DGCA 4R03A 2JP9A 2LRSA 2YTPA 4MLVA 3OMLA 3KZYA 3ADGA 1QU6A 2E1MA 3THNA 1WHQA 2UUBE 2YSPA 2F4VE 2EOZA 2CPNA 4X66E 1GZ6A 2YPNA 5A6AA 1T39A 2EL4A 1TN9A 2JXPA 2DLQA 1J26A 1STUA 2DSYA 3THOB 3UK3C 2EOSA 1DQ3A 2LO3A 2WBTA 3L00A 1JK2A 2EMZA 4KHPE 2L33A 2JY9A 2V88A 1YUIA 1PDAA 2EMAA 1Z1BA 4M0VA 2EPAA 4N4RB 4WXDA 2LTRA 2K7IA 5A6BD 2EMCA 3F6GA 5AE3A 1QNTA 2NUEA 4GEQB 2UXDE 2EMHA 2HJJA 2UU9E 4DR6E 2EMWA 3T1HE 2DRPA 2EM7A 2F8BA 4GZNC 1N3GA 3BBGA 5AE2A 4DV1E 1SFEA 5LL6R 5A6BA 4DV7E 1IMUA 3MHSC 5T6JA 4LU9A 4R2RA 2V87A 1A1IA 2YWQA 2RTXA 3DJWA 2V89A 2JOXA 1X6HA 3T1YE 2RQLA 2YTJA 1A1FA 2I13A 3HPZA 2WZOA 4DV4E 2YRHA 5IT9C 4BHBA 2M4IA 2ENHA 1I94E 4ZYDA 3ADLA 2L3JA 1FJGE 1BB8A 1A1KA 2V85A 4WSPA 2NA2A 1SR9A 1IBLE 1EH7A 1XMQE 1YYWA 4O24A 2B9DA 2L2MA 4R2SA 3AUZA 3KWRA 5AC5A 4DR1E 2WBSA 2LT7A 1T4OA 1A1GA 4WX9A 3AV0A 5AE1A 2M1SA 4WPYA 4JYAE 2JYAA 1RMDA 4L8NA 1PJTA 1G2FC 2GPIA 4DV0E 4DR5E 2M7QA 1LLMC 3EPHA 2YTEA 2EM8A 2EN6A 2EQ0A 2H36X 3VYYA 1PJQA 2VE7C 4RHBB 2GLIA 4WFTA 2ENAA 2EPLX 2N8XA 3LLHA 2A25A 2EOEA 4DR4E 4HEIA 4LFBE 5AC4A 2EJ4A 4BC7A 3TQMA 1IBKE 4ZYEA 3BF2A 4DR7E 1PJSA 4B3RE 2YTFA 2EMFA 5A6KA 1ZAAC 4NHRA 5LLQA 2KONA 2EPUA 3JTZA 5KL7A 5KL6A 4OOGC 2M9AA 2MC6A 1EH6A 2EOOA 4TUIA 5LMNE 3H09A 1HNZE 2UXCE 1AAYA 4X65E 4WYQB 1X3CA 3C4TA 1X6FA 2EPNA 3C6KA 2EN1A 2EOMA 2BBGA 4WSGA 2EPXA
chains in the Genus database with same CATH topology
1XMOE 3VK6A 2EZ6A 5LL6R 4F9BB 4DV7E 4M2ZA 2B3TB 5T6JA 4BMJA 2FGGA 4LU9A 1N33E 2V87A 4GKJE 2L92A 3HPSA 4KZSA 1XNQE 4AQYE 4JI2E 3VYXA 4LFCE 2RTXA 3DJWA 2B7TA 3HXLA 3J80C 2V89A 3J81C 2L2KB 2JOXA 1EKZA 2LE2A 4GKKE 3C4BA 4J8ZA 1YZ9A 3T1YE 4Q28A 4F9CB 4JI3E 1N32E 1J5EE 3HPZA 2WZOA 4L5NC 4I8OA 4DV4E 2FV4B 3JU0A 1X47A 2DB2A 5IT9C 2M4IA 1I94E 4X64E 3ADLA 4DV6E 1N36E 2L3JA 4LF6E 1FJGE 4LFAE 2JOBA 1RQ0A 2V85A 4JI1E 4WSPA 2NA2A 1SR9A 4X8WA 4TUGA 1IBLE 1XMQE 4LF4E 4NXME 4LF5E 1YYWA 2KHXA 3J7AG 2B9DA 2L2MA 4B3ME 2FTXB 5CFFE 5FLXC 3J7Yp 4DUYE 2MDRA 2B7VA 3AUZA 3KWRA 5F3WA 4DR1E 3FIGA 2ODRD 1T4LB 2G7HA 1HR0E 4DV5E 4BS9A 4YHHE 4B3SE 1PKPA 3IWCA 1X48A 2KOUA 2RSMA 4DR2E 1T4OA 2L6MA 3AV0A 5DNYA 4JV5E 3LMLA 5AE1A 4NXNE 4BBYA 2M1SA 4WPYA 1HNWE 4JYAE 2LUPB 2YZTA 1O0WA 4YY3E 4M30A 2E5LE 4DR3E 1T4NA 2K4VA 4JI5E 1YYKA 4DUZE 1HNXE 2RS6A 1DI2A 4L8NA 3K6QA 4JI8E 1WXRA 3F6HA 2VF1A 2DIXA 4DV0E 4DR5E 5AASA 1WHNA 4LTYA 2LRSA 4R03A 2JR1A 2M7QA 4BCAA 4X62E 2ZM6E 4DV3E 2V8QB 1IBME 3P1XA 4LF8E 4R8OA 2L3CA 3ZOQB 3OMLA 5A2QC 3ADGA 1QU6A 1UILA 2E1MA 1WHQA 3MSWA 2LTSA 4F54A 1YYOA 2UUBE 4B3TE 5ADZA 2DMYA 2JWOA 2H36X 2VQFE 3RMPA 4F9AB 1FKAE 3VYYA 2F4VE 2VE7C 2CPNA 4X66E 1GZ6A 3DF6A 1UHZA 4WFTA 4DV1E 1J26A 1ZBTA 1RC7A 2HHHE 1STUA 3ADJA 3LLHA 2DSYA 2LMZA 4P7DA 4P78A 2NUGA 4DR4E 1DQ3A 2NUFA 2LJHA 1XNRE 2UUAE 4K0KE 4KHPE 4LFBE 2L33A 4BC7A 2JY9A 4BC9A 3JAMC 4DMIA 2V88A 1IBKE 4DR7E 4JI7E 5IWAE 3HQ1A 4M0VA 4LF9E 4B3RE 2YT4A 3IWDA 3OTOE 2JVAA 2LTRA 4DV2E 3F6GA 1X49A 2V86A 5AE3A 2LBSB 2KONA 4LF7E 2NUEA 3JTZA 1N34E 2N3GA 4OOGC 2RS7A 5BR8E 4JI6E 4JI4E 4GEQB 2MC6A 2UXDE 2UXBE 4TUIA 5LMNE 2UU9E 4DR6E 4OX9E 2MC5A 3H09A 3IWBA 2EWLA 3T1HE 1HNZE 2VQEE 2F8BA 3HTXA 2UXCE 2UUCE 4X65E 4WYQB 2LUQA 5LMUE 2L8TA 3ADIA 4JI0E 2L2NA 3C4TA 2N3HA 5AE2A 2ODRC 2V83A 1ZBQA 4DKKA 1GQEA 2IHR1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8Q B; 
#chains in the Genus database with same CATH topology
 1XMO E;  5KL2 A;  3VK6 A;  4F9B B;  4M2Z A;  2EQ3 A;  2FGG A;  2EMY A;  1X6E A;  1N33 E;  3HPS A;  1ZR9 A;  4JI2 E;  1EKZ A;  2PRT A;  2LE2 A;  3C4B A;  4J8Z A;  1YZ9 A;  4Q28 A;  2YTN A;  4F9C B;  1N32 E;  2EOQ A;  2EOF A;  4O4K A;  1DGC A;  3JU0 A;  3BGH A;  2R76 A;  1X47 A;  2DB2 A;  4R2Q A;  4DV6 E;  1N36 E;  4LF6 E;  2EMK A;  2EM6 A;  2ELY A;  2JOB A;  2EPO A;  4LF5 E;  3J7A G;  4B3M E;  1L4S A;  2FTX B;  5FLX C;  3J7Y p;  1TF6 A;  2B7V A;  1T4L B;  4B3S E;  4DV5 E;  4BS9 A;  4YHH E;  5KL3 A;  2EN8 A;  3IWC A;  1MGT A;  1JK1 A;  2RSM A;  2EN3 A;  2EMI A;  3LML A;  4ZYH A;  5A6J A;  1HNW E;  2EM9 A;  2YU8 A;  4F6N A;  2MDG A;  4M30 A;  4YY3 E;  4DR3 E;  1T4N A;  2K4V A;  2E5L E;  1YYK A;  2ELZ A;  2EOY A;  1DI2 A;  1P47 A;  3K6Q A;  2HC5 A;  4JI8 E;  1WXR A;  3F6H A;  2EPK X;  4ZYG A;  2BB8 A;  2DIX A;  1ZU1 A;  2LVH A;  4LTY A;  4BCA A;  2JR1 A;  4R2A A;  4DV3 E;  4X62 E;  2R1F A;  4R8O A;  3ZOQ B;  2EPR A;  1MEY C;  1EH8 A;  2LTS A;  2EOH A;  2DMY A;  2J7J A;  3RMP A;  4F9A B;  2DMI A;  2LV2 A;  2Q8U A;  3DF6 A;  2EPZ A;  2EN4 A;  2HHH E;  2ENC A;  2NUG A;  2NUF A;  1XNR E;  4K0K E;  4IJD A;  4O43 A;  4BC9 A;  4R2D A;  3JAM C;  2GHF A;  1UBD C;  2EPC A;  5IWA E;  1G2D C;  2YTD A;  1X5W A;  1TF3 A;  4WXC A;  1X49 A;  2LBS B;  1N34 E;  1YPN A;  5BR8 E;  4JI6 E;  4JI4 E;  2EM4 A;  4O5G A;  2UXB E;  5TSE A;  3IWB A;  2EWL A;  3HTX A;  2UUC E;  5A69 A;  2LUQ A;  2L2N A;  2YTO A;  2N3H A;  2ODR C;  2V83 A;  1ZBQ A;  4DKK A;  1GQE A;  2B3T B;  2EOJ A;  4BMJ A;  1IQO A;  3ECR A;  2L92 A;  2EMG A;  3VYX A;  4LFC E;  3HXL A;  2B7T A;  3J80 C;  4GKK E;  2EM3 A;  2MKD A;  4JI3 E;  4M9V C;  1UN6 B;  3BID A;  4I8O A;  1BBG A;  4X64 E;  2VRD A;  1GTK A;  2YTG A;  4LFA E;  3C6M A;  2EM0 A;  4TUG A;  4X8W A;  1T38 A;  4LF4 E;  2YTQ A;  5CFF E;  3MHH C;  2MDR A;  3FIG A;  2EPM X;  2G7H A;  2HGH A;  4BHC A;  2WCC 3;  2EMX A;  3EPJ A;  2YRK A;  2YSO A;  4DR2 E;  1B69 A;  4IS1 C;  2I9I A;  2CT1 A;  4NXN E;  4BBY A;  5KL4 A;  2LUP B;  2MKN A;  4JI5 E;  2DLK A;  2RPC A;  1KYQ A;  2RS6 A;  2WBU A;  4HTG A;  4F2J C;  5AAS A;  1WHN A;  2ZM6 E;  1BBO A;  1IBM E;  4LF8 E;  2V8Q B;  3P1X A;  2YU5 A;  2L3C A;  3VHT B;  2LCE A;  2EE8 A;  2E72 A;  5A2Q C;  1UIL A;  4F54 A;  1YYO A;  3MSW A;  4B3T E;  5ADZ A;  5KL5 A;  2JWO A;  4KWY A;  2VQF E;  3EPL A;  1FKA E;  2EMB A;  1UHZ A;  2EQ1 A;  2YRM A;  1ZBT A;  1RC7 A;  3ADJ A;  2LMZ A;  4P7D A;  4P78 A;  2LJH A;  2UUA E;  1WRJ A;  4DMI A;  4R2C A;  2JPA A;  4JI7 E;  3HQ1 A;  4LF9 E;  2YT4 A;  3IWD A;  4MLQ A;  3OTO E;  2EML A;  2JVA A;  4DV2 E;  4LF7 E;  2V86 A;  2NAB A;  2EOR A;  2N3G A;  2RS7 A;  4R2E A;  4FK5 C;  4OX9 E;  2MC5 A;  5IXM B;  2VQE E;  2EL6 A;  1WJP A;  5LMU E;  3ADI A;  2L8T A;  4JI0 E;  4Q35 B;  1A1L A;  2D9H A;  2EZ6 A;  2IHR 1;  1NCS A;  3QG5 C;  5IV8 B;  4GKJ E;  2EM2 A;  4KZS A;  1XNQ E;  4AQY E;  1A1J A;  3J81 C;  4R2P A;  2L2K B;  2EN7 A;  4RH8 A;  2ADR A;  3EQ1 A;  1J5E E;  2EL5 A;  4L5N C;  2EM5 A;  2FV4 B;  3KZZ A;  1IQS A;  1F2I G;  2YTI A;  2EOX A;  1RQ0 A;  4JI1 E;  4NXM E;  1KJK A;  2KHX A;  2EN2 A;  4DUY E;  5F3W A;  2ODR D;  1HR0 E;  1A1H A;  1PKP A;  2EP3 A;  4X9J A;  2EOI A;  1X48 A;  3EPK A;  1YFH A;  2KOU A;  1AH5 A;  1YSA C;  2L6M A;  5DNY A;  4JV5 E;  2YZT A;  1NEI A;  1O0W A;  2LJU A;  4DUZ E;  1HNX E;  4NZV A;  2CSH A;  2CTD A;  3M99 B;  1YUJ A;  2EPP A;  2VF1 A;  4F6M A;  2RSI A;  2DGC A;  4R03 A;  2JP9 A;  2LRS A;  2YTP A;  4MLV A;  3OML A;  3KZY A;  3ADG A;  1QU6 A;  2E1M A;  3THN A;  1WHQ A;  2UUB E;  2YSP A;  2F4V E;  2EOZ A;  2CPN A;  4X66 E;  1GZ6 A;  2YPN A;  5A6A A;  1T39 A;  2EL4 A;  1TN9 A;  2JXP A;  2DLQ A;  1J26 A;  1STU A;  2DSY A;  3THO B;  3UK3 C;  2EOS A;  1DQ3 A;  2LO3 A;  2WBT A;  3L00 A;  1JK2 A;  2EMZ A;  4KHP E;  2L33 A;  2JY9 A;  2V88 A;  1YUI A;  1PDA A;  2EMA A;  1Z1B A;  4M0V A;  2EPA A;  4N4R B;  4WXD A;  2LTR A;  2K7I A;  5A6B D;  2EMC A;  3F6G A;  5AE3 A;  1QNT A;  2NUE A;  4GEQ B;  2UXD E;  2EMH A;  2HJJ A;  2UU9 E;  4DR6 E;  2EMW A;  3T1H E;  2DRP A;  2EM7 A;  2F8B A;  4GZN C;  1N3G A;  3BBG A;  5AE2 A;  4DV1 E;  1SFE A;  5LL6 R;  5A6B A;  4DV7 E;  1IMU A;  3MHS C;  5T6J A;  4LU9 A;  4R2R A;  2V87 A;  1A1I A;  2YWQ A;  2RTX A;  3DJW A;  2V89 A;  2JOX A;  1X6H A;  3T1Y E;  2RQL A;  2YTJ A;  1A1F A;  2I13 A;  3HPZ A;  2WZO A;  4DV4 E;  2YRH A;  5IT9 C;  4BHB A;  2M4I A;  2ENH A;  1I94 E;  4ZYD A;  3ADL A;  2L3J A;  1FJG E;  1BB8 A;  1A1K A;  2V85 A;  4WSP A;  2NA2 A;  1SR9 A;  1IBL E;  1EH7 A;  1XMQ E;  1YYW A;  4O24 A;  2B9D A;  2L2M A;  4R2S A;  3AUZ A;  3KWR A;  5AC5 A;  4DR1 E;  2WBS A;  2LT7 A;  1T4O A;  1A1G A;  4WX9 A;  3AV0 A;  5AE1 A;  2M1S A;  4WPY A;  4JYA E;  2JYA A;  1RMD A;  4L8N A;  1PJT A;  1G2F C;  2GPI A;  4DV0 E;  4DR5 E;  2M7Q A;  1LLM C;  3EPH A;  2YTE A;  2EM8 A;  2EN6 A;  2EQ0 A;  2H36 X;  3VYY A;  1PJQ A;  2VE7 C;  4RHB B;  2GLI A;  4WFT A;  2ENA A;  2EPL X;  2N8X A;  3LLH A;  2A25 A;  2EOE A;  4DR4 E;  4HEI A;  4LFB E;  5AC4 A;  2EJ4 A;  4BC7 A;  3TQM A;  1IBK E;  4ZYE A;  3BF2 A;  4DR7 E;  1PJS A;  4B3R E;  2YTF A;  2EMF A;  5A6K A;  1ZAA C;  4NHR A;  5LLQ A;  2KON A;  2EPU A;  3JTZ A;  5KL7 A;  5KL6 A;  4OOG C;  2M9A A;  2MC6 A;  1EH6 A;  2EOO A;  4TUI A;  5LMN E;  3H09 A;  1HNZ E;  2UXC E;  1AAY A;  4X65 E;  4WYQ B;  1X3C A;  3C4T A;  1X6F A;  2EPN A;  3C6K A;  2EN1 A;  2EOM A;  2BBG A;  4WSG A;  2EPX A; 
#chains in the Genus database with same CATH homology
 1XMO E;  3VK6 A;  2EZ6 A;  5LL6 R;  4F9B B;  4DV7 E;  4M2Z A;  2B3T B;  5T6J A;  4BMJ A;  2FGG A;  4LU9 A;  1N33 E;  2V87 A;  4GKJ E;  2L92 A;  3HPS A;  4KZS A;  1XNQ E;  4AQY E;  4JI2 E;  3VYX A;  4LFC E;  2RTX A;  3DJW A;  2B7T A;  3HXL A;  3J80 C;  2V89 A;  3J81 C;  2L2K B;  2JOX A;  1EKZ A;  2LE2 A;  4GKK E;  3C4B A;  4J8Z A;  1YZ9 A;  3T1Y E;  4Q28 A;  4F9C B;  4JI3 E;  1N32 E;  1J5E E;  3HPZ A;  2WZO A;  4L5N C;  4I8O A;  4DV4 E;  2FV4 B;  3JU0 A;  1X47 A;  2DB2 A;  5IT9 C;  2M4I A;  1I94 E;  4X64 E;  3ADL A;  4DV6 E;  1N36 E;  2L3J A;  4LF6 E;  1FJG E;  4LFA E;  2JOB A;  1RQ0 A;  2V85 A;  4JI1 E;  4WSP A;  2NA2 A;  1SR9 A;  4X8W A;  4TUG A;  1IBL E;  1XMQ E;  4LF4 E;  4NXM E;  4LF5 E;  1YYW A;  2KHX A;  3J7A G;  2B9D A;  2L2M A;  4B3M E;  2FTX B;  5CFF E;  5FLX C;  3J7Y p;  4DUY E;  2MDR A;  2B7V A;  3AUZ A;  3KWR A;  5F3W A;  4DR1 E;  3FIG A;  2ODR D;  1T4L B;  2G7H A;  1HR0 E;  4DV5 E;  4BS9 A;  4YHH E;  4B3S E;  1PKP A;  3IWC A;  1X48 A;  2KOU A;  2RSM A;  4DR2 E;  1T4O A;  2L6M A;  3AV0 A;  5DNY A;  4JV5 E;  3LML A;  5AE1 A;  4NXN E;  4BBY A;  2M1S A;  4WPY A;  1HNW E;  4JYA E;  2LUP B;  2YZT A;  1O0W A;  4YY3 E;  4M30 A;  2E5L E;  4DR3 E;  1T4N A;  2K4V A;  4JI5 E;  1YYK A;  4DUZ E;  1HNX E;  2RS6 A;  1DI2 A;  4L8N A;  3K6Q A;  4JI8 E;  1WXR A;  3F6H A;  2VF1 A;  2DIX A;  4DV0 E;  4DR5 E;  5AAS A;  1WHN A;  4LTY A;  2LRS A;  4R03 A;  2JR1 A;  2M7Q A;  4BCA A;  4X62 E;  2ZM6 E;  4DV3 E;  2V8Q B;  1IBM E;  3P1X A;  4LF8 E;  4R8O A;  2L3C A;  3ZOQ B;  3OML A;  5A2Q C;  3ADG A;  1QU6 A;  1UIL A;  2E1M A;  1WHQ A;  3MSW A;  2LTS A;  4F54 A;  1YYO A;  2UUB E;  4B3T E;  5ADZ A;  2DMY A;  2JWO A;  2H36 X;  2VQF E;  3RMP A;  4F9A B;  1FKA E;  3VYY A;  2F4V E;  2VE7 C;  2CPN A;  4X66 E;  1GZ6 A;  3DF6 A;  1UHZ A;  4WFT A;  4DV1 E;  1J26 A;  1ZBT A;  1RC7 A;  2HHH E;  1STU A;  3ADJ A;  3LLH A;  2DSY A;  2LMZ A;  4P7D A;  4P78 A;  2NUG A;  4DR4 E;  1DQ3 A;  2NUF A;  2LJH A;  1XNR E;  2UUA E;  4K0K E;  4KHP E;  4LFB E;  2L33 A;  4BC7 A;  2JY9 A;  4BC9 A;  3JAM C;  4DMI A;  2V88 A;  1IBK E;  4DR7 E;  4JI7 E;  5IWA E;  3HQ1 A;  4M0V A;  4LF9 E;  4B3R E;  2YT4 A;  3IWD A;  3OTO E;  2JVA A;  2LTR A;  4DV2 E;  3F6G A;  1X49 A;  2V86 A;  5AE3 A;  2LBS B;  2KON A;  4LF7 E;  2NUE A;  3JTZ A;  1N34 E;  2N3G A;  4OOG C;  2RS7 A;  5BR8 E;  4JI6 E;  4JI4 E;  4GEQ B;  2MC6 A;  2UXD E;  2UXB E;  4TUI A;  5LMN E;  2UU9 E;  4DR6 E;  4OX9 E;  2MC5 A;  3H09 A;  3IWB A;  2EWL A;  3T1H E;  1HNZ E;  2VQE E;  2F8B A;  3HTX A;  2UXC E;  2UUC E;  4X65 E;  4WYQ B;  2LUQ A;  5LMU E;  2L8T A;  3ADI A;  4JI0 E;  2L2N A;  3C4T A;  2N3H A;  5AE2 A;  2ODR C;  2V83 A;  1ZBQ A;  4DKK A;  1GQE A;  2IHR 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...