1YSAC

The gcn4 basic region leucine zipper binds dna as a dimer of uninterrupted alpha helices: crystal structure of the protein-dna complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
KDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The GCN4 basic region leucine zipper binds DNA as a dimer of uninterrupted alpha helices: crystal structure of the protein-DNA complex.
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*TP*CP*CP*TP*AP*TP*GP*AP*CP*TP*CP*AP*TP*CP*CP*A
total genus 21
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 1993-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ysaC00
2YTFA 2YTIA 2EM9A 2M9AA 2YTJA 2EOXA 3UK3C 1JK2A 1YUIA 2LV2A 2LT7A 2EN8A 2DGCA 2EM2A 5KL7A 2JP9A 2YTGA 5KL6A 1G2FC 1JK1A 1YSAC 2EPRA 4R2DA 2EM7A 1ZR9A 5KL4A 2EMLA 2RPCA 4R2PA 4WSGA 4R2QA 2A25A 2EN7A 2EOHA 1DGCA 2EOFA 1P47A 2EOYA 1A1LA 2YTPA 4R2SA 2EMYA 2EOMA 2EN3A 2EL4A 1A1IA 2RSIA 2MDGA 2EMAA 2VRDA 1WJPA 2EMHA 1A1KA 2ELYA 1RMDA 2DMIA 2EJ4A 2ELZA 2LO3A 2NABA 2I13A 2YTOA 4IJDA 1YUJA 2YTQA 2EOQA 4GZNC 2EQ1A 1A1HA 2E72A 2ADRA 4X9JA 2DLQA 2EP3A 3EPJA 2EM6A 1F2IG 1B69A 2EMZA 2EPAA 2DLKA 2EM8A 2EQ3A 1A1GA 2CT1A 3VHTB 2EN1A 2GHFA 1AAYA 2EOOA 4M9VC 1X5WA 2EM0A 2EE8A 2JPAA 2EN4A 3EPLA 2YSOA 2EMCA 2EOSA 1TN9A 1ZU1A 3M99B 4R2RA 1UBDC 1ZAAC 1NCSA 1A1FA 4IS1C 1X6EA 1BB8A 1A1JA 4F2JC 1X6FA 2EOZA 2YSPA 3MHHC 2EMKA 1UN6B 2J7JA 2EMGA 1MEYC 2EORA 2YRKA 2EMFA 4F6MA 2MKNA 2YRHA 3EPHA 2R1FA 2LVHA 2MKDA 4R2EA 2WCC3 2BB8A 2WBUA 1X6HA 3EPKA 2CSHA 4R2AA 1X3CA 2LCEA 2EL6A 1KJKA 2EMWA 2EPCA 2EL5A 2EMIA 2ENCA 2ENHA 5KL3A 2D9HA 2YRMA 2WBSA 1TF3A 2EM3A 2YTDA 2PRTA 2ENAA 5KL2A 4F6NA 2HGHA 4FK5C 1LLMC 2YU5A 1TF6A 2WBTA 2YU8A 2EM5A 2DRPA 5KL5A 2EMBA 2EPPA 2EPUA 4R2CA 2EOJA 2CTDA 1G2DC 2EPZA 3MHSC 2EMXA 2YTNA 2EN2A 2YTEA 2EM4A 1BBOA 2EOIA 2EQ0A 2EN6A 2GLIA 2EPXA 2EOEA 1Z1BA
chains in the Genus database with same CATH superfamily
2YTIA 2EM9A 2YTJA 2VF1A 5DNYA 2JVAA 5KL7A 4LFAE 3ADGA 2EPRA 2EMLA 5AE1A 2A25A 2EPKX 2EN7A 5FLXC 2EOYA 2EOMA 2EN3A 1EH7A 4LU9A 2MDGA 5T6JA 2LJHA 1A1KA 4NXME 4F9AB 2UU9E 1XMOE 2ELYA 2JY9A 1O0WA 2RTXA 2ELZA 2LO3A 4GEQB 4WSPA 2YTOA 2FV4B 1YUJA 2V83A 2YTQA 2V8QB 1WHQA 4GZNC 5F3WA 4X8WA 2V85A 4DV2E 4X9JA 3IWCA 2EP3A 4JYAE 4WPYA 3FIGA 1HNWE 2EM8A 4X65E 1A1GA 1ZBTA 2KONA 2M4IA 3MSWA 3VHTB 2EOOA 2JPAA 1UILA 3EPLA 4DV7E 3F6GA 1TN9A 4WYQB 4IS1C 1BB8A 2L2MA 2Q8UA 1N32E 1YYWA 2EMGA 2YRKA 3H09A 4LTYA 4DR2E 3VK6A 2WBUA 1X47A 2DSYA 2JR1A 2UXBE 4M30A 3VYYA 2LCEA 4MLVA 1KJKA 4ZYGA 4DV4E 5IWAE 2YTDA 1XNRE 4FK5C 2YU5A 2MC5A 4JI1E 2EPNA 1EKZA 4LFCE 1TF6A 2EM5A 2EMBA 2GPIA 2EPPA 2EOJA 1G2DC 2EPZA 3MHSC 2YTNA 3KWRA 4ZYHA 3J81C 1YYOA 2R76A 1Z1BA 2YTFA 1HR0E 2M9AA 1JK2A 1EH8A 2UUAE 4M0VA 3HQ1A 2E5LE 3OMLA 5KL6A 4R2DA 3AV0A 1ZR9A 3C6MA 5KL4A 3DF6A 4WSGA 1WXRA 4DUYE 4JI5E 1P47A 2VQFE 2EMYA 2EL4A 1BBGA 1YFHA 2RSIA 5AE2A 2EMHA 5IT9C 4O43A 1XMQE 2UUCE 4WX9A 1IBLE 1RMDA 4B3RE 3ECRA 1GTKA 3QG5C 1DQ3A 2LTSA 2EOQA 4DV5E 2EQ1A 3THNA 1A1HA 3DJWA 1WRJA 4B3TE 4O24A 4JI0E 3EPJA 2M1SA 1AH5A 2EMZA 2V88A 1FKAE 1PJSA 1AAYA 4M9VC 1X5WA 2H36X 2DMYA 4RH8A 4BS9A 1ZU1A 4R2RA 1NCSA 1A1FA 4DR1E 1X6EA 2EPMX 5TSEA 2L2NA 2G7HA 4R8OA 5IV8B 4DV6E 2MC6A 2LBSB 4BMJA 3MHHC 2VQEE 5A69A 3RMPA 2EMKA 4HEIA 2J7JA 2DIXA 1UN6B 1MEYC 2EORA 4DV0E 4JI2E 2EMFA 2HJJA 2KOUA 2V86A 3ADJA 2MKDA 2K4VA 2M7QA 2UXCE 1KYQA 1EH6A 4BBYA 4K0KE 2E1MA 2EL6A 4JI7E 2L6MA 2EPCA 4Q35B 2L33A 2ENCA 5KL3A 1IMUA 1IQSA 3BF2A 3C6KA 2WBSA 2EM3A 2PRTA 1GZ6A 3T1YE 2HGHA 2LMZA 4M2ZA 1PJTA 5AASA 5CFFE 1QNTA 2YU8A 5LMNE 4DR6E 4LFBE 3J7AG 4Q28A 2RS7A 2YWQA 2NUEA 3KZYA 2CTDA 1HNZE 2JOXA 4ZYEA 2EMXA 4BCAA 3ADLA 2YTEA 2FGGA 5AC4A 4J8ZA 2EOIA 2EQ0A 5LLQA 2HC5A 3F6HA 3C4BA 1UHZA 3UK3C 2EOXA 5AC5A 2LT7A 5LL6R 2EN8A 1SR9A 2EM2A 2JP9A 5A6AA 2JOBA 2UUBE 4YY3E 1G2FC 1NEIA 3THOB 2RPCA 1IBKE 2FTXB 2EPLX 2EOFA 3JAMC 1A1LA 4BHCA 2NUGA 4OOGC 4WFTA 1YPNA 1A1IA 2EMAA 5IXMB 2VRDA 4F9CB 2N3HA 2DMIA 2EJ4A 4O4KA 2NABA 3L00A 2L3JA 4JI3E 4OX9E 4B3SE 4TUIA 3BGHA 1XNQE 2E72A 4N4RB 2DLQA 4BC7A 2K7IA 4BHBA 2EM6A 1F2IG 1N36E 1B69A 4B3ME 2LTRA 4JI6E 2B9DA 4L8NA 2EN1A 2GHFA 2LJUA 3ZOQB 1X48A 2F4VE 2WZOA 1T38A 1UBDC 3OTOE 1A1JA 1PDAA 4F2JC 3HTXA 1X6FA 2DB2A 2EOZA 2RS6A 4GKJE 2LUQA 1QU6A 4DUZE 4LF5E 4DV1E 5A6KA 2IHR1 1GQEA 4F6MA 2MKNA 2VE7C 4KHPE 3EPHA 5A6BA 2LVHA 2ODRD 1T39A 2WCC3 3BBGA 1J5EE 2UXDE 1J26A 4YHHE 4R2AA 1X3CA 4JV5E 2HHHE 2EMWA 2ENHA 2EZ6A 3IWBA 2D9HA 2YRMA 3J80C 1TF3A 4F6NA 4DR5E 3HPSA 2CPNA 3C4TA 2EPOA 3JU0A 1WHNA 5ADZA 2N3GA 2L3CA 2EPUA 4R2CA 4P78A 4ZYDA 2NA2A 4LF9E 4P7DA 1MGTA 1IQOA 4NZVA 3J7Yp 2EM4A 1YZ9A 4NXNE 3K6QA 2GLIA 1L4SA 2EPXA 2EOEA 2NUFA 1STUA 1YUIA 2LV2A 2ODRC 2DGCA 2F8BA 3TQMA 4MLQA 4LF8E 2L8TA 4WXCA 2YTGA 4DR4E 1IBME 1JK1A 2B3TB 2MDRA 1YSAC 1I94E 2LUPB 2EM7A 4KZSA 4R2PA 4R2QA 2EOHA 1DGCA 1N33E 2N8XA 2YTPA 4R2SA 3JTZA 1X49A 2KHXA 1WJPA 3P1XA 4JI8E 1PJQA 2JYAA 4X66E 2I13A 2LE2A 5BR8E 5A6BD 4IJDA 4LF4E 2V87A 2BBGA 4F9BB 4DMIA 1RC7A 2ADRA 2B7VA 4NHRA 1HNXE 2V89A 3ADIA 2EPAA 2DLKA 2EQ3A 4F54A 1N3GA 4WXDA 4DV3E 2CT1A 2JWOA 2EM0A 4DKKA 4DR7E 2YZTA 2EE8A 2EN4A 2YT4A 3AUZA 2RSMA 2YSOA 1SFEA 2EMCA 2EOSA 3M99B 1ZAAC 3IWDA 4LF6E 3KZZA 4L5NC 2YSPA 5A2QC 3EQ1A 4AQYE 3BIDA 1ZBQA 2ZM6E 4I8OA 3VYXA 2YRHA 2R1FA 3HPZA 4R2EA 4LF7E 2L2KB 2BB8A 2B7TA 2EWLA 1X6HA 3EPKA 2CSHA 4X64E 1RQ0A 2RQLA 1DI2A 2EL5A 2EMIA 4X62E 4KWYA 5A6JA 2LRSA 4JI4E 2ENAA 5KL2A 1T4NA 1LLMC 1FJGE 5AE3A 1N34E 2WBTA 3HXLA 4HTGA 2DRPA 4BC9A 5KL5A 1T4LB 1YYKA 4R03A 5LMUE 4O5GA 2YPNA 2EN2A 2L92A 4RHBB 1BBOA 1PKPA 4TUGA 4DR3E 2I9IA 3LLHA 1T4OA 2EN6A 3LMLA 2JXPA 4GKKE 3T1HE
chains in the Genus database with same CATH topology
2YTFA 2YTIA 2EM9A 2M9AA 2YTJA 2EOXA 3UK3C 1JK2A 1YUIA 2LV2A 2LT7A 2EN8A 2DGCA 2EM2A 5KL7A 2JP9A 2YTGA 5KL6A 1G2FC 1JK1A 1YSAC 2EPRA 4R2DA 2EM7A 1ZR9A 5KL4A 2EMLA 2RPCA 4R2PA 4WSGA 4R2QA 2A25A 2EN7A 2EOHA 1DGCA 2EOFA 1P47A 2EOYA 1A1LA 2YTPA 4R2SA 2EMYA 2EOMA 2EN3A 2EL4A 1A1IA 2RSIA 2MDGA 2EMAA 2VRDA 1WJPA 2EMHA 1A1KA 2ELYA 1RMDA 2DMIA 2EJ4A 2ELZA 2LO3A 2NABA 2I13A 2YTOA 4IJDA 1YUJA 2YTQA 2EOQA 4GZNC 2EQ1A 1A1HA 2E72A 2ADRA 4X9JA 2DLQA 2EP3A 3EPJA 2EM6A 1F2IG 1B69A 2EMZA 2EPAA 2DLKA 2EM8A 2EQ3A 1A1GA 2CT1A 3VHTB 2EN1A 2GHFA 1AAYA 2EOOA 4M9VC 1X5WA 2EM0A 2EE8A 2JPAA 2EN4A 3EPLA 2YSOA 2EMCA 2EOSA 1TN9A 1ZU1A 3M99B 4R2RA 1UBDC 1ZAAC 1NCSA 1A1FA 4IS1C 1X6EA 1BB8A 1A1JA 4F2JC 1X6FA 2EOZA 2YSPA 3MHHC 2EMKA 1UN6B 2J7JA 2EMGA 1MEYC 2EORA 2YRKA 2EMFA 4F6MA 2MKNA 2YRHA 3EPHA 2R1FA 2LVHA 2MKDA 4R2EA 2WCC3 2BB8A 2WBUA 1X6HA 3EPKA 2CSHA 4R2AA 1X3CA 2LCEA 2EL6A 1KJKA 2EMWA 2EPCA 2EL5A 2EMIA 2ENCA 2ENHA 5KL3A 2D9HA 2YRMA 2WBSA 1TF3A 2EM3A 2YTDA 2PRTA 2ENAA 5KL2A 4F6NA 2HGHA 4FK5C 1LLMC 2YU5A 1TF6A 2WBTA 2YU8A 2EM5A 2DRPA 5KL5A 2EMBA 2EPPA 2EPUA 4R2CA 2EOJA 2CTDA 1G2DC 2EPZA 3MHSC 2EMXA 2YTNA 2EN2A 2YTEA 2EM4A 1BBOA 2EOIA 2EQ0A 2EN6A 2GLIA 2EPXA 2EOEA 1Z1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTF A;  2YTI A;  2EM9 A;  2M9A A;  2YTJ A;  2EOX A;  3UK3 C;  1JK2 A;  1YUI A;  2LV2 A;  2LT7 A;  2EN8 A;  2DGC A;  2EM2 A;  5KL7 A;  2JP9 A;  2YTG A;  5KL6 A;  1G2F C;  1JK1 A;  1YSA C;  2EPR A;  4R2D A;  2EM7 A;  1ZR9 A;  5KL4 A;  2EML A;  2RPC A;  4R2P A;  4WSG A;  4R2Q A;  2A25 A;  2EN7 A;  2EOH A;  1DGC A;  2EOF A;  1P47 A;  2EOY A;  1A1L A;  2YTP A;  4R2S A;  2EMY A;  2EOM A;  2EN3 A;  2EL4 A;  1A1I A;  2RSI A;  2MDG A;  2EMA A;  2VRD A;  1WJP A;  2EMH A;  1A1K A;  2ELY A;  1RMD A;  2DMI A;  2EJ4 A;  2ELZ A;  2LO3 A;  2NAB A;  2I13 A;  2YTO A;  4IJD A;  1YUJ A;  2YTQ A;  2EOQ A;  4GZN C;  2EQ1 A;  1A1H A;  2E72 A;  2ADR A;  4X9J A;  2DLQ A;  2EP3 A;  3EPJ A;  2EM6 A;  1F2I G;  1B69 A;  2EMZ A;  2EPA A;  2DLK A;  2EM8 A;  2EQ3 A;  1A1G A;  2CT1 A;  3VHT B;  2EN1 A;  2GHF A;  1AAY A;  2EOO A;  4M9V C;  1X5W A;  2EM0 A;  2EE8 A;  2JPA A;  2EN4 A;  3EPL A;  2YSO A;  2EMC A;  2EOS A;  1TN9 A;  1ZU1 A;  3M99 B;  4R2R A;  1UBD C;  1ZAA C;  1NCS A;  1A1F A;  4IS1 C;  1X6E A;  1BB8 A;  1A1J A;  4F2J C;  1X6F A;  2EOZ A;  2YSP A;  3MHH C;  2EMK A;  1UN6 B;  2J7J A;  2EMG A;  1MEY C;  2EOR A;  2YRK A;  2EMF A;  4F6M A;  2MKN A;  2YRH A;  3EPH A;  2R1F A;  2LVH A;  2MKD A;  4R2E A;  2WCC 3;  2BB8 A;  2WBU A;  1X6H A;  3EPK A;  2CSH A;  4R2A A;  1X3C A;  2LCE A;  2EL6 A;  1KJK A;  2EMW A;  2EPC A;  2EL5 A;  2EMI A;  2ENC A;  2ENH A;  5KL3 A;  2D9H A;  2YRM A;  2WBS A;  1TF3 A;  2EM3 A;  2YTD A;  2PRT A;  2ENA A;  5KL2 A;  4F6N A;  2HGH A;  4FK5 C;  1LLM C;  2YU5 A;  1TF6 A;  2WBT A;  2YU8 A;  2EM5 A;  2DRP A;  5KL5 A;  2EMB A;  2EPP A;  2EPU A;  4R2C A;  2EOJ A;  2CTD A;  1G2D C;  2EPZ A;  3MHS C;  2EMX A;  2YTN A;  2EN2 A;  2YTE A;  2EM4 A;  1BBO A;  2EOI A;  2EQ0 A;  2EN6 A;  2GLI A;  2EPX A;  2EOE A;  1Z1B A; 
#chains in the Genus database with same CATH topology
 2YTI A;  2EM9 A;  2YTJ A;  2VF1 A;  5DNY A;  2JVA A;  5KL7 A;  4LFA E;  3ADG A;  2EPR A;  2EML A;  5AE1 A;  2A25 A;  2EPK X;  2EN7 A;  5FLX C;  2EOY A;  2EOM A;  2EN3 A;  1EH7 A;  4LU9 A;  2MDG A;  5T6J A;  2LJH A;  1A1K A;  4NXM E;  4F9A B;  2UU9 E;  1XMO E;  2ELY A;  2JY9 A;  1O0W A;  2RTX A;  2ELZ A;  2LO3 A;  4GEQ B;  4WSP A;  2YTO A;  2FV4 B;  1YUJ A;  2V83 A;  2YTQ A;  2V8Q B;  1WHQ A;  4GZN C;  5F3W A;  4X8W A;  2V85 A;  4DV2 E;  4X9J A;  3IWC A;  2EP3 A;  4JYA E;  4WPY A;  3FIG A;  1HNW E;  2EM8 A;  4X65 E;  1A1G A;  1ZBT A;  2KON A;  2M4I A;  3MSW A;  3VHT B;  2EOO A;  2JPA A;  1UIL A;  3EPL A;  4DV7 E;  3F6G A;  1TN9 A;  4WYQ B;  4IS1 C;  1BB8 A;  2L2M A;  2Q8U A;  1N32 E;  1YYW A;  2EMG A;  2YRK A;  3H09 A;  4LTY A;  4DR2 E;  3VK6 A;  2WBU A;  1X47 A;  2DSY A;  2JR1 A;  2UXB E;  4M30 A;  3VYY A;  2LCE A;  4MLV A;  1KJK A;  4ZYG A;  4DV4 E;  5IWA E;  2YTD A;  1XNR E;  4FK5 C;  2YU5 A;  2MC5 A;  4JI1 E;  2EPN A;  1EKZ A;  4LFC E;  1TF6 A;  2EM5 A;  2EMB A;  2GPI A;  2EPP A;  2EOJ A;  1G2D C;  2EPZ A;  3MHS C;  2YTN A;  3KWR A;  4ZYH A;  3J81 C;  1YYO A;  2R76 A;  1Z1B A;  2YTF A;  1HR0 E;  2M9A A;  1JK2 A;  1EH8 A;  2UUA E;  4M0V A;  3HQ1 A;  2E5L E;  3OML A;  5KL6 A;  4R2D A;  3AV0 A;  1ZR9 A;  3C6M A;  5KL4 A;  3DF6 A;  4WSG A;  1WXR A;  4DUY E;  4JI5 E;  1P47 A;  2VQF E;  2EMY A;  2EL4 A;  1BBG A;  1YFH A;  2RSI A;  5AE2 A;  2EMH A;  5IT9 C;  4O43 A;  1XMQ E;  2UUC E;  4WX9 A;  1IBL E;  1RMD A;  4B3R E;  3ECR A;  1GTK A;  3QG5 C;  1DQ3 A;  2LTS A;  2EOQ A;  4DV5 E;  2EQ1 A;  3THN A;  1A1H A;  3DJW A;  1WRJ A;  4B3T E;  4O24 A;  4JI0 E;  3EPJ A;  2M1S A;  1AH5 A;  2EMZ A;  2V88 A;  1FKA E;  1PJS A;  1AAY A;  4M9V C;  1X5W A;  2H36 X;  2DMY A;  4RH8 A;  4BS9 A;  1ZU1 A;  4R2R A;  1NCS A;  1A1F A;  4DR1 E;  1X6E A;  2EPM X;  5TSE A;  2L2N A;  2G7H A;  4R8O A;  5IV8 B;  4DV6 E;  2MC6 A;  2LBS B;  4BMJ A;  3MHH C;  2VQE E;  5A69 A;  3RMP A;  2EMK A;  4HEI A;  2J7J A;  2DIX A;  1UN6 B;  1MEY C;  2EOR A;  4DV0 E;  4JI2 E;  2EMF A;  2HJJ A;  2KOU A;  2V86 A;  3ADJ A;  2MKD A;  2K4V A;  2M7Q A;  2UXC E;  1KYQ A;  1EH6 A;  4BBY A;  4K0K E;  2E1M A;  2EL6 A;  4JI7 E;  2L6M A;  2EPC A;  4Q35 B;  2L33 A;  2ENC A;  5KL3 A;  1IMU A;  1IQS A;  3BF2 A;  3C6K A;  2WBS A;  2EM3 A;  2PRT A;  1GZ6 A;  3T1Y E;  2HGH A;  2LMZ A;  4M2Z A;  1PJT A;  5AAS A;  5CFF E;  1QNT A;  2YU8 A;  5LMN E;  4DR6 E;  4LFB E;  3J7A G;  4Q28 A;  2RS7 A;  2YWQ A;  2NUE A;  3KZY A;  2CTD A;  1HNZ E;  2JOX A;  4ZYE A;  2EMX A;  4BCA A;  3ADL A;  2YTE A;  2FGG A;  5AC4 A;  4J8Z A;  2EOI A;  2EQ0 A;  5LLQ A;  2HC5 A;  3F6H A;  3C4B A;  1UHZ A;  3UK3 C;  2EOX A;  5AC5 A;  2LT7 A;  5LL6 R;  2EN8 A;  1SR9 A;  2EM2 A;  2JP9 A;  5A6A A;  2JOB A;  2UUB E;  4YY3 E;  1G2F C;  1NEI A;  3THO B;  2RPC A;  1IBK E;  2FTX B;  2EPL X;  2EOF A;  3JAM C;  1A1L A;  4BHC A;  2NUG A;  4OOG C;  4WFT A;  1YPN A;  1A1I A;  2EMA A;  5IXM B;  2VRD A;  4F9C B;  2N3H A;  2DMI A;  2EJ4 A;  4O4K A;  2NAB A;  3L00 A;  2L3J A;  4JI3 E;  4OX9 E;  4B3S E;  4TUI A;  3BGH A;  1XNQ E;  2E72 A;  4N4R B;  2DLQ A;  4BC7 A;  2K7I A;  4BHB A;  2EM6 A;  1F2I G;  1N36 E;  1B69 A;  4B3M E;  2LTR A;  4JI6 E;  2B9D A;  4L8N A;  2EN1 A;  2GHF A;  2LJU A;  3ZOQ B;  1X48 A;  2F4V E;  2WZO A;  1T38 A;  1UBD C;  3OTO E;  1A1J A;  1PDA A;  4F2J C;  3HTX A;  1X6F A;  2DB2 A;  2EOZ A;  2RS6 A;  4GKJ E;  2LUQ A;  1QU6 A;  4DUZ E;  4LF5 E;  4DV1 E;  5A6K A;  2IHR 1;  1GQE A;  4F6M A;  2MKN A;  2VE7 C;  4KHP E;  3EPH A;  5A6B A;  2LVH A;  2ODR D;  1T39 A;  2WCC 3;  3BBG A;  1J5E E;  2UXD E;  1J26 A;  4YHH E;  4R2A A;  1X3C A;  4JV5 E;  2HHH E;  2EMW A;  2ENH A;  2EZ6 A;  3IWB A;  2D9H A;  2YRM A;  3J80 C;  1TF3 A;  4F6N A;  4DR5 E;  3HPS A;  2CPN A;  3C4T A;  2EPO A;  3JU0 A;  1WHN A;  5ADZ A;  2N3G A;  2L3C A;  2EPU A;  4R2C A;  4P78 A;  4ZYD A;  2NA2 A;  4LF9 E;  4P7D A;  1MGT A;  1IQO A;  4NZV A;  3J7Y p;  2EM4 A;  1YZ9 A;  4NXN E;  3K6Q A;  2GLI A;  1L4S A;  2EPX A;  2EOE A;  2NUF A;  1STU A;  1YUI A;  2LV2 A;  2ODR C;  2DGC A;  2F8B A;  3TQM A;  4MLQ A;  4LF8 E;  2L8T A;  4WXC A;  2YTG A;  4DR4 E;  1IBM E;  1JK1 A;  2B3T B;  2MDR A;  1YSA C;  1I94 E;  2LUP B;  2EM7 A;  4KZS A;  4R2P A;  4R2Q A;  2EOH A;  1DGC A;  1N33 E;  2N8X A;  2YTP A;  4R2S A;  3JTZ A;  1X49 A;  2KHX A;  1WJP A;  3P1X A;  4JI8 E;  1PJQ A;  2JYA A;  4X66 E;  2I13 A;  2LE2 A;  5BR8 E;  5A6B D;  4IJD A;  4LF4 E;  2V87 A;  2BBG A;  4F9B B;  4DMI A;  1RC7 A;  2ADR A;  2B7V A;  4NHR A;  1HNX E;  2V89 A;  3ADI A;  2EPA A;  2DLK A;  2EQ3 A;  4F54 A;  1N3G A;  4WXD A;  4DV3 E;  2CT1 A;  2JWO A;  2EM0 A;  4DKK A;  4DR7 E;  2YZT A;  2EE8 A;  2EN4 A;  2YT4 A;  3AUZ A;  2RSM A;  2YSO A;  1SFE A;  2EMC A;  2EOS A;  3M99 B;  1ZAA C;  3IWD A;  4LF6 E;  3KZZ A;  4L5N C;  2YSP A;  5A2Q C;  3EQ1 A;  4AQY E;  3BID A;  1ZBQ A;  2ZM6 E;  4I8O A;  3VYX A;  2YRH A;  2R1F A;  3HPZ A;  4R2E A;  4LF7 E;  2L2K B;  2BB8 A;  2B7T A;  2EWL A;  1X6H A;  3EPK A;  2CSH A;  4X64 E;  1RQ0 A;  2RQL A;  1DI2 A;  2EL5 A;  2EMI A;  4X62 E;  4KWY A;  5A6J A;  2LRS A;  4JI4 E;  2ENA A;  5KL2 A;  1T4N A;  1LLM C;  1FJG E;  5AE3 A;  1N34 E;  2WBT A;  3HXL A;  4HTG A;  2DRP A;  4BC9 A;  5KL5 A;  1T4L B;  1YYK A;  4R03 A;  5LMU E;  4O5G A;  2YPN A;  2EN2 A;  2L92 A;  4RHB B;  1BBO A;  1PKP A;  4TUG A;  4DR3 E;  2I9I A;  3LLH A;  1T4O A;  2EN6 A;  3LML A;  2JXP A;  4GKK E;  3T1H E; 
#chains in the Genus database with same CATH homology
 2YTF A;  2YTI A;  2EM9 A;  2M9A A;  2YTJ A;  2EOX A;  3UK3 C;  1JK2 A;  1YUI A;  2LV2 A;  2LT7 A;  2EN8 A;  2DGC A;  2EM2 A;  5KL7 A;  2JP9 A;  2YTG A;  5KL6 A;  1G2F C;  1JK1 A;  1YSA C;  2EPR A;  4R2D A;  2EM7 A;  1ZR9 A;  5KL4 A;  2EML A;  2RPC A;  4R2P A;  4WSG A;  4R2Q A;  2A25 A;  2EN7 A;  2EOH A;  1DGC A;  2EOF A;  1P47 A;  2EOY A;  1A1L A;  2YTP A;  4R2S A;  2EMY A;  2EOM A;  2EN3 A;  2EL4 A;  1A1I A;  2RSI A;  2MDG A;  2EMA A;  2VRD A;  1WJP A;  2EMH A;  1A1K A;  2ELY A;  1RMD A;  2DMI A;  2EJ4 A;  2ELZ A;  2LO3 A;  2NAB A;  2I13 A;  2YTO A;  4IJD A;  1YUJ A;  2YTQ A;  2EOQ A;  4GZN C;  2EQ1 A;  1A1H A;  2E72 A;  2ADR A;  4X9J A;  2DLQ A;  2EP3 A;  3EPJ A;  2EM6 A;  1F2I G;  1B69 A;  2EMZ A;  2EPA A;  2DLK A;  2EM8 A;  2EQ3 A;  1A1G A;  2CT1 A;  3VHT B;  2EN1 A;  2GHF A;  1AAY A;  2EOO A;  4M9V C;  1X5W A;  2EM0 A;  2EE8 A;  2JPA A;  2EN4 A;  3EPL A;  2YSO A;  2EMC A;  2EOS A;  1TN9 A;  1ZU1 A;  3M99 B;  4R2R A;  1UBD C;  1ZAA C;  1NCS A;  1A1F A;  4IS1 C;  1X6E A;  1BB8 A;  1A1J A;  4F2J C;  1X6F A;  2EOZ A;  2YSP A;  3MHH C;  2EMK A;  1UN6 B;  2J7J A;  2EMG A;  1MEY C;  2EOR A;  2YRK A;  2EMF A;  4F6M A;  2MKN A;  2YRH A;  3EPH A;  2R1F A;  2LVH A;  2MKD A;  4R2E A;  2WCC 3;  2BB8 A;  2WBU A;  1X6H A;  3EPK A;  2CSH A;  4R2A A;  1X3C A;  2LCE A;  2EL6 A;  1KJK A;  2EMW A;  2EPC A;  2EL5 A;  2EMI A;  2ENC A;  2ENH A;  5KL3 A;  2D9H A;  2YRM A;  2WBS A;  1TF3 A;  2EM3 A;  2YTD A;  2PRT A;  2ENA A;  5KL2 A;  4F6N A;  2HGH A;  4FK5 C;  1LLM C;  2YU5 A;  1TF6 A;  2WBT A;  2YU8 A;  2EM5 A;  2DRP A;  5KL5 A;  2EMB A;  2EPP A;  2EPU A;  4R2C A;  2EOJ A;  2CTD A;  1G2D C;  2EPZ A;  3MHS C;  2EMX A;  2YTN A;  2EN2 A;  2YTE A;  2EM4 A;  1BBO A;  2EOI A;  2EQ0 A;  2EN6 A;  2GLI A;  2EPX A;  2EOE A;  1Z1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...