1YSAC

The gcn4 basic region leucine zipper binds dna as a dimer of uninterrupted alpha helices: crystal structure of the protein-dna complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
KDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*TP*CP*CP*TP*AP*TP*GP*AP*CP*TP*CP*AP*TP*CP*CP*A
publication title The GCN4 basic region leucine zipper binds DNA as a dimer of uninterrupted alpha helices: crystal structure of the protein-DNA complex.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 21
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 1993-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ysaC00
2EN4A 2EN6A 2EM0A 4IJDA 1YUIA 2RPCA 2GLIA 2EMLA 2EMZA 2EN8A 5KL2A 1A1FA 4R2AA 2LVHA 1A1LA 1JK1A 2EOXA 1WJPA 1A1GA 2CT1A 4R2QA 1G2FC 2YTNA 2ADRA 1TF6A 2J7JA 2LCEA 2YSOA 1AAYA 1A1IA 2RSIA 1A1KA 2EMIA 2EMFA 2YTJA 1UBDC 2HGHA 2EL5A 2YU8A 2VRDA 2EN3A 1P47A 2YTPA 2EM9A 2LV2A 1ZU1A 2WBTA 2EPXA 2EM4A 2EOQA 2EOEA 2EOOA 2R1FA 4GZNC 1UN6B 5KL7A 4R2DA 5KL3A 2ELZA 4M9VC 1LLMC 2DRPA 2DMIA 2EP3A 5KL6A 2EM8A 1X5WA 2YTFA 2EPUA 2YTEA 2DLKA 4F2JC 2YTGA 4F6NA 2NABA 1X6EA 2EMYA 2EQ1A 2EPPA 2EOYA 4F6MA 1F2IG 1BB8A 2EMGA 1X6FA 1Z1BA 4FK5C 2EQ3A 2WBUA 2BB8A 2EOIA 4R2PA 2EL6A 1MEYC 2DGCA 2EPCA 2MKNA 2MKDA 2EMBA 3VHTB 2EN2A 1BBOA 2EN1A 2EOMA 2E72A 2EPAA 2DLQA 2EMXA 4R2EA 4IS1C 2CTDA 1X6HA 1DGCA 2I13A 1ZAAC 2ENHA 2GHFA 2EN7A 2EMHA 2MDGA 4R2SA 1KJKA 2JP9A 2EOHA 2EORA 2EPZA 2CSHA 2YRHA 2YSPA 3M99B 4X9JA 3EPJA 2EMCA 2D9HA 3EPKA 2LT7A 1G2DC 2LO3A 2EL4A 5KL4A 2WBSA 1A1HA 1NCSA 1A1JA 2EMWA 2EQ0A 2JPAA 2M9AA 2WCC3 2EJ4A 1ZR9A 1RMDA 1X3CA 2ELYA 2EM5A 2EMKA 2EPRA 2YTIA 3EPLA 2PRTA 3UK3C 2YTDA 1TF3A 2ENCA 2YRMA 2EMAA 2EM6A 5KL5A 2EOFA 2YRKA 2YTOA 1YUJA 4WSGA 3MHSC 3EPHA 2EOSA 2YTQA 2EM3A 2EM2A 4R2RA 4R2CA 2EE8A 1JK2A 2EOJA 2ENAA 2YU5A 3MHHC 2EOZA 1TN9A 1B69A 2EM7A 1YSAC 2A25A
chains in the Genus database with same CATH superfamily
4X62E 2EM0A 1A1FA 1A1LA 4DV3E 2EOXA 1J5EE 4KZSA 1WJPA 3HPSA 2CT1A 2M4IA 4RHBB 2V89A 3HXLA 2V86A 1BBGA 1A1KA 5A6BA 1UBDC 1XMOE 4Q28A 2VRDA 4JI5E 2L92A 1YPNA 5LMNE 2LV2A 1UILA 2B7VA 2EM4A 2L8TA 2EOEA 2EOOA 4LF6E 5KL3A 2ELZA 2NA2A 4M9VC 5LLQA 2DRPA 2EP3A 5CFFE 2M7QA 3BBGA 1EH7A 1RQ0A 3L00A 2BBGA 2JVAA 2VQFE 2NUEA 1BB8A 4JI1E 2NUGA 4R2PA 1DI2A 1MEYC 2UXDE 2V87A 2N3GA 2V83A 1T4NA 3VHTB 5LL6R 2DGCA 2MKNA 4DR6E 3HTXA 2VE7C 4IS1C 2L2NA 2GHFA 2EN7A 2EMHA 2JOBA 2JWOA 4LF7E 2H36X 2B7TA 2UU9E 4JV5E 2JP9A 4DV6E 2RS6A 4NXNE 2YRHA 4OX9E 3VYXA 2YSPA 4P78A 4X64E 1PDAA 2EMCA 2D9HA 2LTSA 1NEIA 5AC4A 4R03A 1IQSA 2VF1A 5AASA 4B3RE 3HPZA 4J8ZA 2LUQA 1NCSA 4F9AB 2L2MA 5A6AA 2EQ0A 3HQ1A 2JPAA 2M9AA 2WCC3 1X3CA 2FGGA 2EMKA 1YYOA 5KL5A 4LF5E 2EPKX 2YRKA 2YTOA 1YUJA 2L6MA 3AUZA 4R2RA 1IBME 2EE8A 4X65E 2I9IA 4X8WA 2K4VA 1HNZE 2RTXA 3TQMA 2YU5A 1FKAE 4NXME 1TN9A 1HNWE 1J26A 2DSYA 2EM7A 5AE1A 2A25A 3IWBA 2EN6A 4ZYHA 2EPNA 4WPYA 4IJDA 1YUIA 2RPCA 2EMLA 3KZZA 2EMZA 4L5NC 5KL2A 2JYAA 4N4RB 1A1GA 2F8BA 3LMLA 2ADRA 3IWCA 1XMQE 2LCEA 2YSOA 1AAYA 2EMFA 2YTJA 2E5LE 2B9DA 1L4SA 4DV2E 2EM9A 4B3SE 4NZVA 3BGHA 4DV0E 1N34E 2EOQA 2L3CA 2R1FA 2Q8UA 5KL7A 4R2DA 1IBLE 1KYQA 1LLMC 2V88A 2CPNA 1PJTA 1X5WA 2DLKA 4GEQB 2B3TB 4BS9A 2NABA 2EPPA 4WFTA 5T6JA 2EOYA 4F6MA 4LFBE 1Z1BA 2EQ3A 2YWQA 4BC9A 4LU9A 4O4KA 2EMBA 4F54A 3BF2A 1BBOA 2EN1A 2EOMA 2E72A 5BR8E 2LMZA 2EMXA 2YPNA 1WHNA 1X6HA 1T38A 2YZTA 1PJSA 5AC5A 4P7DA 2MDGA 3RMPA 4JI6E 2EOHA 2MDRA 5AE2A 2EPZA 1MGTA 1T4OA 3M99B 3EPKA 3MSWA 5F3WA 1N32E 2LO3A 4KHPE 4DV1E 2LTRA 2WBSA 2LRSA 2ODRC 2UXBE 4BHBA 2LUPB 4DUYE 2V85A 2EJ4A 1ZR9A 4I8OA 1DQ3A 4F9BB 3THOB 2ODRD 2PRTA 3UK3C 3DJWA 4DUZE 3AV0A 1T39A 1O0WA 1SFEA 2YTDA 5A6BD 1X49A 4NHRA 3H09A 2YRMA 2EMAA 4DR1E 2R76A 4LTYA 4LF8E 2HJJA 4WSGA 1I94E 3EPHA 2EOSA 2YTQA 2EM3A 2EM2A 3OTOE 4BCAA 1X47A 4YHHE 1IQOA 2RQLA 5IT9C 4DR5E 2ENAA 4X66E 5LMUE 3OMLA 4DR3E 3KWRA 2F4VE 2GLIA 2EN8A 4R2AA 2LVHA 4WX9A 4JI0E 1JK1A 1RC7A 4R2QA 3C6MA 3C4BA 2YTNA 4MLVA 1TF6A 2NUFA 5IWAE 2G7HA 4DV5E 2EMIA 3P1XA 3J7AG 4RH8A 2HGHA 2EL5A 2YU8A 1FJGE 1YZ9A 4B3TE 1IMUA 2EN3A 1P47A 2YTPA 2L2KB 5A2QC 1ZU1A 2WBTA 2KOUA 4B3ME 4GZNC 1UN6B 1EKZA 2K7IA 3QG5C 3ZOQB 4O24A 2DMIA 4YY3E 5KL6A 2EM8A 4GKKE 2YTFA 4BMJA 4F2JC 3ECRA 4O5GA 2RSMA 3BIDA 4F6NA 3F6GA 2EQ1A 4O43A 4M2ZA 2EPMX 2IHR1 1F2IG 2M1SA 2EMGA 4FK5C 2EOIA 2JXPA 4R8OA 4WSPA 1X48A 4DR2E 4JI4E 1ZBQA 2EPAA 2I13A 4R2EA 2E1MA 2UUBE 1N36E 1ZBTA 3T1YE 4ZYGA 4LF4E 3J81C 2EPOA 2WZOA 3C4TA 4BHCA 3VK6A 2CSHA 4Q35B 4X9JA 4DR4E 5A6JA 3J80C 1G2DC 1HNXE 1A1HA 1QU6A 1YYKA 2EMWA 3LLHA 1T4LB 5A69A 4JI7E 2UXCE 1RMDA 1STUA 2EM5A 2LJUA 3EPLA 2HC5A 2UUAE 2ENCA 2EOFA 2V8QB 4BC7A 3C6KA 5FLXC 2L33A 3MHSC 5IXMB 1WHQA 2EWLA 4KWYA 4JI8E 1JK2A 3JU0A 2MC6A 4TUGA 2LJHA 1GZ6A 1YYWA 4OOGC 4MLQA 1B69A 1N33E 3THNA 2EN4A 1WXRA 3EQ1A 1GTKA 1QNTA 3DF6A 3VYYA 4DMIA 5ADZA 1G2FC 2EZ6A 1EH8A 2J7JA 3ADLA 1A1IA 2RSIA 4ZYDA 3ADJA 2JOXA 3T1HE 2LBSB 2RS7A 2VQEE 2EPXA 2KONA 4WXCA 4HTGA 4LFCE 3K6QA 2ZM6E 4DR7E 3FIGA 1IBKE 4DKKA 2EPUA 2YTEA 4K0KE 2YTGA 1EH6A 1X6EA 2EMYA 2N3HA 1YFHA 2KHXA 3ADIA 2EPLX 1PJQA 4LF9E 2YT4A 2DMYA 1X6FA 2FV4B 3F6HA 5DNYA 5IV8B 2WBUA 2BB8A 4JI3E 1XNQE 2EL6A 2GPIA 2EPCA 1AH5A 2MKDA 2UUCE 2EN2A 2N8XA 4WXDA 1UHZA 3J7Yp 5A6KA 4F9CB 1WRJA 2DLQA 1DGCA 2CTDA 4M30A 2L3JA 1SR9A 2ENHA 4DV4E 1HR0E 1ZAAC 2FTXB 5TSEA 4WYQB 4R2SA 2HHHE 1KJKA 2EORA 3JAMC 3EPJA 4ZYEA 2LT7A 4JYAE 4M0VA 4L8NA 2EL4A 2JR1A 2LE2A 5KL4A 3ADGA 3IWDA 4JI2E 1A1JA 2MC5A 2JY9A 3JTZA 2ELYA 2EPRA 2YTIA 4BBYA 1TF3A 1N3GA 1PKPA 4LFAE 2EM6A 4HEIA 5AE3A 4R2CA 4AQYE 1GQEA 2DIXA 3KZYA 2EOJA 4GKJE 2DB2A 3MHHC 2EOZA 1XNRE 4TUIA 1YSAC 4DV7E
chains in the Genus database with same CATH topology
2EN4A 2EN6A 2EM0A 4IJDA 1YUIA 2RPCA 2GLIA 2EMLA 2EMZA 2EN8A 5KL2A 1A1FA 4R2AA 2LVHA 1A1LA 1JK1A 2EOXA 1WJPA 1A1GA 2CT1A 4R2QA 1G2FC 2YTNA 2ADRA 1TF6A 2J7JA 2LCEA 2YSOA 1AAYA 1A1IA 2RSIA 1A1KA 2EMIA 2EMFA 2YTJA 1UBDC 2HGHA 2EL5A 2YU8A 2VRDA 2EN3A 1P47A 2YTPA 2EM9A 2LV2A 1ZU1A 2WBTA 2EPXA 2EM4A 2EOQA 2EOEA 2EOOA 2R1FA 4GZNC 1UN6B 5KL7A 4R2DA 5KL3A 2ELZA 4M9VC 1LLMC 2DRPA 2DMIA 2EP3A 5KL6A 2EM8A 1X5WA 2YTFA 2EPUA 2YTEA 2DLKA 4F2JC 2YTGA 4F6NA 2NABA 1X6EA 2EMYA 2EQ1A 2EPPA 2EOYA 4F6MA 1F2IG 1BB8A 2EMGA 1X6FA 1Z1BA 4FK5C 2EQ3A 2WBUA 2BB8A 2EOIA 4R2PA 2EL6A 1MEYC 2DGCA 2EPCA 2MKNA 2MKDA 2EMBA 3VHTB 2EN2A 1BBOA 2EN1A 2EOMA 2E72A 2EPAA 2DLQA 2EMXA 4R2EA 4IS1C 2CTDA 1X6HA 1DGCA 2I13A 1ZAAC 2ENHA 2GHFA 2EN7A 2EMHA 2MDGA 4R2SA 1KJKA 2JP9A 2EOHA 2EORA 2EPZA 2CSHA 2YRHA 2YSPA 3M99B 4X9JA 3EPJA 2EMCA 2D9HA 3EPKA 2LT7A 1G2DC 2LO3A 2EL4A 5KL4A 2WBSA 1A1HA 1NCSA 1A1JA 2EMWA 2EQ0A 2JPAA 2M9AA 2WCC3 2EJ4A 1ZR9A 1RMDA 1X3CA 2ELYA 2EM5A 2EMKA 2EPRA 2YTIA 3EPLA 2PRTA 3UK3C 2YTDA 1TF3A 2ENCA 2YRMA 2EMAA 2EM6A 5KL5A 2EOFA 2YRKA 2YTOA 1YUJA 4WSGA 3MHSC 3EPHA 2EOSA 2YTQA 2EM3A 2EM2A 4R2RA 4R2CA 2EE8A 1JK2A 2EOJA 2ENAA 2YU5A 3MHHC 2EOZA 1TN9A 1B69A 2EM7A 1YSAC 2A25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN4 A;  2EN6 A;  2EM0 A;  4IJD A;  1YUI A;  2RPC A;  2GLI A;  2EML A;  2EMZ A;  2EN8 A;  5KL2 A;  1A1F A;  4R2A A;  2LVH A;  1A1L A;  1JK1 A;  2EOX A;  1WJP A;  1A1G A;  2CT1 A;  4R2Q A;  1G2F C;  2YTN A;  2ADR A;  1TF6 A;  2J7J A;  2LCE A;  2YSO A;  1AAY A;  1A1I A;  2RSI A;  1A1K A;  2EMI A;  2EMF A;  2YTJ A;  1UBD C;  2HGH A;  2EL5 A;  2YU8 A;  2VRD A;  2EN3 A;  1P47 A;  2YTP A;  2EM9 A;  2LV2 A;  1ZU1 A;  2WBT A;  2EPX A;  2EM4 A;  2EOQ A;  2EOE A;  2EOO A;  2R1F A;  4GZN C;  1UN6 B;  5KL7 A;  4R2D A;  5KL3 A;  2ELZ A;  4M9V C;  1LLM C;  2DRP A;  2DMI A;  2EP3 A;  5KL6 A;  2EM8 A;  1X5W A;  2YTF A;  2EPU A;  2YTE A;  2DLK A;  4F2J C;  2YTG A;  4F6N A;  2NAB A;  1X6E A;  2EMY A;  2EQ1 A;  2EPP A;  2EOY A;  4F6M A;  1F2I G;  1BB8 A;  2EMG A;  1X6F A;  1Z1B A;  4FK5 C;  2EQ3 A;  2WBU A;  2BB8 A;  2EOI A;  4R2P A;  2EL6 A;  1MEY C;  2DGC A;  2EPC A;  2MKN A;  2MKD A;  2EMB A;  3VHT B;  2EN2 A;  1BBO A;  2EN1 A;  2EOM A;  2E72 A;  2EPA A;  2DLQ A;  2EMX A;  4R2E A;  4IS1 C;  2CTD A;  1X6H A;  1DGC A;  2I13 A;  1ZAA C;  2ENH A;  2GHF A;  2EN7 A;  2EMH A;  2MDG A;  4R2S A;  1KJK A;  2JP9 A;  2EOH A;  2EOR A;  2EPZ A;  2CSH A;  2YRH A;  2YSP A;  3M99 B;  4X9J A;  3EPJ A;  2EMC A;  2D9H A;  3EPK A;  2LT7 A;  1G2D C;  2LO3 A;  2EL4 A;  5KL4 A;  2WBS A;  1A1H A;  1NCS A;  1A1J A;  2EMW A;  2EQ0 A;  2JPA A;  2M9A A;  2WCC 3;  2EJ4 A;  1ZR9 A;  1RMD A;  1X3C A;  2ELY A;  2EM5 A;  2EMK A;  2EPR A;  2YTI A;  3EPL A;  2PRT A;  3UK3 C;  2YTD A;  1TF3 A;  2ENC A;  2YRM A;  2EMA A;  2EM6 A;  5KL5 A;  2EOF A;  2YRK A;  2YTO A;  1YUJ A;  4WSG A;  3MHS C;  3EPH A;  2EOS A;  2YTQ A;  2EM3 A;  2EM2 A;  4R2R A;  4R2C A;  2EE8 A;  1JK2 A;  2EOJ A;  2ENA A;  2YU5 A;  3MHH C;  2EOZ A;  1TN9 A;  1B69 A;  2EM7 A;  1YSA C;  2A25 A; 
#chains in the Genus database with same CATH topology
 4X62 E;  2EM0 A;  1A1F A;  1A1L A;  4DV3 E;  2EOX A;  1J5E E;  4KZS A;  1WJP A;  3HPS A;  2CT1 A;  2M4I A;  4RHB B;  2V89 A;  3HXL A;  2V86 A;  1BBG A;  1A1K A;  5A6B A;  1UBD C;  1XMO E;  4Q28 A;  2VRD A;  4JI5 E;  2L92 A;  1YPN A;  5LMN E;  2LV2 A;  1UIL A;  2B7V A;  2EM4 A;  2L8T A;  2EOE A;  2EOO A;  4LF6 E;  5KL3 A;  2ELZ A;  2NA2 A;  4M9V C;  5LLQ A;  2DRP A;  2EP3 A;  5CFF E;  2M7Q A;  3BBG A;  1EH7 A;  1RQ0 A;  3L00 A;  2BBG A;  2JVA A;  2VQF E;  2NUE A;  1BB8 A;  4JI1 E;  2NUG A;  4R2P A;  1DI2 A;  1MEY C;  2UXD E;  2V87 A;  2N3G A;  2V83 A;  1T4N A;  3VHT B;  5LL6 R;  2DGC A;  2MKN A;  4DR6 E;  3HTX A;  2VE7 C;  4IS1 C;  2L2N A;  2GHF A;  2EN7 A;  2EMH A;  2JOB A;  2JWO A;  4LF7 E;  2H36 X;  2B7T A;  2UU9 E;  4JV5 E;  2JP9 A;  4DV6 E;  2RS6 A;  4NXN E;  2YRH A;  4OX9 E;  3VYX A;  2YSP A;  4P78 A;  4X64 E;  1PDA A;  2EMC A;  2D9H A;  2LTS A;  1NEI A;  5AC4 A;  4R03 A;  1IQS A;  2VF1 A;  5AAS A;  4B3R E;  3HPZ A;  4J8Z A;  2LUQ A;  1NCS A;  4F9A B;  2L2M A;  5A6A A;  2EQ0 A;  3HQ1 A;  2JPA A;  2M9A A;  2WCC 3;  1X3C A;  2FGG A;  2EMK A;  1YYO A;  5KL5 A;  4LF5 E;  2EPK X;  2YRK A;  2YTO A;  1YUJ A;  2L6M A;  3AUZ A;  4R2R A;  1IBM E;  2EE8 A;  4X65 E;  2I9I A;  4X8W A;  2K4V A;  1HNZ E;  2RTX A;  3TQM A;  2YU5 A;  1FKA E;  4NXM E;  1TN9 A;  1HNW E;  1J26 A;  2DSY A;  2EM7 A;  5AE1 A;  2A25 A;  3IWB A;  2EN6 A;  4ZYH A;  2EPN A;  4WPY A;  4IJD A;  1YUI A;  2RPC A;  2EML A;  3KZZ A;  2EMZ A;  4L5N C;  5KL2 A;  2JYA A;  4N4R B;  1A1G A;  2F8B A;  3LML A;  2ADR A;  3IWC A;  1XMQ E;  2LCE A;  2YSO A;  1AAY A;  2EMF A;  2YTJ A;  2E5L E;  2B9D A;  1L4S A;  4DV2 E;  2EM9 A;  4B3S E;  4NZV A;  3BGH A;  4DV0 E;  1N34 E;  2EOQ A;  2L3C A;  2R1F A;  2Q8U A;  5KL7 A;  4R2D A;  1IBL E;  1KYQ A;  1LLM C;  2V88 A;  2CPN A;  1PJT A;  1X5W A;  2DLK A;  4GEQ B;  2B3T B;  4BS9 A;  2NAB A;  2EPP A;  4WFT A;  5T6J A;  2EOY A;  4F6M A;  4LFB E;  1Z1B A;  2EQ3 A;  2YWQ A;  4BC9 A;  4LU9 A;  4O4K A;  2EMB A;  4F54 A;  3BF2 A;  1BBO A;  2EN1 A;  2EOM A;  2E72 A;  5BR8 E;  2LMZ A;  2EMX A;  2YPN A;  1WHN A;  1X6H A;  1T38 A;  2YZT A;  1PJS A;  5AC5 A;  4P7D A;  2MDG A;  3RMP A;  4JI6 E;  2EOH A;  2MDR A;  5AE2 A;  2EPZ A;  1MGT A;  1T4O A;  3M99 B;  3EPK A;  3MSW A;  5F3W A;  1N32 E;  2LO3 A;  4KHP E;  4DV1 E;  2LTR A;  2WBS A;  2LRS A;  2ODR C;  2UXB E;  4BHB A;  2LUP B;  4DUY E;  2V85 A;  2EJ4 A;  1ZR9 A;  4I8O A;  1DQ3 A;  4F9B B;  3THO B;  2ODR D;  2PRT A;  3UK3 C;  3DJW A;  4DUZ E;  3AV0 A;  1T39 A;  1O0W A;  1SFE A;  2YTD A;  5A6B D;  1X49 A;  4NHR A;  3H09 A;  2YRM A;  2EMA A;  4DR1 E;  2R76 A;  4LTY A;  4LF8 E;  2HJJ A;  4WSG A;  1I94 E;  3EPH A;  2EOS A;  2YTQ A;  2EM3 A;  2EM2 A;  3OTO E;  4BCA A;  1X47 A;  4YHH E;  1IQO A;  2RQL A;  5IT9 C;  4DR5 E;  2ENA A;  4X66 E;  5LMU E;  3OML A;  4DR3 E;  3KWR A;  2F4V E;  2GLI A;  2EN8 A;  4R2A A;  2LVH A;  4WX9 A;  4JI0 E;  1JK1 A;  1RC7 A;  4R2Q A;  3C6M A;  3C4B A;  2YTN A;  4MLV A;  1TF6 A;  2NUF A;  5IWA E;  2G7H A;  4DV5 E;  2EMI A;  3P1X A;  3J7A G;  4RH8 A;  2HGH A;  2EL5 A;  2YU8 A;  1FJG E;  1YZ9 A;  4B3T E;  1IMU A;  2EN3 A;  1P47 A;  2YTP A;  2L2K B;  5A2Q C;  1ZU1 A;  2WBT A;  2KOU A;  4B3M E;  4GZN C;  1UN6 B;  1EKZ A;  2K7I A;  3QG5 C;  3ZOQ B;  4O24 A;  2DMI A;  4YY3 E;  5KL6 A;  2EM8 A;  4GKK E;  2YTF A;  4BMJ A;  4F2J C;  3ECR A;  4O5G A;  2RSM A;  3BID A;  4F6N A;  3F6G A;  2EQ1 A;  4O43 A;  4M2Z A;  2EPM X;  2IHR 1;  1F2I G;  2M1S A;  2EMG A;  4FK5 C;  2EOI A;  2JXP A;  4R8O A;  4WSP A;  1X48 A;  4DR2 E;  4JI4 E;  1ZBQ A;  2EPA A;  2I13 A;  4R2E A;  2E1M A;  2UUB E;  1N36 E;  1ZBT A;  3T1Y E;  4ZYG A;  4LF4 E;  3J81 C;  2EPO A;  2WZO A;  3C4T A;  4BHC A;  3VK6 A;  2CSH A;  4Q35 B;  4X9J A;  4DR4 E;  5A6J A;  3J80 C;  1G2D C;  1HNX E;  1A1H A;  1QU6 A;  1YYK A;  2EMW A;  3LLH A;  1T4L B;  5A69 A;  4JI7 E;  2UXC E;  1RMD A;  1STU A;  2EM5 A;  2LJU A;  3EPL A;  2HC5 A;  2UUA E;  2ENC A;  2EOF A;  2V8Q B;  4BC7 A;  3C6K A;  5FLX C;  2L33 A;  3MHS C;  5IXM B;  1WHQ A;  2EWL A;  4KWY A;  4JI8 E;  1JK2 A;  3JU0 A;  2MC6 A;  4TUG A;  2LJH A;  1GZ6 A;  1YYW A;  4OOG C;  4MLQ A;  1B69 A;  1N33 E;  3THN A;  2EN4 A;  1WXR A;  3EQ1 A;  1GTK A;  1QNT A;  3DF6 A;  3VYY A;  4DMI A;  5ADZ A;  1G2F C;  2EZ6 A;  1EH8 A;  2J7J A;  3ADL A;  1A1I A;  2RSI A;  4ZYD A;  3ADJ A;  2JOX A;  3T1H E;  2LBS B;  2RS7 A;  2VQE E;  2EPX A;  2KON A;  4WXC A;  4HTG A;  4LFC E;  3K6Q A;  2ZM6 E;  4DR7 E;  3FIG A;  1IBK E;  4DKK A;  2EPU A;  2YTE A;  4K0K E;  2YTG A;  1EH6 A;  1X6E A;  2EMY A;  2N3H A;  1YFH A;  2KHX A;  3ADI A;  2EPL X;  1PJQ A;  4LF9 E;  2YT4 A;  2DMY A;  1X6F A;  2FV4 B;  3F6H A;  5DNY A;  5IV8 B;  2WBU A;  2BB8 A;  4JI3 E;  1XNQ E;  2EL6 A;  2GPI A;  2EPC A;  1AH5 A;  2MKD A;  2UUC E;  2EN2 A;  2N8X A;  4WXD A;  1UHZ A;  3J7Y p;  5A6K A;  4F9C B;  1WRJ A;  2DLQ A;  1DGC A;  2CTD A;  4M30 A;  2L3J A;  1SR9 A;  2ENH A;  4DV4 E;  1HR0 E;  1ZAA C;  2FTX B;  5TSE A;  4WYQ B;  4R2S A;  2HHH E;  1KJK A;  2EOR A;  3JAM C;  3EPJ A;  4ZYE A;  2LT7 A;  4JYA E;  4M0V A;  4L8N A;  2EL4 A;  2JR1 A;  2LE2 A;  5KL4 A;  3ADG A;  3IWD A;  4JI2 E;  1A1J A;  2MC5 A;  2JY9 A;  3JTZ A;  2ELY A;  2EPR A;  2YTI A;  4BBY A;  1TF3 A;  1N3G A;  1PKP A;  4LFA E;  2EM6 A;  4HEI A;  5AE3 A;  4R2C A;  4AQY E;  1GQE A;  2DIX A;  3KZY A;  2EOJ A;  4GKJ E;  2DB2 A;  3MHH C;  2EOZ A;  1XNR E;  4TUI A;  1YSA C;  4DV7 E; 
#chains in the Genus database with same CATH homology
 2EN4 A;  2EN6 A;  2EM0 A;  4IJD A;  1YUI A;  2RPC A;  2GLI A;  2EML A;  2EMZ A;  2EN8 A;  5KL2 A;  1A1F A;  4R2A A;  2LVH A;  1A1L A;  1JK1 A;  2EOX A;  1WJP A;  1A1G A;  2CT1 A;  4R2Q A;  1G2F C;  2YTN A;  2ADR A;  1TF6 A;  2J7J A;  2LCE A;  2YSO A;  1AAY A;  1A1I A;  2RSI A;  1A1K A;  2EMI A;  2EMF A;  2YTJ A;  1UBD C;  2HGH A;  2EL5 A;  2YU8 A;  2VRD A;  2EN3 A;  1P47 A;  2YTP A;  2EM9 A;  2LV2 A;  1ZU1 A;  2WBT A;  2EPX A;  2EM4 A;  2EOQ A;  2EOE A;  2EOO A;  2R1F A;  4GZN C;  1UN6 B;  5KL7 A;  4R2D A;  5KL3 A;  2ELZ A;  4M9V C;  1LLM C;  2DRP A;  2DMI A;  2EP3 A;  5KL6 A;  2EM8 A;  1X5W A;  2YTF A;  2EPU A;  2YTE A;  2DLK A;  4F2J C;  2YTG A;  4F6N A;  2NAB A;  1X6E A;  2EMY A;  2EQ1 A;  2EPP A;  2EOY A;  4F6M A;  1F2I G;  1BB8 A;  2EMG A;  1X6F A;  1Z1B A;  4FK5 C;  2EQ3 A;  2WBU A;  2BB8 A;  2EOI A;  4R2P A;  2EL6 A;  1MEY C;  2DGC A;  2EPC A;  2MKN A;  2MKD A;  2EMB A;  3VHT B;  2EN2 A;  1BBO A;  2EN1 A;  2EOM A;  2E72 A;  2EPA A;  2DLQ A;  2EMX A;  4R2E A;  4IS1 C;  2CTD A;  1X6H A;  1DGC A;  2I13 A;  1ZAA C;  2ENH A;  2GHF A;  2EN7 A;  2EMH A;  2MDG A;  4R2S A;  1KJK A;  2JP9 A;  2EOH A;  2EOR A;  2EPZ A;  2CSH A;  2YRH A;  2YSP A;  3M99 B;  4X9J A;  3EPJ A;  2EMC A;  2D9H A;  3EPK A;  2LT7 A;  1G2D C;  2LO3 A;  2EL4 A;  5KL4 A;  2WBS A;  1A1H A;  1NCS A;  1A1J A;  2EMW A;  2EQ0 A;  2JPA A;  2M9A A;  2WCC 3;  2EJ4 A;  1ZR9 A;  1RMD A;  1X3C A;  2ELY A;  2EM5 A;  2EMK A;  2EPR A;  2YTI A;  3EPL A;  2PRT A;  3UK3 C;  2YTD A;  1TF3 A;  2ENC A;  2YRM A;  2EMA A;  2EM6 A;  5KL5 A;  2EOF A;  2YRK A;  2YTO A;  1YUJ A;  4WSG A;  3MHS C;  3EPH A;  2EOS A;  2YTQ A;  2EM3 A;  2EM2 A;  4R2R A;  4R2C A;  2EE8 A;  1JK2 A;  2EOJ A;  2ENA A;  2YU5 A;  3MHH C;  2EOZ A;  1TN9 A;  1B69 A;  2EM7 A;  1YSA C;  2A25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...