1YSAC

The gcn4 basic region leucine zipper binds dna as a dimer of uninterrupted alpha helices: crystal structure of the protein-dna complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
KDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*TP*CP*CP*TP*AP*TP*GP*AP*CP*TP*CP*AP*TP*CP*CP*A
publication title The GCN4 basic region leucine zipper binds DNA as a dimer of uninterrupted alpha helices: crystal structure of the protein-DNA complex.
pubmed doi rcsb
total genus 21
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 1993-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ysaC00
2ENCA 2EL4A 4R2QA 4R2AA 2EN1A 3EPLA 1A1JA 3UK3C 2GLIA 2YTJA 1P47A 1B69A 1NCSA 2YTEA 2DLKA 1A1LA 2EPCA 2GHFA 2YTNA 4WSGA 3EPKA 1A1FA 1X6FA 2LO3A 2EMWA 2MKNA 2EOFA 2YTDA 1X5WA 2YRHA 1DGCA 1JK2A 3M99B 2EMLA 2CTDA 2ELZA 2EOSA 2EM7A 2EOXA 2WBTA 2YRKA 5KL4A 4R2PA 2VRDA 1X6HA 2YTQA 2LVHA 5KL7A 4R2RA 2YTFA 5KL3A 2EN4A 2ELYA 1A1HA 3MHSC 2PRTA 1Z1BA 4IJDA 2LCEA 1AAYA 2EN6A 5KL5A 2EL6A 4R2CA 2BB8A 2WCC3 3EPHA 2EOJA 3MHHC 2EPUA 1YUJA 1UBDC 1X6EA 2EMKA 2YTIA 2EPZA 2EMGA 1BBOA 2EQ1A 1TF6A 2EMAA 4FK5C 4F2JC 2EMHA 2E72A 2YTGA 2EM6A 1KJKA 2EM4A 4F6MA 2RPCA 2EPPA 2YTOA 2DGCA 2EOOA 1YSAC 2DRPA 2NABA 2I13A 1BB8A 2EJ4A 2YTPA 1ZAAC 2EM0A 1UN6B 4R2EA 2EN3A 2EOHA 4X9JA 1TN9A 2LT7A 2EM3A 2WBSA 1YUIA 2EL5A 2MDGA 2EOEA 4R2SA 2YRMA 1ZR9A 4IS1C 2JPAA 2EQ3A 2EOIA 2EOMA 2EOYA 2ENAA 2EM2A 2CT1A 1G2FC 1RMDA 2EMIA 2EPXA 2CSHA 2EMCA 1LLMC 1G2DC 2EN7A 2EMFA 2A25A 2YU5A 5KL2A 2EOZA 2EN8A 1MEYC 2J7JA 2EMYA 2M9AA 2LV2A 1X3CA 2EPAA 2WBUA 2EM8A 1A1GA 2EOQA 2EMBA 2HGHA 2EM9A 3EPJA 2EN2A 2D9HA 1A1IA 1JK1A 1ZU1A 4F6NA 2EP3A 2EM5A 2EQ0A 2EMXA 2YSOA 4GZNC 2ADRA 4R2DA 2YU8A 5KL6A 2DMIA 1TF3A 2EE8A 2EORA 2R1FA 2MKDA 2EPRA 2DLQA 2EMZA 3VHTB 1A1KA 1F2IG 4M9VC 2ENHA 2YSPA 2RSIA 2JP9A 1WJPA
chains in the Genus database with same CATH superfamily
2R76A 4R2AA 3K6QA 2YTJA 3JU0A 1T4OA 2YTEA 2DLKA 4O5GA 5A69A 2LE2A 2L2MA 1J5EE 3HPZA 2YTNA 4WSGA 1WHQA 5A6KA 2KONA 2MDRA 2HHHE 2VQFE 1SR9A 1JK2A 3M99B 2EMLA 5KL4A 4HTGA 4R2PA 4AQYE 2LVHA 2GPIA 5KL3A 3MHSC 2RSMA 1Z1BA 1AAYA 2LJHA 3AUZA 2EL6A 4DR6E 2WCC3 5IV8B 2EOJA 1FKAE 2YT4A 3TQMA 3ADGA 1UBDC 1X6EA 1EH6A 1RQ0A 2EMGA 2N8XA 2YTIA 1BBOA 2EQ1A 2H36X 2LBSB 4FK5C 4F2JC 1GTKA 2I9IA 1EKZA 2RPCA 5LL6R 2YTOA 2DGCA 2DRPA 1YSAC 4YY3E 2EJ4A 1UN6B 4J8ZA 2V87A 4KWYA 2LT7A 1PJTA 2EM3A 4BHCA 1YUIA 4DR3E 2EL5A 5T6JA 3LMLA 2EOIA 1N36E 2EOYA 2M4IA 4ZYDA 2CT1A 5A2QC 4BMJA 3THOB 1IMUA 2DSYA 4JI0E 2N3HA 2JVAA 1WRJA 2UXCE 2EPKX 2EOZA 2JYAA 1MEYC 5TSEA 3J7AG 2JXPA 2M9AA 3ADIA 2EOQA 4NXNE 2EN2A 3BF2A 5A6AA 2K7IA 1QU6A 2D9HA 2VE7C 1A1IA 2EM5A 3KWRA 4O4KA 4R2DA 2DMIA 2V83A 2WZOA 2BBGA 2EPNA 2EMZA 1N33E 3EQ1A 4LFAE 4JV5E 4TUGA 1HR0E 2EL4A 4R2QA 2MC6A 4DV4E 3UK3C 2GLIA 2M1SA 1B69A 1A1LA 2EPCA 4X65E 3VYYA 3QG5C 2V85A 1PDAA 1A1FA 4R03A 4I8OA 1ZBQA 1N32E 1YPNA 2HC5A 3BGHA 4Q28A 3HPSA 3P1XA 5LMUE 4M2ZA 3IWCA 3L00A 2EOSA 2YRKA 4WYQB 1IQSA 1HNZE 1YYWA 5KL7A 4R2RA 2YTFA 2YWQA 4M0VA 4TUIA 4DR7E 2EN4A 2DIXA 2Q8UA 4NHRA 4IJDA 2LCEA 1YZ9A 2EPMX 1EH8A 2UU9E 4N4RB 2FTXB 3EPHA 4O43A 4LF4E 1KYQA 3OTOE 2EMKA 4BC7A 3KZZA 4DKKA 1TF6A 2EMAA 4ZYGA 2YPNA 5FLXC 2EM6A 1KJKA 2V89A 4B3SE 4MLQA 2V88A 3F6HA 2EM0A 3C4BA 2ODRC 3C6KA 4X9JA 2MDGA 2V86A 2B7TA 4IS1C 4JI4E 2JPAA 1DI2A 2EOMA 2MC5A 4X66E 3ADLA 3BIDA 4DR1E 4BS9A 1G2FC 4DV3E 1RMDA 2EMIA 2EPXA 1QNTA 1NEIA 2EN7A 2EMFA 1WXRA 2A25A 1XNRE 2LTRA 4LF6E 4B3TE 4BBYA 1T4NA 2EN8A 2EZ6A 1X3CA 2UXDE 4RHBB 3JAMC 4P78A 3EPJA 1FJGE 4X8WA 2K4VA 1SFEA 1JK1A 4F6NA 3IWDA 4MLVA 2EQ0A 5IXMB 4DV7E 2ADRA 2L3CA 3AV0A 1DQ3A 1PJQA 2JOXA 4X62E 4OX9E 2M7QA 4DV6E 4JYAE 2LTSA 2EPRA 1YYKA 2DLQA 3VHTB 1A1KA 4LF9E 1I94E 2RSIA 4WXCA 3DF6A 2DB2A 1YFHA 1A1JA 2CPNA 5AC5A 2L2KB 3IWBA 5A6JA 1N34E 3ECRA 4GEQB 3EPKA 4M30A 2LO3A 2NUGA 2HJJA 2EOFA 2V8QB 2YTDA 1X5WA 1T4LB 2YRHA 1DGCA 2JOBA 2CTDA 2VQEE 1WHNA 2ELZA 4DV0E 2EOXA 2EM7A 2WBTA 4JI8E 2VRDA 2YTQA 2FV4B 4BC9A 1XNQE 1MGTA 3J81C 3RMPA 2ELYA 3T1YE 5LLQA 2EN6A 1STUA 4WX9A 1UILA 2EWLA 1XMOE 2EPUA 1YUJA 3MSWA 4DR2E 2EPZA 4F9BB 4LU9A 2EMHA 5A6BD 3DJWA 3JTZA 2UUBE 4OOGC 5CFFE 4DUYE 4F6MA 2EPPA 5BR8E 2NABA 4K0KE 2IHR1 1T38A 1ZAAC 1XMQE 4R2EA 2E1MA 4NXME 5LMNE 1IBKE 2LRSA 2WBSA 4DV1E 4L5NC 2EOEA 4R2SA 1X47A 1X48A 3VYXA 4LFCE 2L92A 4LF7E 5ADZA 2UXBE 4JI3E 2EM2A 3HXLA 1ZBTA 5IT9C 2E5LE 1UHZA 2CSHA 2EMCA 1G2DC 2YU5A 5KL2A 1BBGA 1GQEA 2J7JA 2WBUA 2LV2A 3J7Yp 2LJUA 3ADJA 5A6BA 1IQOA 3C6MA 2EMBA 3H09A 4LF8E 1X49A 4Q35B 3FIGA 4WSPA 1HNXE 1ZU1A 4LFBE 2B9DA 4DR5E 2RS7A 2EMXA 4F54A 4DV5E 2L33A 2YU8A 5KL6A 2EE8A 4B3ME 2JR1A 2EPLX 1O0WA 2L3JA 2LMZA 4X64E 2ENHA 4LTYA 5AE2A 2YSPA 1X6HA 1IBME 2NUFA 2ENCA 3LLHA 2EN1A 3EPLA 1P47A 3T1HE 1NCSA 4BHBA 4LF5E 4B3RE 5F3WA 4BCAA 2B7VA 2GHFA 3J80C 4ZYEA 4GKKE 2ZM6E 1X6FA 2EMWA 2MKNA 2EPOA 1T39A 3VK6A 4WPYA 4KZSA 2NUEA 4YHHE 3OMLA 3KZYA 4DR4E 4DMIA 2VF1A 3ZOQB 1AH5A 1HNWE 1A1HA 2PRTA 1PKPA 5KL5A 4ZYHA 4R2CA 2BB8A 4GKJE 3MHHC 1PJSA 5IWAE 4JI5E 4JI7E 5AE3A 3HQ1A 5AE1A 3BBGA 4JI2E 4F9AB 3F6GA 2E72A 2YTGA 4L8NA 2EM4A 2EOOA 2I13A 1BB8A 2L6MA 4WFTA 4RH8A 2YTPA 2L2NA 2F8BA 3THNA 4DV2E 2EN3A 2EOHA 2G7HA 2ODRD 2B3TB 4R8OA 1TN9A 2RTXA 2KHXA 4DUZE 4JI6E 3HTXA 1RC7A 2YRMA 1ZR9A 2UUAE 4JI1E 2LUPB 2LUQA 2NA2A 2EQ3A 5DNYA 2ENAA 1L4SA 2F4VE 2N3GA 4NZVA 4WXDA 1LLMC 2UUCE 1J26A 1IBLE 2RQLA 1GZ6A 4O24A 2L8TA 2EMYA 2EPAA 4KHPE 2EM8A 1A1GA 1YYOA 2HGHA 4F9CB 2EM9A 4HEIA 2YZTA 1N3GA 2FGGA 2EP3A 3C4TA 4P7DA 2YSOA 4GZNC 2JWOA 2DMYA 5AASA 1EH7A 1TF3A 2EORA 2R1FA 2RS6A 2MKDA 2KOUA 2JY9A 1F2IG 4M9VC 5AC4A 2JP9A 1WJPA
chains in the Genus database with same CATH topology
2ENCA 2EL4A 4R2QA 4R2AA 2EN1A 3EPLA 1A1JA 3UK3C 2GLIA 2YTJA 1P47A 1B69A 1NCSA 2YTEA 2DLKA 1A1LA 2EPCA 2GHFA 2YTNA 4WSGA 3EPKA 1A1FA 1X6FA 2LO3A 2EMWA 2MKNA 2EOFA 2YTDA 1X5WA 2YRHA 1DGCA 1JK2A 3M99B 2EMLA 2CTDA 2ELZA 2EOSA 2EM7A 2EOXA 2WBTA 2YRKA 5KL4A 4R2PA 2VRDA 1X6HA 2YTQA 2LVHA 5KL7A 4R2RA 2YTFA 5KL3A 2EN4A 2ELYA 1A1HA 3MHSC 2PRTA 1Z1BA 4IJDA 2LCEA 1AAYA 2EN6A 5KL5A 2EL6A 4R2CA 2BB8A 2WCC3 3EPHA 2EOJA 3MHHC 2EPUA 1YUJA 1UBDC 1X6EA 2EMKA 2YTIA 2EPZA 2EMGA 1BBOA 2EQ1A 1TF6A 2EMAA 4FK5C 4F2JC 2EMHA 2E72A 2YTGA 2EM6A 1KJKA 2EM4A 4F6MA 2RPCA 2EPPA 2YTOA 2DGCA 2EOOA 1YSAC 2DRPA 2NABA 2I13A 1BB8A 2EJ4A 2YTPA 1ZAAC 2EM0A 1UN6B 4R2EA 2EN3A 2EOHA 4X9JA 1TN9A 2LT7A 2EM3A 2WBSA 1YUIA 2EL5A 2MDGA 2EOEA 4R2SA 2YRMA 1ZR9A 4IS1C 2JPAA 2EQ3A 2EOIA 2EOMA 2EOYA 2ENAA 2EM2A 2CT1A 1G2FC 1RMDA 2EMIA 2EPXA 2CSHA 2EMCA 1LLMC 1G2DC 2EN7A 2EMFA 2A25A 2YU5A 5KL2A 2EOZA 2EN8A 1MEYC 2J7JA 2EMYA 2M9AA 2LV2A 1X3CA 2EPAA 2WBUA 2EM8A 1A1GA 2EOQA 2EMBA 2HGHA 2EM9A 3EPJA 2EN2A 2D9HA 1A1IA 1JK1A 1ZU1A 4F6NA 2EP3A 2EM5A 2EQ0A 2EMXA 2YSOA 4GZNC 2ADRA 4R2DA 2YU8A 5KL6A 2DMIA 1TF3A 2EE8A 2EORA 2R1FA 2MKDA 2EPRA 2DLQA 2EMZA 3VHTB 1A1KA 1F2IG 4M9VC 2ENHA 2YSPA 2RSIA 2JP9A 1WJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENC A;  2EL4 A;  4R2Q A;  4R2A A;  2EN1 A;  3EPL A;  1A1J A;  3UK3 C;  2GLI A;  2YTJ A;  1P47 A;  1B69 A;  1NCS A;  2YTE A;  2DLK A;  1A1L A;  2EPC A;  2GHF A;  2YTN A;  4WSG A;  3EPK A;  1A1F A;  1X6F A;  2LO3 A;  2EMW A;  2MKN A;  2EOF A;  2YTD A;  1X5W A;  2YRH A;  1DGC A;  1JK2 A;  3M99 B;  2EML A;  2CTD A;  2ELZ A;  2EOS A;  2EM7 A;  2EOX A;  2WBT A;  2YRK A;  5KL4 A;  4R2P A;  2VRD A;  1X6H A;  2YTQ A;  2LVH A;  5KL7 A;  4R2R A;  2YTF A;  5KL3 A;  2EN4 A;  2ELY A;  1A1H A;  3MHS C;  2PRT A;  1Z1B A;  4IJD A;  2LCE A;  1AAY A;  2EN6 A;  5KL5 A;  2EL6 A;  4R2C A;  2BB8 A;  2WCC 3;  3EPH A;  2EOJ A;  3MHH C;  2EPU A;  1YUJ A;  1UBD C;  1X6E A;  2EMK A;  2YTI A;  2EPZ A;  2EMG A;  1BBO A;  2EQ1 A;  1TF6 A;  2EMA A;  4FK5 C;  4F2J C;  2EMH A;  2E72 A;  2YTG A;  2EM6 A;  1KJK A;  2EM4 A;  4F6M A;  2RPC A;  2EPP A;  2YTO A;  2DGC A;  2EOO A;  1YSA C;  2DRP A;  2NAB A;  2I13 A;  1BB8 A;  2EJ4 A;  2YTP A;  1ZAA C;  2EM0 A;  1UN6 B;  4R2E A;  2EN3 A;  2EOH A;  4X9J A;  1TN9 A;  2LT7 A;  2EM3 A;  2WBS A;  1YUI A;  2EL5 A;  2MDG A;  2EOE A;  4R2S A;  2YRM A;  1ZR9 A;  4IS1 C;  2JPA A;  2EQ3 A;  2EOI A;  2EOM A;  2EOY A;  2ENA A;  2EM2 A;  2CT1 A;  1G2F C;  1RMD A;  2EMI A;  2EPX A;  2CSH A;  2EMC A;  1LLM C;  1G2D C;  2EN7 A;  2EMF A;  2A25 A;  2YU5 A;  5KL2 A;  2EOZ A;  2EN8 A;  1MEY C;  2J7J A;  2EMY A;  2M9A A;  2LV2 A;  1X3C A;  2EPA A;  2WBU A;  2EM8 A;  1A1G A;  2EOQ A;  2EMB A;  2HGH A;  2EM9 A;  3EPJ A;  2EN2 A;  2D9H A;  1A1I A;  1JK1 A;  1ZU1 A;  4F6N A;  2EP3 A;  2EM5 A;  2EQ0 A;  2EMX A;  2YSO A;  4GZN C;  2ADR A;  4R2D A;  2YU8 A;  5KL6 A;  2DMI A;  1TF3 A;  2EE8 A;  2EOR A;  2R1F A;  2MKD A;  2EPR A;  2DLQ A;  2EMZ A;  3VHT B;  1A1K A;  1F2I G;  4M9V C;  2ENH A;  2YSP A;  2RSI A;  2JP9 A;  1WJP A; 
#chains in the Genus database with same CATH topology
 2R76 A;  4R2A A;  3K6Q A;  2YTJ A;  3JU0 A;  1T4O A;  2YTE A;  2DLK A;  4O5G A;  5A69 A;  2LE2 A;  2L2M A;  1J5E E;  3HPZ A;  2YTN A;  4WSG A;  1WHQ A;  5A6K A;  2KON A;  2MDR A;  2HHH E;  2VQF E;  1SR9 A;  1JK2 A;  3M99 B;  2EML A;  5KL4 A;  4HTG A;  4R2P A;  4AQY E;  2LVH A;  2GPI A;  5KL3 A;  3MHS C;  2RSM A;  1Z1B A;  1AAY A;  2LJH A;  3AUZ A;  2EL6 A;  4DR6 E;  2WCC 3;  5IV8 B;  2EOJ A;  1FKA E;  2YT4 A;  3TQM A;  3ADG A;  1UBD C;  1X6E A;  1EH6 A;  1RQ0 A;  2EMG A;  2N8X A;  2YTI A;  1BBO A;  2EQ1 A;  2H36 X;  2LBS B;  4FK5 C;  4F2J C;  1GTK A;  2I9I A;  1EKZ A;  2RPC A;  5LL6 R;  2YTO A;  2DGC A;  2DRP A;  1YSA C;  4YY3 E;  2EJ4 A;  1UN6 B;  4J8Z A;  2V87 A;  4KWY A;  2LT7 A;  1PJT A;  2EM3 A;  4BHC A;  1YUI A;  4DR3 E;  2EL5 A;  5T6J A;  3LML A;  2EOI A;  1N36 E;  2EOY A;  2M4I A;  4ZYD A;  2CT1 A;  5A2Q C;  4BMJ A;  3THO B;  1IMU A;  2DSY A;  4JI0 E;  2N3H A;  2JVA A;  1WRJ A;  2UXC E;  2EPK X;  2EOZ A;  2JYA A;  1MEY C;  5TSE A;  3J7A G;  2JXP A;  2M9A A;  3ADI A;  2EOQ A;  4NXN E;  2EN2 A;  3BF2 A;  5A6A A;  2K7I A;  1QU6 A;  2D9H A;  2VE7 C;  1A1I A;  2EM5 A;  3KWR A;  4O4K A;  4R2D A;  2DMI A;  2V83 A;  2WZO A;  2BBG A;  2EPN A;  2EMZ A;  1N33 E;  3EQ1 A;  4LFA E;  4JV5 E;  4TUG A;  1HR0 E;  2EL4 A;  4R2Q A;  2MC6 A;  4DV4 E;  3UK3 C;  2GLI A;  2M1S A;  1B69 A;  1A1L A;  2EPC A;  4X65 E;  3VYY A;  3QG5 C;  2V85 A;  1PDA A;  1A1F A;  4R03 A;  4I8O A;  1ZBQ A;  1N32 E;  1YPN A;  2HC5 A;  3BGH A;  4Q28 A;  3HPS A;  3P1X A;  5LMU E;  4M2Z A;  3IWC A;  3L00 A;  2EOS A;  2YRK A;  4WYQ B;  1IQS A;  1HNZ E;  1YYW A;  5KL7 A;  4R2R A;  2YTF A;  2YWQ A;  4M0V A;  4TUI A;  4DR7 E;  2EN4 A;  2DIX A;  2Q8U A;  4NHR A;  4IJD A;  2LCE A;  1YZ9 A;  2EPM X;  1EH8 A;  2UU9 E;  4N4R B;  2FTX B;  3EPH A;  4O43 A;  4LF4 E;  1KYQ A;  3OTO E;  2EMK A;  4BC7 A;  3KZZ A;  4DKK A;  1TF6 A;  2EMA A;  4ZYG A;  2YPN A;  5FLX C;  2EM6 A;  1KJK A;  2V89 A;  4B3S E;  4MLQ A;  2V88 A;  3F6H A;  2EM0 A;  3C4B A;  2ODR C;  3C6K A;  4X9J A;  2MDG A;  2V86 A;  2B7T A;  4IS1 C;  4JI4 E;  2JPA A;  1DI2 A;  2EOM A;  2MC5 A;  4X66 E;  3ADL A;  3BID A;  4DR1 E;  4BS9 A;  1G2F C;  4DV3 E;  1RMD A;  2EMI A;  2EPX A;  1QNT A;  1NEI A;  2EN7 A;  2EMF A;  1WXR A;  2A25 A;  1XNR E;  2LTR A;  4LF6 E;  4B3T E;  4BBY A;  1T4N A;  2EN8 A;  2EZ6 A;  1X3C A;  2UXD E;  4RHB B;  3JAM C;  4P78 A;  3EPJ A;  1FJG E;  4X8W A;  2K4V A;  1SFE A;  1JK1 A;  4F6N A;  3IWD A;  4MLV A;  2EQ0 A;  5IXM B;  4DV7 E;  2ADR A;  2L3C A;  3AV0 A;  1DQ3 A;  1PJQ A;  2JOX A;  4X62 E;  4OX9 E;  2M7Q A;  4DV6 E;  4JYA E;  2LTS A;  2EPR A;  1YYK A;  2DLQ A;  3VHT B;  1A1K A;  4LF9 E;  1I94 E;  2RSI A;  4WXC A;  3DF6 A;  2DB2 A;  1YFH A;  1A1J A;  2CPN A;  5AC5 A;  2L2K B;  3IWB A;  5A6J A;  1N34 E;  3ECR A;  4GEQ B;  3EPK A;  4M30 A;  2LO3 A;  2NUG A;  2HJJ A;  2EOF A;  2V8Q B;  2YTD A;  1X5W A;  1T4L B;  2YRH A;  1DGC A;  2JOB A;  2CTD A;  2VQE E;  1WHN A;  2ELZ A;  4DV0 E;  2EOX A;  2EM7 A;  2WBT A;  4JI8 E;  2VRD A;  2YTQ A;  2FV4 B;  4BC9 A;  1XNQ E;  1MGT A;  3J81 C;  3RMP A;  2ELY A;  3T1Y E;  5LLQ A;  2EN6 A;  1STU A;  4WX9 A;  1UIL A;  2EWL A;  1XMO E;  2EPU A;  1YUJ A;  3MSW A;  4DR2 E;  2EPZ A;  4F9B B;  4LU9 A;  2EMH A;  5A6B D;  3DJW A;  3JTZ A;  2UUB E;  4OOG C;  5CFF E;  4DUY E;  4F6M A;  2EPP A;  5BR8 E;  2NAB A;  4K0K E;  2IHR 1;  1T38 A;  1ZAA C;  1XMQ E;  4R2E A;  2E1M A;  4NXM E;  5LMN E;  1IBK E;  2LRS A;  2WBS A;  4DV1 E;  4L5N C;  2EOE A;  4R2S A;  1X47 A;  1X48 A;  3VYX A;  4LFC E;  2L92 A;  4LF7 E;  5ADZ A;  2UXB E;  4JI3 E;  2EM2 A;  3HXL A;  1ZBT A;  5IT9 C;  2E5L E;  1UHZ A;  2CSH A;  2EMC A;  1G2D C;  2YU5 A;  5KL2 A;  1BBG A;  1GQE A;  2J7J A;  2WBU A;  2LV2 A;  3J7Y p;  2LJU A;  3ADJ A;  5A6B A;  1IQO A;  3C6M A;  2EMB A;  3H09 A;  4LF8 E;  1X49 A;  4Q35 B;  3FIG A;  4WSP A;  1HNX E;  1ZU1 A;  4LFB E;  2B9D A;  4DR5 E;  2RS7 A;  2EMX A;  4F54 A;  4DV5 E;  2L33 A;  2YU8 A;  5KL6 A;  2EE8 A;  4B3M E;  2JR1 A;  2EPL X;  1O0W A;  2L3J A;  2LMZ A;  4X64 E;  2ENH A;  4LTY A;  5AE2 A;  2YSP A;  1X6H A;  1IBM E;  2NUF A;  2ENC A;  3LLH A;  2EN1 A;  3EPL A;  1P47 A;  3T1H E;  1NCS A;  4BHB A;  4LF5 E;  4B3R E;  5F3W A;  4BCA A;  2B7V A;  2GHF A;  3J80 C;  4ZYE A;  4GKK E;  2ZM6 E;  1X6F A;  2EMW A;  2MKN A;  2EPO A;  1T39 A;  3VK6 A;  4WPY A;  4KZS A;  2NUE A;  4YHH E;  3OML A;  3KZY A;  4DR4 E;  4DMI A;  2VF1 A;  3ZOQ B;  1AH5 A;  1HNW E;  1A1H A;  2PRT A;  1PKP A;  5KL5 A;  4ZYH A;  4R2C A;  2BB8 A;  4GKJ E;  3MHH C;  1PJS A;  5IWA E;  4JI5 E;  4JI7 E;  5AE3 A;  3HQ1 A;  5AE1 A;  3BBG A;  4JI2 E;  4F9A B;  3F6G A;  2E72 A;  2YTG A;  4L8N A;  2EM4 A;  2EOO A;  2I13 A;  1BB8 A;  2L6M A;  4WFT A;  4RH8 A;  2YTP A;  2L2N A;  2F8B A;  3THN A;  4DV2 E;  2EN3 A;  2EOH A;  2G7H A;  2ODR D;  2B3T B;  4R8O A;  1TN9 A;  2RTX A;  2KHX A;  4DUZ E;  4JI6 E;  3HTX A;  1RC7 A;  2YRM A;  1ZR9 A;  2UUA E;  4JI1 E;  2LUP B;  2LUQ A;  2NA2 A;  2EQ3 A;  5DNY A;  2ENA A;  1L4S A;  2F4V E;  2N3G A;  4NZV A;  4WXD A;  1LLM C;  2UUC E;  1J26 A;  1IBL E;  2RQL A;  1GZ6 A;  4O24 A;  2L8T A;  2EMY A;  2EPA A;  4KHP E;  2EM8 A;  1A1G A;  1YYO A;  2HGH A;  4F9C B;  2EM9 A;  4HEI A;  2YZT A;  1N3G A;  2FGG A;  2EP3 A;  3C4T A;  4P7D A;  2YSO A;  4GZN C;  2JWO A;  2DMY A;  5AAS A;  1EH7 A;  1TF3 A;  2EOR A;  2R1F A;  2RS6 A;  2MKD A;  2KOU A;  2JY9 A;  1F2I G;  4M9V C;  5AC4 A;  2JP9 A;  1WJP A; 
#chains in the Genus database with same CATH homology
 2ENC A;  2EL4 A;  4R2Q A;  4R2A A;  2EN1 A;  3EPL A;  1A1J A;  3UK3 C;  2GLI A;  2YTJ A;  1P47 A;  1B69 A;  1NCS A;  2YTE A;  2DLK A;  1A1L A;  2EPC A;  2GHF A;  2YTN A;  4WSG A;  3EPK A;  1A1F A;  1X6F A;  2LO3 A;  2EMW A;  2MKN A;  2EOF A;  2YTD A;  1X5W A;  2YRH A;  1DGC A;  1JK2 A;  3M99 B;  2EML A;  2CTD A;  2ELZ A;  2EOS A;  2EM7 A;  2EOX A;  2WBT A;  2YRK A;  5KL4 A;  4R2P A;  2VRD A;  1X6H A;  2YTQ A;  2LVH A;  5KL7 A;  4R2R A;  2YTF A;  5KL3 A;  2EN4 A;  2ELY A;  1A1H A;  3MHS C;  2PRT A;  1Z1B A;  4IJD A;  2LCE A;  1AAY A;  2EN6 A;  5KL5 A;  2EL6 A;  4R2C A;  2BB8 A;  2WCC 3;  3EPH A;  2EOJ A;  3MHH C;  2EPU A;  1YUJ A;  1UBD C;  1X6E A;  2EMK A;  2YTI A;  2EPZ A;  2EMG A;  1BBO A;  2EQ1 A;  1TF6 A;  2EMA A;  4FK5 C;  4F2J C;  2EMH A;  2E72 A;  2YTG A;  2EM6 A;  1KJK A;  2EM4 A;  4F6M A;  2RPC A;  2EPP A;  2YTO A;  2DGC A;  2EOO A;  1YSA C;  2DRP A;  2NAB A;  2I13 A;  1BB8 A;  2EJ4 A;  2YTP A;  1ZAA C;  2EM0 A;  1UN6 B;  4R2E A;  2EN3 A;  2EOH A;  4X9J A;  1TN9 A;  2LT7 A;  2EM3 A;  2WBS A;  1YUI A;  2EL5 A;  2MDG A;  2EOE A;  4R2S A;  2YRM A;  1ZR9 A;  4IS1 C;  2JPA A;  2EQ3 A;  2EOI A;  2EOM A;  2EOY A;  2ENA A;  2EM2 A;  2CT1 A;  1G2F C;  1RMD A;  2EMI A;  2EPX A;  2CSH A;  2EMC A;  1LLM C;  1G2D C;  2EN7 A;  2EMF A;  2A25 A;  2YU5 A;  5KL2 A;  2EOZ A;  2EN8 A;  1MEY C;  2J7J A;  2EMY A;  2M9A A;  2LV2 A;  1X3C A;  2EPA A;  2WBU A;  2EM8 A;  1A1G A;  2EOQ A;  2EMB A;  2HGH A;  2EM9 A;  3EPJ A;  2EN2 A;  2D9H A;  1A1I A;  1JK1 A;  1ZU1 A;  4F6N A;  2EP3 A;  2EM5 A;  2EQ0 A;  2EMX A;  2YSO A;  4GZN C;  2ADR A;  4R2D A;  2YU8 A;  5KL6 A;  2DMI A;  1TF3 A;  2EE8 A;  2EOR A;  2R1F A;  2MKD A;  2EPR A;  2DLQ A;  2EMZ A;  3VHT B;  1A1K A;  1F2I G;  4M9V C;  2ENH A;  2YSP A;  2RSI A;  2JP9 A;  1WJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...