3IWCA

T. maritima adometdc complex with s-adenosylmethionine methyl ester
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
58
Chain Sequence
HLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEIGIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-adenosylmethionine decarboxylase
publication title Complexes of Thermotoga maritimaS-adenosylmethionine decarboxylase provide insights into substrate specificity.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 8
structure length 58
sequence length 58
chains with identical sequence C
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.750 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3iwcA00
3IWBA 3IWCA 3IWDA
chains in the Genus database with same CATH superfamily
2N3GA 1X5WA 5BR8E 2EPPA 1HNWE 1SFEA 1A1HA 2B3TB 1PJTA 4ZYGA 2L2NA 2KHXA 4L8NA 3VK6A 4P7DA 5KL5A 2EMXA 2YSPA 1YZ9A 5AE2A 1GTKA 1PDAA 2EMIA 4X8WA 2MKNA 2JXPA 5ADZA 5IT9C 2WCC3 2GHFA 4DV1E 2ODRD 3J7Yp 4RHBB 2EPOA 1P47A 2ELYA 4JYAE 2I13A 2LJHA 1N33E 4I8OA 4TUIA 4Q28A 2L2MA 2UXCE 2YRKA 5A6KA 2LVHA 2EOSA 2JWOA 4HTGA 4JI7E 5F3WA 1T4OA 1A1KA 2F4VE 4FK5C 4JI4E 2EM4A 4NHRA 4JI6E 2M4IA 3C4TA 5T6JA 1GZ6A 2LUQA 1BB8A 1QNTA 2M7QA 3IWBA 1NCSA 2ENAA 2NABA 1I94E 1HNZE 4DV4E 3P1XA 2DGCA 2FTXB 2M1SA 5AC5A 2EPZA 1B69A 2JR1A 2N8XA 4IJDA 5CFFE 4YY3E 2E5LE 2NA2A 4WFTA 2L8TA 4BC9A 3H09A 4BBYA 2RS7A 4R2RA 2JYAA 2EM5A 1XMOE 4LF6E 5AE1A 3T1YE 1X6EA 1ZR9A 2RQLA 1X48A 2JOXA 2J7JA 1Z1BA 1UBDC 1YUIA 3K6QA 2ELZA 3LMLA 2PRTA 4IS1C 1KJKA 3MHHC 3FIGA 1XMQE 1FKAE 3EPKA 1PKPA 4LTYA 1HR0E 2RSIA 2KOUA 2EOJA 5IV8B 2EOFA 4N4RB 2VE7C 2DB2A 3C4BA 2EN6A 2LV2A 2EPLX 1QU6A 3EPLA 2EP3A 2BB8A 2B7TA 2B7VA 2EPNA 2V88A 4KWYA 3OMLA 1MGTA 4P78A 1YFHA 3DJWA 2UXBE 2EOXA 4WXCA 2YU5A 2EPXA 2EN8A 4JI1E 3MSWA 3L00A 1N34E 2FV4B 5LMUE 4ZYEA 2WZOA 5TSEA 2YU8A 4GKKE 4Q35B 2DLKA 2FGGA 1ZAAC 3KZZA 2EMAA 2V86A 3THNA 5DNYA 4DR5E 4DV3E 1O0WA 1YUJA 4F54A 3IWCA 1DGCA 3VYXA 3JU0A 2EPAA 2EE8A 2RSMA 2V8QB 2NUFA 4WSPA 4X62E 2DSYA 2A25A 1IMUA 3AV0A 2EMGA 2E1MA 4LU9A 3M99B 2K4VA 3TQMA 1LLMC 1YSAC 4NZVA 2L3JA 4WSGA 2YTFA 3EPJA 4J8ZA 2EN1A 2DIXA 4WYQB 2M9AA 4LFBE 1AAYA 2V83A 1F2IG 3HXLA 2YT4A 5KL3A 2D9HA 2GPIA 4R2DA 4LFAE 4YHHE 2EM6A 5IWAE 2DMYA 1WJPA 1MEYC 5LLQA 4GEQB 4JI0E 4LFCE 4F9AB 2EL5A 2WBTA 2EOOA 4MLVA 1EH8A 4KZSA 2EZ6A 2YTIA 2EQ1A 4BMJA 4O24A 1IBKE 2EMYA 5LL6R 3C6MA 3QG5C 3BIDA 3EPHA 2EOZA 5LMNE 2LMZA 2I9IA 4M0VA 1AH5A 4BHBA 4DR3E 3RMPA 4F9CB 2VQFE 1WHQA 1IBME 2YWQA 2EM7A 1J26A 3LLHA 2R76A 2G7HA 1N3GA 2EN2A 2LUPB 1L4SA 2EMFA 2UU9E 4DKKA 1BBOA 1RC7A 4JV5E 4K0KE 2JPAA 2CTDA 3ADIA 2VQEE 1PJSA 5KL7A 2JVAA 4O5GA 4DMIA 2DMIA 4R2PA 2YRHA 3THOB 3BBGA 2N3HA 2L92A 2MDGA 4F6MA 2NUGA 4DV0E 4LF5E 2ENCA 2EJ4A 1JK2A 3MHSC 4O43A 1N32E 2RS6A 5AC4A 1JK1A 4X66E 4B3RE 2YSOA 1T4NA 1X6FA 2KONA 4R2CA 2MDRA 3HPZA 2MC5A 1EH7A 3KWRA 2DRPA 2BBGA 2EMHA 2EOYA 4M9VC 2CSHA 1IQSA 1FJGE 2YTJA 1WXRA 2EPRA 4F6NA 4JI5E 1XNQE 1RQ0A 4AQYE 2EQ3A 1UHZA 1N36E 2DLQA 1RMDA 2EOQA 2JP9A 4R2EA 4X65E 2EOHA 2EM2A 1NEIA 1BBGA 2VF1A 2UUBE 2HGHA 2CT1A 1WRJA 3ADJA 3JAMC 2EN4A 3ADGA 5AE3A 2LTRA 5AASA 1YPNA 4R2AA 2EQ0A 3ECRA 1YYKA 3KZYA 1X49A 4BC7A 2UXDE 3ADLA 4R03A 4BCAA 2EN3A 3VYYA 4R2SA 2ZM6E 1UILA 2YTNA 3HQ1A 4DR4E 5FLXC 2EMKA 2B9DA 4B3TE 1TF3A 4WX9A 2WBUA 5A2QC 2HJJA 2EL6A 2YTPA 2HHHE 4BS9A 4DR7E 3IWDA 1YYOA 4DR1E 1T4LB 4LF9E 4DUZE 2JOBA 2YTGA 1HNXE 2EM3A 2EWLA 1A1JA 2LBSB 2EPKX 4OOGC 1A1FA 1X6HA 2LTSA 2L6MA 2LCEA 2EN7A 5A69A 3UK3C 5KL2A 5A6BA 2F8BA 1G2DC 4M2ZA 1GQEA 3VHTB 1SR9A 3OTOE 5KL4A 4DR6E 4MLQA 4DR2E 1ZBQA 2NUEA 2EM8A 4ZYDA 2EPCA 2VRDA 2WBSA 3BF2A 1DQ3A 1PJQA 4F9BB 4JI3E 4NXNE 1KYQA 4DV6E 2ODRC 2CPNA 2V85A 4DV5E 4X9JA 1TF6A 1A1LA 2LRSA 3F6HA 4R8OA 2MC6A 4HEIA 4X64E 1EKZA 4NXME 2V89A 2EMBA 3J7AG 4LF8E 2YZTA 2V87A 3F6GA 2LT7A 5A6JA 3AUZA 1X47A 1ZBTA 2LE2A 3J81C 4LF7E 2EORA 4ZYHA 3EQ1A 1ZU1A 1T38A 1A1IA 4KHPE 4B3SE 2K7IA 2EOEA 2HC5A 3DF6A 3J80C 4F2JC 3HTXA 2EPUA 2LO3A 5IXMB 2L2KB 2EOIA 1IBLE 1YYWA 2YTQA 2EMWA 4DUYE 4L5NC 2L33A 2EMLA 3C6KA 2YRMA 2YTOA 4M30A 4WPYA 1STUA 4GZNC 2YTEA 2ENHA 1X3CA 5A6AA 1DI2A 4TUGA 2EOMA 4GKJE 2UUCE 4JI2E 4R2QA 4WXDA 1G2FC 2EPMX 2YTDA 3ZOQB 5KL6A 2EMCA 1T39A 2EM0A 3BGHA 2RPCA 4DV2E 2Q8UA 3JTZA 2H36X 2YPNA 1J5EE 2LJUA 2MKDA 4O4KA 2L3CA 1XNRE 2R1FA 1UN6B 4BHCA 1IQOA 4LF4E 2EM9A 4RH8A 1EH6A 2E72A 1WHNA 4DV7E 5A6BD 2ADRA 3T1HE 2EMZA 4B3ME 2JY9A 2RTXA 3HPSA 4JI8E 1TN9A 2IHR1 2GLIA 2UUAE 4OX9E 1A1GA 2EL4A
chains in the Genus database with same CATH topology
2N3GA 2LUPB 1QU6A 5BR8E 2UU9E 4DKKA 1HNWE 2F8BA 4M2ZA 1GQEA 1SR9A 2B7TA 2B7VA 3OTOE 2B3TB 1RC7A 2V88A 4K0KE 4JV5E 3ADIA 2VQEE 3OMLA 4P78A 2L2NA 4DR6E 3DJWA 2KHXA 4DR2E 1ZBQA 2JVAA 2NUEA 2UXBE 4DMIA 4L8NA 1DQ3A 2N3HA 2L92A 3VK6A 4JI1E 4F9BB 4JI3E 4P7DA 4NXNE 3MSWA 1YZ9A 2NUGA 4DV0E 1N34E 5AE2A 4LF5E 4DV6E 2ODRC 2CPNA 2V85A 4X8WA 4DV5E 2FV4B 5LMUE 2WZOA 5ADZA 5IT9C 2LRSA 1N32E 2RS6A 4GKKE 3F6HA 4X66E 4B3RE 4R8OA 2MC6A 2ODRD 4DV1E 4X64E 3J7Yp 1EKZA 1T4NA 2FGGA 2V89A 4NXME 3J7AG 4LF8E 2KONA 2YZTA 2V87A 3F6GA 4JYAE 2MDRA 3HPZA 2MC5A 3AUZA 2LJHA 2V86A 1X47A 1ZBTA 2LE2A 3J81C 4LF7E 1N33E 3KWRA 4I8OA 5DNYA 4TUIA 4DR5E 4Q28A 4DV3E 1O0WA 4KHPE 4B3SE 1FJGE 3HTXA 3DF6A 4F54A 2L2MA 3IWCA 3J80C 2UXCE 1WXRA 2L2KB 3VYXA 2JWOA 3JU0A 1IBLE 4JI5E 4JI7E 1XNQE 1RQ0A 1YYWA 5F3WA 2RSMA 1T4OA 2V8QB 4AQYE 4WSPA 2NUFA 4DUYE 2F4VE 4L5NC 4X62E 2DSYA 2L33A 4JI4E 1UHZA 3AV0A 1N36E 4JI6E 2M4IA 4M30A 2E1MA 4LU9A 3C4TA 4WPYA 1STUA 4X65E 2K4VA 5T6JA 2L3JA 1GZ6A 1DI2A 2LUQA 4J8ZA 4TUGA 2DIXA 4GKJE 4WYQB 2UUCE 4JI2E 2VF1A 2UUBE 2M7QA 4LFBE 3IWBA 3ADJA 1I94E 3JAMC 5AE3A 3ADGA 4DV4E 3P1XA 2LTRA 2FTXB 2V83A 3HXLA 1HNZE 2M1SA 5AASA 2YT4A 1YYKA 3ZOQB 2JR1A 4LFAE 2E5LE 1X49A 5CFFE 4YY3E 4BC7A 2NA2A 4YHHE 3ADLA 4WFTA 2L8TA 2UXDE 5IWAE 4R03A 2DMYA 4BC9A 4BCAA 3H09A 4GEQB 4BBYA 3VYYA 2RS7A 4JI0E 2ZM6E 4LFCE 1UILA 1XMOE 4F9AB 4DV2E 3HQ1A 3JTZA 2H36X 5FLXC 1J5EE 2B9DA 5AE1A 3T1YE 4LF6E 4DR4E 2L3CA 4B3TE 1X48A 2JOXA 1XNRE 4KZSA 2EZ6A 5A2QC 4LF4E 4BMJA 3K6QA 2VE7C 3LMLA 2HHHE 4BS9A 1IBKE 5LL6R 3FIGA 4DR7E 1WHNA 3IWDA 4DV7E 3T1HE 1YYOA 4DR1E 1XMQE 1T4LB 4B3ME 2JY9A 5LMNE 4LF9E 2LMZA 2JOBA 4DUZE 2RTXA 1HNXE 3HPSA 4M0VA 4JI8E 1FKAE 1PKPA 2EWLA 4LTYA 4DR3E 3RMPA 1HR0E 2LBSB 2IHR1 2KOUA 1WHQA 4F9CB 4OOGC 2VQFE 1IBME 3LLHA 1J26A 2UUAE 4OX9E 2G7HA 2L6MA 2LTSA 2DB2A 3C4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWB A;  3IWC A;  3IWD A; 
#chains in the Genus database with same CATH topology
 2N3G A;  1X5W A;  5BR8 E;  2EPP A;  1HNW E;  1SFE A;  1A1H A;  2B3T B;  1PJT A;  4ZYG A;  2L2N A;  2KHX A;  4L8N A;  3VK6 A;  4P7D A;  5KL5 A;  2EMX A;  2YSP A;  1YZ9 A;  5AE2 A;  1GTK A;  1PDA A;  2EMI A;  4X8W A;  2MKN A;  2JXP A;  5ADZ A;  5IT9 C;  2WCC 3;  2GHF A;  4DV1 E;  2ODR D;  3J7Y p;  4RHB B;  2EPO A;  1P47 A;  2ELY A;  4JYA E;  2I13 A;  2LJH A;  1N33 E;  4I8O A;  4TUI A;  4Q28 A;  2L2M A;  2UXC E;  2YRK A;  5A6K A;  2LVH A;  2EOS A;  2JWO A;  4HTG A;  4JI7 E;  5F3W A;  1T4O A;  1A1K A;  2F4V E;  4FK5 C;  4JI4 E;  2EM4 A;  4NHR A;  4JI6 E;  2M4I A;  3C4T A;  5T6J A;  1GZ6 A;  2LUQ A;  1BB8 A;  1QNT A;  2M7Q A;  3IWB A;  1NCS A;  2ENA A;  2NAB A;  1I94 E;  1HNZ E;  4DV4 E;  3P1X A;  2DGC A;  2FTX B;  2M1S A;  5AC5 A;  2EPZ A;  1B69 A;  2JR1 A;  2N8X A;  4IJD A;  5CFF E;  4YY3 E;  2E5L E;  2NA2 A;  4WFT A;  2L8T A;  4BC9 A;  3H09 A;  4BBY A;  2RS7 A;  4R2R A;  2JYA A;  2EM5 A;  1XMO E;  4LF6 E;  5AE1 A;  3T1Y E;  1X6E A;  1ZR9 A;  2RQL A;  1X48 A;  2JOX A;  2J7J A;  1Z1B A;  1UBD C;  1YUI A;  3K6Q A;  2ELZ A;  3LML A;  2PRT A;  4IS1 C;  1KJK A;  3MHH C;  3FIG A;  1XMQ E;  1FKA E;  3EPK A;  1PKP A;  4LTY A;  1HR0 E;  2RSI A;  2KOU A;  2EOJ A;  5IV8 B;  2EOF A;  4N4R B;  2VE7 C;  2DB2 A;  3C4B A;  2EN6 A;  2LV2 A;  2EPL X;  1QU6 A;  3EPL A;  2EP3 A;  2BB8 A;  2B7T A;  2B7V A;  2EPN A;  2V88 A;  4KWY A;  3OML A;  1MGT A;  4P78 A;  1YFH A;  3DJW A;  2UXB E;  2EOX A;  4WXC A;  2YU5 A;  2EPX A;  2EN8 A;  4JI1 E;  3MSW A;  3L00 A;  1N34 E;  2FV4 B;  5LMU E;  4ZYE A;  2WZO A;  5TSE A;  2YU8 A;  4GKK E;  4Q35 B;  2DLK A;  2FGG A;  1ZAA C;  3KZZ A;  2EMA A;  2V86 A;  3THN A;  5DNY A;  4DR5 E;  4DV3 E;  1O0W A;  1YUJ A;  4F54 A;  3IWC A;  1DGC A;  3VYX A;  3JU0 A;  2EPA A;  2EE8 A;  2RSM A;  2V8Q B;  2NUF A;  4WSP A;  4X62 E;  2DSY A;  2A25 A;  1IMU A;  3AV0 A;  2EMG A;  2E1M A;  4LU9 A;  3M99 B;  2K4V A;  3TQM A;  1LLM C;  1YSA C;  4NZV A;  2L3J A;  4WSG A;  2YTF A;  3EPJ A;  4J8Z A;  2EN1 A;  2DIX A;  4WYQ B;  2M9A A;  4LFB E;  1AAY A;  2V83 A;  1F2I G;  3HXL A;  2YT4 A;  5KL3 A;  2D9H A;  2GPI A;  4R2D A;  4LFA E;  4YHH E;  2EM6 A;  5IWA E;  2DMY A;  1WJP A;  1MEY C;  5LLQ A;  4GEQ B;  4JI0 E;  4LFC E;  4F9A B;  2EL5 A;  2WBT A;  2EOO A;  4MLV A;  1EH8 A;  4KZS A;  2EZ6 A;  2YTI A;  2EQ1 A;  4BMJ A;  4O24 A;  1IBK E;  2EMY A;  5LL6 R;  3C6M A;  3QG5 C;  3BID A;  3EPH A;  2EOZ A;  5LMN E;  2LMZ A;  2I9I A;  4M0V A;  1AH5 A;  4BHB A;  4DR3 E;  3RMP A;  4F9C B;  2VQF E;  1WHQ A;  1IBM E;  2YWQ A;  2EM7 A;  1J26 A;  3LLH A;  2R76 A;  2G7H A;  1N3G A;  2EN2 A;  2LUP B;  1L4S A;  2EMF A;  2UU9 E;  4DKK A;  1BBO A;  1RC7 A;  4JV5 E;  4K0K E;  2JPA A;  2CTD A;  3ADI A;  2VQE E;  1PJS A;  5KL7 A;  2JVA A;  4O5G A;  4DMI A;  2DMI A;  4R2P A;  2YRH A;  3THO B;  3BBG A;  2N3H A;  2L92 A;  2MDG A;  4F6M A;  2NUG A;  4DV0 E;  4LF5 E;  2ENC A;  2EJ4 A;  1JK2 A;  3MHS C;  4O43 A;  1N32 E;  2RS6 A;  5AC4 A;  1JK1 A;  4X66 E;  4B3R E;  2YSO A;  1T4N A;  1X6F A;  2KON A;  4R2C A;  2MDR A;  3HPZ A;  2MC5 A;  1EH7 A;  3KWR A;  2DRP A;  2BBG A;  2EMH A;  2EOY A;  4M9V C;  2CSH A;  1IQS A;  1FJG E;  2YTJ A;  1WXR A;  2EPR A;  4F6N A;  4JI5 E;  1XNQ E;  1RQ0 A;  4AQY E;  2EQ3 A;  1UHZ A;  1N36 E;  2DLQ A;  1RMD A;  2EOQ A;  2JP9 A;  4R2E A;  4X65 E;  2EOH A;  2EM2 A;  1NEI A;  1BBG A;  2VF1 A;  2UUB E;  2HGH A;  2CT1 A;  1WRJ A;  3ADJ A;  3JAM C;  2EN4 A;  3ADG A;  5AE3 A;  2LTR A;  5AAS A;  1YPN A;  4R2A A;  2EQ0 A;  3ECR A;  1YYK A;  3KZY A;  1X49 A;  4BC7 A;  2UXD E;  3ADL A;  4R03 A;  4BCA A;  2EN3 A;  3VYY A;  4R2S A;  2ZM6 E;  1UIL A;  2YTN A;  3HQ1 A;  4DR4 E;  5FLX C;  2EMK A;  2B9D A;  4B3T E;  1TF3 A;  4WX9 A;  2WBU A;  5A2Q C;  2HJJ A;  2EL6 A;  2YTP A;  2HHH E;  4BS9 A;  4DR7 E;  3IWD A;  1YYO A;  4DR1 E;  1T4L B;  4LF9 E;  4DUZ E;  2JOB A;  2YTG A;  1HNX E;  2EM3 A;  2EWL A;  1A1J A;  2LBS B;  2EPK X;  4OOG C;  1A1F A;  1X6H A;  2LTS A;  2L6M A;  2LCE A;  2EN7 A;  5A69 A;  3UK3 C;  5KL2 A;  5A6B A;  2F8B A;  1G2D C;  4M2Z A;  1GQE A;  3VHT B;  1SR9 A;  3OTO E;  5KL4 A;  4DR6 E;  4MLQ A;  4DR2 E;  1ZBQ A;  2NUE A;  2EM8 A;  4ZYD A;  2EPC A;  2VRD A;  2WBS A;  3BF2 A;  1DQ3 A;  1PJQ A;  4F9B B;  4JI3 E;  4NXN E;  1KYQ A;  4DV6 E;  2ODR C;  2CPN A;  2V85 A;  4DV5 E;  4X9J A;  1TF6 A;  1A1L A;  2LRS A;  3F6H A;  4R8O A;  2MC6 A;  4HEI A;  4X64 E;  1EKZ A;  4NXM E;  2V89 A;  2EMB A;  3J7A G;  4LF8 E;  2YZT A;  2V87 A;  3F6G A;  2LT7 A;  5A6J A;  3AUZ A;  1X47 A;  1ZBT A;  2LE2 A;  3J81 C;  4LF7 E;  2EOR A;  4ZYH A;  3EQ1 A;  1ZU1 A;  1T38 A;  1A1I A;  4KHP E;  4B3S E;  2K7I A;  2EOE A;  2HC5 A;  3DF6 A;  3J80 C;  4F2J C;  3HTX A;  2EPU A;  2LO3 A;  5IXM B;  2L2K B;  2EOI A;  1IBL E;  1YYW A;  2YTQ A;  2EMW A;  4DUY E;  4L5N C;  2L33 A;  2EML A;  3C6K A;  2YRM A;  2YTO A;  4M30 A;  4WPY A;  1STU A;  4GZN C;  2YTE A;  2ENH A;  1X3C A;  5A6A A;  1DI2 A;  4TUG A;  2EOM A;  4GKJ E;  2UUC E;  4JI2 E;  4R2Q A;  4WXD A;  1G2F C;  2EPM X;  2YTD A;  3ZOQ B;  5KL6 A;  2EMC A;  1T39 A;  2EM0 A;  3BGH A;  2RPC A;  4DV2 E;  2Q8U A;  3JTZ A;  2H36 X;  2YPN A;  1J5E E;  2LJU A;  2MKD A;  4O4K A;  2L3C A;  1XNR E;  2R1F A;  1UN6 B;  4BHC A;  1IQO A;  4LF4 E;  2EM9 A;  4RH8 A;  1EH6 A;  2E72 A;  1WHN A;  4DV7 E;  5A6B D;  2ADR A;  3T1H E;  2EMZ A;  4B3M E;  2JY9 A;  2RTX A;  3HPS A;  4JI8 E;  1TN9 A;  2IHR 1;  2GLI A;  2UUA E;  4OX9 E;  1A1G A;  2EL4 A; 
#chains in the Genus database with same CATH homology
 2N3G A;  2LUP B;  1QU6 A;  5BR8 E;  2UU9 E;  4DKK A;  1HNW E;  2F8B A;  4M2Z A;  1GQE A;  1SR9 A;  2B7T A;  2B7V A;  3OTO E;  2B3T B;  1RC7 A;  2V88 A;  4K0K E;  4JV5 E;  3ADI A;  2VQE E;  3OML A;  4P78 A;  2L2N A;  4DR6 E;  3DJW A;  2KHX A;  4DR2 E;  1ZBQ A;  2JVA A;  2NUE A;  2UXB E;  4DMI A;  4L8N A;  1DQ3 A;  2N3H A;  2L92 A;  3VK6 A;  4JI1 E;  4F9B B;  4JI3 E;  4P7D A;  4NXN E;  3MSW A;  1YZ9 A;  2NUG A;  4DV0 E;  1N34 E;  5AE2 A;  4LF5 E;  4DV6 E;  2ODR C;  2CPN A;  2V85 A;  4X8W A;  4DV5 E;  2FV4 B;  5LMU E;  2WZO A;  5ADZ A;  5IT9 C;  2LRS A;  1N32 E;  2RS6 A;  4GKK E;  3F6H A;  4X66 E;  4B3R E;  4R8O A;  2MC6 A;  2ODR D;  4DV1 E;  4X64 E;  3J7Y p;  1EKZ A;  1T4N A;  2FGG A;  2V89 A;  4NXM E;  3J7A G;  4LF8 E;  2KON A;  2YZT A;  2V87 A;  3F6G A;  4JYA E;  2MDR A;  3HPZ A;  2MC5 A;  3AUZ A;  2LJH A;  2V86 A;  1X47 A;  1ZBT A;  2LE2 A;  3J81 C;  4LF7 E;  1N33 E;  3KWR A;  4I8O A;  5DNY A;  4TUI A;  4DR5 E;  4Q28 A;  4DV3 E;  1O0W A;  4KHP E;  4B3S E;  1FJG E;  3HTX A;  3DF6 A;  4F54 A;  2L2M A;  3IWC A;  3J80 C;  2UXC E;  1WXR A;  2L2K B;  3VYX A;  2JWO A;  3JU0 A;  1IBL E;  4JI5 E;  4JI7 E;  1XNQ E;  1RQ0 A;  1YYW A;  5F3W A;  2RSM A;  1T4O A;  2V8Q B;  4AQY E;  4WSP A;  2NUF A;  4DUY E;  2F4V E;  4L5N C;  4X62 E;  2DSY A;  2L33 A;  4JI4 E;  1UHZ A;  3AV0 A;  1N36 E;  4JI6 E;  2M4I A;  4M30 A;  2E1M A;  4LU9 A;  3C4T A;  4WPY A;  1STU A;  4X65 E;  2K4V A;  5T6J A;  2L3J A;  1GZ6 A;  1DI2 A;  2LUQ A;  4J8Z A;  4TUG A;  2DIX A;  4GKJ E;  4WYQ B;  2UUC E;  4JI2 E;  2VF1 A;  2UUB E;  2M7Q A;  4LFB E;  3IWB A;  3ADJ A;  1I94 E;  3JAM C;  5AE3 A;  3ADG A;  4DV4 E;  3P1X A;  2LTR A;  2FTX B;  2V83 A;  3HXL A;  1HNZ E;  2M1S A;  5AAS A;  2YT4 A;  1YYK A;  3ZOQ B;  2JR1 A;  4LFA E;  2E5L E;  1X49 A;  5CFF E;  4YY3 E;  4BC7 A;  2NA2 A;  4YHH E;  3ADL A;  4WFT A;  2L8T A;  2UXD E;  5IWA E;  4R03 A;  2DMY A;  4BC9 A;  4BCA A;  3H09 A;  4GEQ B;  4BBY A;  3VYY A;  2RS7 A;  4JI0 E;  2ZM6 E;  4LFC E;  1UIL A;  1XMO E;  4F9A B;  4DV2 E;  3HQ1 A;  3JTZ A;  2H36 X;  5FLX C;  1J5E E;  2B9D A;  5AE1 A;  3T1Y E;  4LF6 E;  4DR4 E;  2L3C A;  4B3T E;  1X48 A;  2JOX A;  1XNR E;  4KZS A;  2EZ6 A;  5A2Q C;  4LF4 E;  4BMJ A;  3K6Q A;  2VE7 C;  3LML A;  2HHH E;  4BS9 A;  1IBK E;  5LL6 R;  3FIG A;  4DR7 E;  1WHN A;  3IWD A;  4DV7 E;  3T1H E;  1YYO A;  4DR1 E;  1XMQ E;  1T4L B;  4B3M E;  2JY9 A;  5LMN E;  4LF9 E;  2LMZ A;  2JOB A;  4DUZ E;  2RTX A;  1HNX E;  3HPS A;  4M0V A;  4JI8 E;  1FKA E;  1PKP A;  2EWL A;  4LTY A;  4DR3 E;  3RMP A;  1HR0 E;  2LBS B;  2IHR 1;  2KOU A;  1WHQ A;  4F9C B;  4OOG C;  2VQF E;  1IBM E;  3LLH A;  1J26 A;  2UUA E;  4OX9 E;  2G7H A;  2L6M A;  2LTS A;  2DB2 A;  3C4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...