3IWCA

T. maritima adometdc complex with s-adenosylmethionine methyl ester
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
58
Chain Sequence
b'HLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEIGIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-adenosylmethionine decarboxylase
publication title Complexes of Thermotoga maritimaS-adenosylmethionine decarboxylase provide insights into substrate specificity.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 8
structure length 58
sequence length 58
chains with identical sequence C
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.750 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3iwcA00
3IWCA 3IWBA 3IWDA
chains in the Genus database with same CATH superfamily
2VE7C 3IWBA 2MKNA 2KONA 1YUIA 1HNZE 4IJDA 1IMUA 1KJKA 2RTXA 3AUZA 2RS7A 1UN6B 2ENCA 2EPNA 3RMPA 1YUJA 4LU9A 4DV3E 2WZOA 3LMLA 1X6HA 4Q28A 1T39A 4GKKE 4DR6E 5LLQA 1RMDA 2EPKX 4M30A 1I94E 2LTRA 1AAYA 4HTGA 2EORA 4R2SA 2EPRA 4NHRA 4R2EA 4WX9A 4DV6E 1PKPA 2YTFA 4FK5C 4LTYA 2YTIA 1BB8A 2YTOA 4BS9A 5IXMB 2L2NA 2KHXA 1EH6A 3EPJA 4BCAA 2JXPA 3HQ1A 2I9IA 3QG5C 5LL6R 2PRTA 2M7QA 1X49A 2FGGA 2VF1A 2LBSB 4DR3E 3OMLA 2EM6A 5LMUE 1EH8A 3C6KA 4X66E 3VYYA 2UUAE 2EJ4A 1A1HA 1RQ0A 1WRJA 5AC4A 4M2ZA 3J7Yp 2B7VA 1SR9A 3KWRA 1MEYC 4X65E 3THNA 2EPPA 4KWYA 2HC5A 2N3HA 3DJWA 4M9VC 3L00A 5AE2A 2DB2A 2G7HA 3F6GA 2ELZA 3HPZA 4BBYA 1T4OA 2EOIA 2LJHA 1AH5A 4WYQB 2LJUA 1YYKA 1MGTA 3C6MA 3BIDA 2HHHE 2DLKA 2EN3A 2L33A 4NXME 2UXDE 1A1IA 2RSMA 3BF2A 2NABA 2YSOA 1DGCA 2EOMA 1LLMC 1YSAC 2LTSA 2DIXA 2EN4A 4OX9E 2LUQA 4WXCA 2EPMX 1A1JA 4JI7E 4BMJA 1EH7A 2B9DA 1X48A 4ZYEA 3EPLA 1UHZA 2EMWA 4JI5E 4R03A 3KZZA 2EL5A 2YTNA 3JAMC 3C4BA 3JTZA 1N34E 2V87A 1FJGE 1YYOA 4ZYDA 4JI2E 2NA2A 4DR1E 2M9AA 3MSWA 2EWLA 4WSGA 3ADIA 4P7DA 2WBUA 4B3TE 2H36X 1FKAE 4RH8A 4LF5E 3UK3C 2L92A 2EN6A 4O4KA 4DR7E 2M4IA 2GLIA 1N33E 2EM9A 1A1KA 2GPIA 3KZYA 1KYQA 2DLQA 4GEQB 1TF3A 4BHCA 5AE1A 5KL4A 4R2AA 4JI0E 1HNXE 3F6HA 2EPAA 1PJQA 3IWDA 3VHTB 4IS1C 2JOBA 2MDGA 4YY3E 2EMLA 2D9HA 2V8QB 2DMIA 4TUIA 2F8BA 2JPAA 1J26A 1TN9A 2UXCE 2EP3A 1IQOA 4JYAE 2L2KB 2EN1A 4ZYGA 1GZ6A 2YZTA 4DR2E 2B3TB 4X64E 5KL2A 3OTOE 4LF4E 5AASA 5IT9C 3MHHC 3FIGA 1TF6A 2VQFE 3HXLA 2FTXB 2FV4B 2V85A 2YTPA 2R1FA 2EMAA 2EM0A 4OOGC 2EL4A 4R2PA 2EPZA 2ZM6E 1ZAAC 1YZ9A 2MDRA 2NUFA 2LE2A 1L4SA 2EOQA 4WXDA 2EPXA 2NUGA 2RQLA 1F2IG 4LF8E 4O24A 2MC5A 2RS6A 4GKJE 1X47A 2L6MA 2RSIA 5KL5A 1YFHA 5A6AA 1IBLE 1N32E 2ELYA 2DGCA 4JI4E 1WHNA 3J81C 4DV2E 1YYWA 2EM7A 2EQ1A 4JI1E 1XNRE 1O0WA 4X9JA 4F6MA 2ADRA 3VK6A 2LMZA 2VRDA 2HJJA 2E72A 2N3GA 4DV7E 4KZSA 4BC9A 3TQMA 2EPUA 4X8WA 4BHBA 2EMHA 2BBGA 1RC7A 3P1XA 2EN7A 3BBGA 3IWCA 4DV5E 2M1SA 2JP9A 2LCEA 2YTJA 1GTKA 3ADGA 2YTGA 2EM5A 4B3RE 2EPLX 2ODRD 4WFTA 2EPOA 4JV5E 5KL7A 3ADJA 2NUEA 2JR1A 2EMYA 4B3SE 4X62E 2EMBA 4R2QA 4DR4E 2BB8A 2EN2A 2YWQA 1HR0E 2CTDA 5IV8B 4M0VA 1HNWE 5A2QC 4J8ZA 2UXBE 4F9BB 2L8TA 1T4NA 2EM4A 1WJPA 2DSYA 2YU8A 3LLHA 2F4VE 4I8OA 1N36E 4F9CB 1X3CA 3H09A 2EOZA 3BGHA 5IWAE 4WPYA 4YHHE 2A25A 1ZR9A 1ZBQA 1NCSA 1NEIA 1STUA 1T38A 1IQSA 3K6QA 3J7AG 2KOUA 4DUZE 2EMCA 3J80C 2YPNA 2YSPA 4NXNE 1B69A 2EOYA 1A1FA 2CPNA 5TSEA 3HTXA 1IBME 2EM3A 2UU9E 4ZYHA 2EOHA 4GZNC 4WSPA 2EQ3A 2JVAA 4LFBE 1GQEA 1ZU1A 2V88A 2IHR1 2EE8A 1ZBTA 1UILA 4JI8E 2L3CA 2JYAA 2CT1A 2EOFA 2LV2A 4LFAE 1X6EA 3ECRA 1Z1BA 5F3WA 3ZOQB 2YT4A 2I13A 2N8XA 2LVHA 2E1MA 5T6JA 1SFEA 1JK2A 2EN8A 3AV0A 3HPSA 3EPHA 4HEIA 2EMKA 1J5EE 3MHSC 2YTQA 1JK1A 2EM8A 1PJSA 3JU0A 4F9AB 1WHQA 2JY9A 4DUYE 2EQ0A 2WBTA 4B3ME 2ENAA 5LMNE 1DI2A 2K7IA 4Q35B 4F54A 2UUCE 1T4LB 5ADZA 5KL6A 1QU6A 3T1HE 4O43A 4L5NC 2CSHA 2WCC3 3ADLA 2YU5A 1PDAA 4NZVA 2ENHA 2YRKA 4DV1E 4LF9E 2EMIA 4JI3E 4RHBB 2MKDA 2YTEA 1UBDC 2DMYA 2LT7A 5A6JA 2L2MA 5FLXC 4R8OA 5DNYA 2MC6A 4F2JC 2RPCA 4AQYE 2EOXA 1N3GA 4KHPE 2R76A 4R2RA 2V89A 1XMQE 1EKZA 2EM2A 2V83A 3DF6A 2WBSA 2UUBE 3VYXA 1BBOA 4N4RB 4DV4E 2J7JA 4P78A 5BR8E 1A1LA 4DKKA 4MLVA 2YRMA 1QNTA 2EL6A 4LFCE 3C4TA 4JI6E 5A6BA 1XMOE 1BBGA 2EOJA 4LF6E 4TUGA 3T1YE 4R2CA 2DRPA 2YTDA 2LO3A 1X5WA 2EMZA 5KL3A 2EOOA 2EOEA 2HGHA 4F6NA 2EMGA 2B7TA 5A6KA 3M99B 1XNQE 4DMIA 2JWOA 1P47A 1A1GA 5CFFE 4L8NA 3EQ1A 4DR5E 2E5LE 1YPNA 4K0KE 4O5GA 2ODRC 2LUPB 2JOXA 2YRHA 2EOSA 2EMFA 2EZ6A 4BC7A 2EPCA 5AC5A 5A69A 4DV0E 4LF7E 2K4VA 4MLQA 2Q8UA 3EPKA 3THOB 1PJTA 1G2DC 5AE3A 1WXRA 2V86A 1G2FC 2EMXA 1IBKE 1X6FA 2VQEE 1DQ3A 2LRSA 2GHFA 5A6BD 4R2DA 2L3JA
chains in the Genus database with same CATH topology
2VE7C 3IWBA 2JY9A 2V87A 3JTZA 3P1XA 1N34E 2KONA 4DUYE 1FJGE 4B3ME 4M2ZA 1YYOA 1HNZE 4JI2E 5LMNE 2NA2A 2RTXA 3AUZA 3IWCA 4DV5E 2M1SA 4DR1E 1DI2A 2RS7A 3ADGA 3MSWA 2EWLA 4F54A 3RMPA 3ADIA 4LU9A 4B3RE 4DV3E 4P7DA 2ODRD 4WFTA 2UUCE 1T4LB 5ADZA 2WZOA 2H36X 1QU6A 3LMLA 3T1HE 1FKAE 4B3TE 4JV5E 4Q28A 4L5NC 3ADLA 4GKKE 4LF5E 4DR6E 3ADJA 2NUEA 2JR1A 4B3SE 2L92A 4X62E 1I94E 4M30A 4DV1E 2LTRA 4LF9E 4DR4E 1HR0E 4JI3E 4DR7E 2DMYA 4DV6E 4M0VA 2M4IA 1N33E 2L2MA 5FLXC 1PKPA 5A2QC 4R8OA 4J8ZA 5DNYA 1HNWE 2MC6A 4F9BB 2UXBE 2L8TA 1T4NA 2F4VE 2DSYA 3LLHA 4GEQB 4AQYE 5AE1A 4I8OA 4LTYA 4KHPE 1N36E 4F9CB 4JI0E 1HNXE 2V89A 3F6HA 3H09A 4BS9A 2L2NA 2KHXA 3IWDA 1XMQE 1EKZA 2JOBA 2V83A 4BCAA 3DF6A 4YY3E 2UUBE 3HQ1A 5IWAE 3VYXA 4WPYA 1RC7A 4YHHE 5LL6R 4DV4E 1ZBQA 2M7QA 1STUA 3K6QA 1X49A 2FGGA 2VF1A 2LBSB 3J7AG 4DR3E 4P78A 2V8QB 5BR8E 4TUIA 2F8BA 3OMLA 2KOUA 4DKKA 4DUZE 1J26A 5LMUE 4X66E 2UXCE 3VYYA 4LFCE 3J80C 2UUAE 4JYAE 3C4TA 1RQ0A 2L2KB 4JI6E 4NXNE 1GZ6A 2YZTA 3J7Yp 4DR2E 1XMOE 2B3TB 4X64E 3OTOE 4TUGA 4LF4E 3T1YE 2B7VA 4LF6E 1SR9A 5AASA 2CPNA 3FIGA 3KWRA 5IT9C 3HTXA 1IBME 2UU9E 4X65E 2VQFE 3HXLA 2FTXB 2FV4B 2V85A 4WSPA 4OOGC 2N3HA 2JVAA 4LFBE 3DJWA 2ZM6E 1GQEA 2V88A 2B7TA 2IHR1 1YZ9A 2MDRA 1ZBTA 5AE2A 2LE2A 2DB2A 2NUFA 2G7HA 3F6GA 2UXDE 1UILA 4JI8E 4DMIA 1XNQE 2L3CA 3HPZA 2NUGA 4BBYA 1T4OA 4LF8E 2LJHA 4WYQB 2JWOA 1YYKA 2MC5A 4LFAE 2RS6A 4GKJE 1X47A 2L6MA 2HHHE 5CFFE 5F3WA 4L8NA 2L33A 3ZOQB 4DR5E 1IBLE 2E5LE 4JI5E 4NXME 2YT4A 1N32E 4K0KE 2RSMA 2ODRC 2LUPB 2JOXA 4JI4E 1WHNA 2E1MA 5T6JA 4BC7A 3J81C 2EZ6A 2LTSA 4DV2E 4DV0E 1YYWA 2DIXA 2K4VA 3AV0A 3HPSA 4LF7E 4OX9E 4JI1E 2LUQA 5AE3A 1XNRE 1WXRA 1J5EE 1O0WA 2V86A 4JI7E 4BMJA 2B9DA 3VK6A 1X48A 2LMZA 3JU0A 4F9AB 1IBKE 1UHZA 2VQEE 1DQ3A 1WHQA 2LRSA 2N3GA 4KZSA 4R03A 4BC9A 3JAMC 4X8WA 4DV7E 3C4BA 2L3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWC A;  3IWB A;  3IWD A; 
#chains in the Genus database with same CATH topology
 2VE7 C;  3IWB A;  2MKN A;  2KON A;  1YUI A;  1HNZ E;  4IJD A;  1IMU A;  1KJK A;  2RTX A;  3AUZ A;  2RS7 A;  1UN6 B;  2ENC A;  2EPN A;  3RMP A;  1YUJ A;  4LU9 A;  4DV3 E;  2WZO A;  3LML A;  1X6H A;  4Q28 A;  1T39 A;  4GKK E;  4DR6 E;  5LLQ A;  1RMD A;  2EPK X;  4M30 A;  1I94 E;  2LTR A;  1AAY A;  4HTG A;  2EOR A;  4R2S A;  2EPR A;  4NHR A;  4R2E A;  4WX9 A;  4DV6 E;  1PKP A;  2YTF A;  4FK5 C;  4LTY A;  2YTI A;  1BB8 A;  2YTO A;  4BS9 A;  5IXM B;  2L2N A;  2KHX A;  1EH6 A;  3EPJ A;  4BCA A;  2JXP A;  3HQ1 A;  2I9I A;  3QG5 C;  5LL6 R;  2PRT A;  2M7Q A;  1X49 A;  2FGG A;  2VF1 A;  2LBS B;  4DR3 E;  3OML A;  2EM6 A;  5LMU E;  1EH8 A;  3C6K A;  4X66 E;  3VYY A;  2UUA E;  2EJ4 A;  1A1H A;  1RQ0 A;  1WRJ A;  5AC4 A;  4M2Z A;  3J7Y p;  2B7V A;  1SR9 A;  3KWR A;  1MEY C;  4X65 E;  3THN A;  2EPP A;  4KWY A;  2HC5 A;  2N3H A;  3DJW A;  4M9V C;  3L00 A;  5AE2 A;  2DB2 A;  2G7H A;  3F6G A;  2ELZ A;  3HPZ A;  4BBY A;  1T4O A;  2EOI A;  2LJH A;  1AH5 A;  4WYQ B;  2LJU A;  1YYK A;  1MGT A;  3C6M A;  3BID A;  2HHH E;  2DLK A;  2EN3 A;  2L33 A;  4NXM E;  2UXD E;  1A1I A;  2RSM A;  3BF2 A;  2NAB A;  2YSO A;  1DGC A;  2EOM A;  1LLM C;  1YSA C;  2LTS A;  2DIX A;  2EN4 A;  4OX9 E;  2LUQ A;  4WXC A;  2EPM X;  1A1J A;  4JI7 E;  4BMJ A;  1EH7 A;  2B9D A;  1X48 A;  4ZYE A;  3EPL A;  1UHZ A;  2EMW A;  4JI5 E;  4R03 A;  3KZZ A;  2EL5 A;  2YTN A;  3JAM C;  3C4B A;  3JTZ A;  1N34 E;  2V87 A;  1FJG E;  1YYO A;  4ZYD A;  4JI2 E;  2NA2 A;  4DR1 E;  2M9A A;  3MSW A;  2EWL A;  4WSG A;  3ADI A;  4P7D A;  2WBU A;  4B3T E;  2H36 X;  1FKA E;  4RH8 A;  4LF5 E;  3UK3 C;  2L92 A;  2EN6 A;  4O4K A;  4DR7 E;  2M4I A;  2GLI A;  1N33 E;  2EM9 A;  1A1K A;  2GPI A;  3KZY A;  1KYQ A;  2DLQ A;  4GEQ B;  1TF3 A;  4BHC A;  5AE1 A;  5KL4 A;  4R2A A;  4JI0 E;  1HNX E;  3F6H A;  2EPA A;  1PJQ A;  3IWD A;  3VHT B;  4IS1 C;  2JOB A;  2MDG A;  4YY3 E;  2EML A;  2D9H A;  2V8Q B;  2DMI A;  4TUI A;  2F8B A;  2JPA A;  1J26 A;  1TN9 A;  2UXC E;  2EP3 A;  1IQO A;  4JYA E;  2L2K B;  2EN1 A;  4ZYG A;  1GZ6 A;  2YZT A;  4DR2 E;  2B3T B;  4X64 E;  5KL2 A;  3OTO E;  4LF4 E;  5AAS A;  5IT9 C;  3MHH C;  3FIG A;  1TF6 A;  2VQF E;  3HXL A;  2FTX B;  2FV4 B;  2V85 A;  2YTP A;  2R1F A;  2EMA A;  2EM0 A;  4OOG C;  2EL4 A;  4R2P A;  2EPZ A;  2ZM6 E;  1ZAA C;  1YZ9 A;  2MDR A;  2NUF A;  2LE2 A;  1L4S A;  2EOQ A;  4WXD A;  2EPX A;  2NUG A;  2RQL A;  1F2I G;  4LF8 E;  4O24 A;  2MC5 A;  2RS6 A;  4GKJ E;  1X47 A;  2L6M A;  2RSI A;  5KL5 A;  1YFH A;  5A6A A;  1IBL E;  1N32 E;  2ELY A;  2DGC A;  4JI4 E;  1WHN A;  3J81 C;  4DV2 E;  1YYW A;  2EM7 A;  2EQ1 A;  4JI1 E;  1XNR E;  1O0W A;  4X9J A;  4F6M A;  2ADR A;  3VK6 A;  2LMZ A;  2VRD A;  2HJJ A;  2E72 A;  2N3G A;  4DV7 E;  4KZS A;  4BC9 A;  3TQM A;  2EPU A;  4X8W A;  4BHB A;  2EMH A;  2BBG A;  1RC7 A;  3P1X A;  2EN7 A;  3BBG A;  3IWC A;  4DV5 E;  2M1S A;  2JP9 A;  2LCE A;  2YTJ A;  1GTK A;  3ADG A;  2YTG A;  2EM5 A;  4B3R E;  2EPL X;  2ODR D;  4WFT A;  2EPO A;  4JV5 E;  5KL7 A;  3ADJ A;  2NUE A;  2JR1 A;  2EMY A;  4B3S E;  4X62 E;  2EMB A;  4R2Q A;  4DR4 E;  2BB8 A;  2EN2 A;  2YWQ A;  1HR0 E;  2CTD A;  5IV8 B;  4M0V A;  1HNW E;  5A2Q C;  4J8Z A;  2UXB E;  4F9B B;  2L8T A;  1T4N A;  2EM4 A;  1WJP A;  2DSY A;  2YU8 A;  3LLH A;  2F4V E;  4I8O A;  1N36 E;  4F9C B;  1X3C A;  3H09 A;  2EOZ A;  3BGH A;  5IWA E;  4WPY A;  4YHH E;  2A25 A;  1ZR9 A;  1ZBQ A;  1NCS A;  1NEI A;  1STU A;  1T38 A;  1IQS A;  3K6Q A;  3J7A G;  2KOU A;  4DUZ E;  2EMC A;  3J80 C;  2YPN A;  2YSP A;  4NXN E;  1B69 A;  2EOY A;  1A1F A;  2CPN A;  5TSE A;  3HTX A;  1IBM E;  2EM3 A;  2UU9 E;  4ZYH A;  2EOH A;  4GZN C;  4WSP A;  2EQ3 A;  2JVA A;  4LFB E;  1GQE A;  1ZU1 A;  2V88 A;  2IHR 1;  2EE8 A;  1ZBT A;  1UIL A;  4JI8 E;  2L3C A;  2JYA A;  2CT1 A;  2EOF A;  2LV2 A;  4LFA E;  1X6E A;  3ECR A;  1Z1B A;  5F3W A;  3ZOQ B;  2YT4 A;  2I13 A;  2N8X A;  2LVH A;  2E1M A;  5T6J A;  1SFE A;  1JK2 A;  2EN8 A;  3AV0 A;  3HPS A;  3EPH A;  4HEI A;  2EMK A;  1J5E E;  3MHS C;  2YTQ A;  1JK1 A;  2EM8 A;  1PJS A;  3JU0 A;  4F9A B;  1WHQ A;  2JY9 A;  4DUY E;  2EQ0 A;  2WBT A;  4B3M E;  2ENA A;  5LMN E;  1DI2 A;  2K7I A;  4Q35 B;  4F54 A;  2UUC E;  1T4L B;  5ADZ A;  5KL6 A;  1QU6 A;  3T1H E;  4O43 A;  4L5N C;  2CSH A;  2WCC 3;  3ADL A;  2YU5 A;  1PDA A;  4NZV A;  2ENH A;  2YRK A;  4DV1 E;  4LF9 E;  2EMI A;  4JI3 E;  4RHB B;  2MKD A;  2YTE A;  1UBD C;  2DMY A;  2LT7 A;  5A6J A;  2L2M A;  5FLX C;  4R8O A;  5DNY A;  2MC6 A;  4F2J C;  2RPC A;  4AQY E;  2EOX A;  1N3G A;  4KHP E;  2R76 A;  4R2R A;  2V89 A;  1XMQ E;  1EKZ A;  2EM2 A;  2V83 A;  3DF6 A;  2WBS A;  2UUB E;  3VYX A;  1BBO A;  4N4R B;  4DV4 E;  2J7J A;  4P78 A;  5BR8 E;  1A1L A;  4DKK A;  4MLV A;  2YRM A;  1QNT A;  2EL6 A;  4LFC E;  3C4T A;  4JI6 E;  5A6B A;  1XMO E;  1BBG A;  2EOJ A;  4LF6 E;  4TUG A;  3T1Y E;  4R2C A;  2DRP A;  2YTD A;  2LO3 A;  1X5W A;  2EMZ A;  5KL3 A;  2EOO A;  2EOE A;  2HGH A;  4F6N A;  2EMG A;  2B7T A;  5A6K A;  3M99 B;  1XNQ E;  4DMI A;  2JWO A;  1P47 A;  1A1G A;  5CFF E;  4L8N A;  3EQ1 A;  4DR5 E;  2E5L E;  1YPN A;  4K0K E;  4O5G A;  2ODR C;  2LUP B;  2JOX A;  2YRH A;  2EOS A;  2EMF A;  2EZ6 A;  4BC7 A;  2EPC A;  5AC5 A;  5A69 A;  4DV0 E;  4LF7 E;  2K4V A;  4MLQ A;  2Q8U A;  3EPK A;  3THO B;  1PJT A;  1G2D C;  5AE3 A;  1WXR A;  2V86 A;  1G2F C;  2EMX A;  1IBK E;  1X6F A;  2VQE E;  1DQ3 A;  2LRS A;  2GHF A;  5A6B D;  4R2D A;  2L3J A; 
#chains in the Genus database with same CATH homology
 2VE7 C;  3IWB A;  2JY9 A;  2V87 A;  3JTZ A;  3P1X A;  1N34 E;  2KON A;  4DUY E;  1FJG E;  4B3M E;  4M2Z A;  1YYO A;  1HNZ E;  4JI2 E;  5LMN E;  2NA2 A;  2RTX A;  3AUZ A;  3IWC A;  4DV5 E;  2M1S A;  4DR1 E;  1DI2 A;  2RS7 A;  3ADG A;  3MSW A;  2EWL A;  4F54 A;  3RMP A;  3ADI A;  4LU9 A;  4B3R E;  4DV3 E;  4P7D A;  2ODR D;  4WFT A;  2UUC E;  1T4L B;  5ADZ A;  2WZO A;  2H36 X;  1QU6 A;  3LML A;  3T1H E;  1FKA E;  4B3T E;  4JV5 E;  4Q28 A;  4L5N C;  3ADL A;  4GKK E;  4LF5 E;  4DR6 E;  3ADJ A;  2NUE A;  2JR1 A;  4B3S E;  2L92 A;  4X62 E;  1I94 E;  4M30 A;  4DV1 E;  2LTR A;  4LF9 E;  4DR4 E;  1HR0 E;  4JI3 E;  4DR7 E;  2DMY A;  4DV6 E;  4M0V A;  2M4I A;  1N33 E;  2L2M A;  5FLX C;  1PKP A;  5A2Q C;  4R8O A;  4J8Z A;  5DNY A;  1HNW E;  2MC6 A;  4F9B B;  2UXB E;  2L8T A;  1T4N A;  2F4V E;  2DSY A;  3LLH A;  4GEQ B;  4AQY E;  5AE1 A;  4I8O A;  4LTY A;  4KHP E;  1N36 E;  4F9C B;  4JI0 E;  1HNX E;  2V89 A;  3F6H A;  3H09 A;  4BS9 A;  2L2N A;  2KHX A;  3IWD A;  1XMQ E;  1EKZ A;  2JOB A;  2V83 A;  4BCA A;  3DF6 A;  4YY3 E;  2UUB E;  3HQ1 A;  5IWA E;  3VYX A;  4WPY A;  1RC7 A;  4YHH E;  5LL6 R;  4DV4 E;  1ZBQ A;  2M7Q A;  1STU A;  3K6Q A;  1X49 A;  2FGG A;  2VF1 A;  2LBS B;  3J7A G;  4DR3 E;  4P78 A;  2V8Q B;  5BR8 E;  4TUI A;  2F8B A;  3OML A;  2KOU A;  4DKK A;  4DUZ E;  1J26 A;  5LMU E;  4X66 E;  2UXC E;  3VYY A;  4LFC E;  3J80 C;  2UUA E;  4JYA E;  3C4T A;  1RQ0 A;  2L2K B;  4JI6 E;  4NXN E;  1GZ6 A;  2YZT A;  3J7Y p;  4DR2 E;  1XMO E;  2B3T B;  4X64 E;  3OTO E;  4TUG A;  4LF4 E;  3T1Y E;  2B7V A;  4LF6 E;  1SR9 A;  5AAS A;  2CPN A;  3FIG A;  3KWR A;  5IT9 C;  3HTX A;  1IBM E;  2UU9 E;  4X65 E;  2VQF E;  3HXL A;  2FTX B;  2FV4 B;  2V85 A;  4WSP A;  4OOG C;  2N3H A;  2JVA A;  4LFB E;  3DJW A;  2ZM6 E;  1GQE A;  2V88 A;  2B7T A;  2IHR 1;  1YZ9 A;  2MDR A;  1ZBT A;  5AE2 A;  2LE2 A;  2DB2 A;  2NUF A;  2G7H A;  3F6G A;  2UXD E;  1UIL A;  4JI8 E;  4DMI A;  1XNQ E;  2L3C A;  3HPZ A;  2NUG A;  4BBY A;  1T4O A;  4LF8 E;  2LJH A;  4WYQ B;  2JWO A;  1YYK A;  2MC5 A;  4LFA E;  2RS6 A;  4GKJ E;  1X47 A;  2L6M A;  2HHH E;  5CFF E;  5F3W A;  4L8N A;  2L33 A;  3ZOQ B;  4DR5 E;  1IBL E;  2E5L E;  4JI5 E;  4NXM E;  2YT4 A;  1N32 E;  4K0K E;  2RSM A;  2ODR C;  2LUP B;  2JOX A;  4JI4 E;  1WHN A;  2E1M A;  5T6J A;  4BC7 A;  3J81 C;  2EZ6 A;  2LTS A;  4DV2 E;  4DV0 E;  1YYW A;  2DIX A;  2K4V A;  3AV0 A;  3HPS A;  4LF7 E;  4OX9 E;  4JI1 E;  2LUQ A;  5AE3 A;  1XNR E;  1WXR A;  1J5E E;  1O0W A;  2V86 A;  4JI7 E;  4BMJ A;  2B9D A;  3VK6 A;  1X48 A;  2LMZ A;  3JU0 A;  4F9A B;  1IBK E;  1UHZ A;  2VQE E;  1DQ3 A;  1WHQ A;  2LRS A;  2N3G A;  4KZS A;  4R03 A;  4BC9 A;  3JAM C;  4X8W A;  4DV7 E;  3C4B A;  2L3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...