3IWCA

T. maritima adometdc complex with s-adenosylmethionine methyl ester
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
58
Chain Sequence
HLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEIGIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complexes of Thermotoga maritimaS-adenosylmethionine decarboxylase provide insights into substrate specificity.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords S-adenosylmethionine decarboxylase
total genus 8
structure length 58
sequence length 58
chains with identical sequence C
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.750 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3iwcA00
3IWCA 3IWDA 3IWBA
chains in the Genus database with same CATH superfamily
3AV0A 3HPZA 4N4RB 2GHFA 1X48A 1ZR9A 5IXMB 2LUPB 3VYXA 2JOXA 3AUZA 2EE8A 2L2MA 4P7DA 1KYQA 1G2DC 2RPCA 1RC7A 2BBGA 4O43A 4IJDA 4WFTA 2EM4A 4WYQB 2JXPA 4R2PA 4DR6E 2RS7A 4IS1C 2NUFA 4WSPA 4BHBA 3LLHA 3VYYA 2JPAA 2L3JA 1IQOA 1LLMC 3C6MA 1FKAE 5AE1A 4R2SA 2DMYA 2KOUA 2WBUA 2EQ0A 4X66E 2ODRC 2EPPA 1KJKA 5A6BD 2UU9E 5AASA 3C4TA 5LMNE 2VQEE 2HJJA 3HPSA 2LBSB 1WHNA 5AC5A 2FTXB 4LFBE 4DV7E 4R2EA 2EN3A 2V89A 2WBSA 2L2NA 5A69A 2B3TB 3P1XA 2EPNA 2YU5A 4R03A 5KL6A 3MHSC 1N36E 1BB8A 2YZTA 3J81C 2FV4B 2H36X 4O24A 3K6QA 3JAMC 4GZNC 2DLQA 2JYAA 1IBLE 2E1MA 5KL7A 1X3CA 3KZYA 4RH8A 4R2AA 4X9JA 5LLQA 1IBKE 1TF3A 4BS9A 5KL5A 4M9VC 2K7IA 1PKPA 3J7AG 1L4SA 2MC5A 1JK2A 5A6AA 4BC9A 4BBYA 1NCSA 2YTQA 4HEIA 5IWAE 2EOIA 3BF2A 4KHPE 2M9AA 1BBGA 2YTEA 1A1KA 1MEYC 2EOEA 5KL2A 4P78A 4LF5E 1ZBQA 1A1IA 3KZZA 2B7TA 1TN9A 1T4LB 1AH5A 4JI8E 2HHHE 1GTKA 1J26A 2V86A 2DMIA 3FIGA 3F6HA 4DV2E 1T38A 4F6NA 2NUEA 2BB8A 2EWLA 3HQ1A 4DMIA 3C4BA 3EQ1A 2VRDA 4LTYA 1QU6A 3TQMA 2EMLA 4X65E 2UXBE 4R2DA 5A6BA 1YPNA 5BR8E 2EMAA 2EM7A 4M30A 2EPRA 2B9DA 2EN4A 4R2QA 2EMBA 2EQ3A 1EH8A 2EM6A 3T1YE 3RMPA 2YTNA 2EPZA 4JI3E 2UUAE 4R2CA 1XMQE 2LJHA 1T39A 3EPJA 2LRSA 4OOGC 5CFFE 2EMYA 3HXLA 1YFHA 1T4NA 4WX9A 4LFAE 2YTPA 3THNA 2YRHA 1X6HA 5LL6R 4JI5E 2F8BA 2YSPA 1YZ9A 2EPKX 3JTZA 3T1HE 3ADIA 2EM3A 4L5NC 1P47A 2ELZA 2N8XA 2EMHA 1MGTA 1B69A 4OX9E 2YTJA 2EMFA 2V8QB 2EN6A 3M99B 2RTXA 2YRMA 4X62E 3ECRA 4LF4E 5IV8B 2JVAA 4X64E 1HR0E 1UHZA 1RMDA 2EPUA 3OTOE 1N33E 2L33A 1GZ6A 2EPAA 4DKKA 2R1FA 4M0VA 4BC7A 4ZYDA 2GLIA 2WCC3 2B7VA 1XNQE 4JI7E 2EPMX 1I94E 1EKZA 4BCAA 1PJSA 1WRJA 2EMZA 4DV1E 2MKDA 2YTIA 4DV5E 2D9HA 1IQSA 4ZYHA 2EM0A 2MDGA 1HNZE 4LFCE 5LMUE 1YSAC 1GQEA 2UXDE 4JV5E 4YHHE 2I13A 2F4VE 1A1LA 2EN1A 2EN8A 2MC6A 1YYOA 4YY3E 4FK5C 2DLKA 3L00A 3MSWA 2EL6A 1DQ3A 2ENHA 2EM9A 4DR7E 3BBGA 4Q28A 2EPOA 1EH7A 1PJQA 2MDRA 4GKJE 2M7QA 3H09A 2LMZA 2EM2A 2JR1A 2LE2A 3BGHA 3KWRA 2HGHA 2EOOA 4L8NA 4KWYA 4R2RA 1G2FC 4GEQB 1X47A 2NA2A 2EOMA 2EMWA 4JI4E 2LUQA 1J5EE 2JY9A 4RHBB 1YUJA 2UUBE 4LF6E 1UBDC 4O5GA 2LJUA 2UUCE 5IT9C 2ENCA 1Z1BA 2EOJA 1XMOE 2WBTA 1ZAAC 5DNYA 2M1SA 3VHTB 2IHR1 3ADLA 5AC4A 1RQ0A 1N3GA 4DR4E 2EL4A 1N32E 2R76A 2PRTA 1PDAA 2V87A 1FJGE 2CT1A 1DGCA 4TUGA 1O0WA 2LVHA 1N34E 1JK1A 1HNWE 2A25A 4JI6E 1UILA 1A1JA 4I8OA 2JP9A 4JI1E 3C6KA 2V88A 2EOQA 4F54A 2E72A 1X5WA 4DV6E 4AQYE 2RQLA 4ZYEA 2LTSA 2EPCA 3ADJA 2UXCE 1IMUA 5KL3A 2EPLX 4KZSA 4NXNE 2MKNA 2YRKA 3VK6A 1SFEA 5A6JA 3MHHC 4DUYE 2EOHA 2ENAA 4J8ZA 2EMXA 4DV0E 3ZOQB 4M2ZA 2EP3A 2J7JA 4LU9A 2JOBA 3DF6A 3BIDA 3UK3C 2FGGA 3OMLA 4WXCA 2Q8UA 2L8TA 2LT7A 4BMJA 3IWBA 2RSIA 4NHRA 2EN2A 1A1GA 2EL5A 3THOB 2CTDA 1STUA 2LTRA 4DUZE 2EZ6A 2YWQA 4WPYA 1ZBTA 4WXDA 5A2QC 2L6MA 2EORA 3J80C 1NEIA 2L2KB 3HTXA 4LF7E 5AE3A 3EPKA 4B3RE 1DI2A 2GPIA 4MLVA 2RSMA 2VQFE 2G7HA 3F6GA 4F9AB 2EOXA 5TSEA 2EOZA 1BBOA 5T6JA 4F9CB 2EQ1A 2CPNA 2EMGA 4B3SE 4B3ME 2EN7A 2L92A 4GKKE 2EM8A 2EOFA 2DSYA 3QG5C 1SR9A 4O4KA 1IBME 2ZM6E 4DV4E 4DR1E 2YSOA 2YT4A 2WZOA 5F3WA 4HTGA 2KHXA 1XNRE 4DR2E 1X6FA 4X8WA 2EMCA 4DR5E 4WSGA 2JWOA 1HNXE 2ADRA 2LCEA 1UN6B 3EPHA 2I9IA 4TUIA 2E5LE 3EPLA 1AAYA 2RS6A 5KL4A 4F9BB 3ADGA 1F2IG 3JU0A 1QNTA 2DRPA 5A6KA 4JI0E 4NZVA 3IWDA 2EOYA 4Q35B 4DV3E 2ELYA 2N3HA 1A1FA 4K0KE 2NABA 2L3CA 2EOSA 2K4VA 1T4OA 4NXME 1A1HA 4BHCA 2V85A 2CSHA 2EJ4A 4MLQA 4JYAE 4LF9E 1TF6A 2DB2A 2DIXA 1YUIA 2ODRD 2M4IA 2HC5A 4B3TE 4F2JC 2YTOA 1YYKA 2EMKA 1X6EA 1PJTA 4LF8E 2LV2A 2VE7C 4DR3E 2YPNA 1ZU1A 2YTDA 1WXRA 2DGCA 2KONA 3LMLA 2EM5A 5ADZA 4ZYGA 1EH6A 2YU8A 5FLXC 3DJWA 2NUGA 4JI2E 2N3GA 2LO3A 1WHQA 2YTFA 1X49A 3IWCA 3J7Yp 4F6MA 2YTGA 2EMIA 1WJPA 2EPXA 2V83A 2VF1A 5AE2A 1YYWA 4R8OA
chains in the Genus database with same CATH topology
2LE2A 2NUEA 2EWLA 3AV0A 3HPZA 3HQ1A 4DMIA 3KWRA 1X48A 4L8NA 3C4BA 2LUPB 4GEQB 1X47A 2NA2A 5T6JA 3VYXA 4LTYA 2JOXA 1QU6A 3AUZA 4JI4E 2LUQA 4F9CB 4X65E 4P7DA 2L2MA 2UXBE 1J5EE 4M30A 2CPNA 5BR8E 2JY9A 1RC7A 4B3SE 2UUBE 4LF6E 4B3ME 2B9DA 4WFTA 2L92A 3T1YE 4WYQB 3RMPA 4JI3E 4GKKE 2UUAE 1XMQE 2DSYA 4DR6E 2LJHA 2UUCE 2RS7A 5IT9C 2NUFA 4WSPA 1SR9A 2LRSA 4OOGC 5CFFE 1IBME 3LLHA 3HXLA 2ZM6E 1XMOE 4DV4E 4DR1E 3VYYA 5DNYA 2M1SA 1T4NA 2YT4A 2WZOA 5F3WA 4LFAE 2IHR1 2KHXA 2L3JA 3ADLA 1XNRE 4DR2E 1FKAE 1RQ0A 4X8WA 5AE1A 4DR5E 2JWOA 5LL6R 4JI5E 2F8BA 1YZ9A 4DR4E 3T1HE 3JTZA 1HNXE 3ADIA 2DMYA 4DV2E 2KOUA 4X66E 2ODRC 1N32E 4TUIA 4L5NC 2E5LE 2UU9E 2V87A 1FJGE 5AASA 3C4TA 4TUGA 1O0WA 5LMNE 1N34E 2VQEE 1HNWE 3HPSA 4OX9E 2LBSB 1WHNA 4JI6E 2RS6A 2FTXB 1UILA 4F9BB 4LFBE 3ADGA 4DV7E 3JU0A 4I8OA 4JI1E 2V8QB 2V88A 2V89A 2RTXA 4F54A 4X62E 4JI0E 4DV6E 4AQYE 2L2NA 4LF4E 2B3TB 2LTSA 3IWDA 2JVAA 3ADJA 3P1XA 4X64E 2N3HA 4DV3E 1HR0E 2UXCE 1UHZA 4K0KE 4R03A 3OTOE 1N33E 2L3CA 2L33A 4KZSA 1N36E 2YZTA 1GZ6A 3J81C 2K4VA 4NXNE 1T4OA 2FV4B 2H36X 4M0VA 4BC7A 4DKKA 3K6QA 4NXME 3VK6A 3JAMC 2V85A 2B7VA 1XNQE 4JI7E 1IBLE 2E1MA 4JYAE 4DUYE 4LF9E 2DB2A 2DIXA 4J8ZA 2ODRD 1I94E 1EKZA 4BCAA 4DV0E 1IBKE 3ZOQB 4BS9A 2M4IA 4DV1E 4M2ZA 4B3TE 1PKPA 3J7AG 4DV5E 4LU9A 1YYKA 2JOBA 3DF6A 2FGGA 3OMLA 2MC5A 1HNZE 4LFCE 2L8TA 5LMUE 4LF8E 4BMJA 1J26A 1GQEA 3IWBA 2VE7C 4BC9A 4BBYA 4JV5E 2UXDE 4DR3E 4YHHE 5IWAE 2F4VE 1WXRA 4KHPE 2KONA 2MC6A 3LMLA 1STUA 2LTRA 4DUZE 1YYOA 5ADZA 2EZ6A 4WPYA 4YY3E 5FLXC 3DJWA 1ZBTA 5A2QC 3MSWA 2NUGA 4JI2E 3F6GA 4P78A 2N3GA 1DQ3A 1WHQA 2L6MA 4DR7E 3J80C 4LF5E 1ZBQA 2L2KB 3HTXA 4Q28A 1X49A 2MDRA 3IWCA 4LF7E 5AE3A 2B7TA 4B3RE 1DI2A 4GKJE 3J7Yp 2M7QA 2RSMA 3H09A 1T4LB 2LMZA 4JI8E 2HHHE 2VQFE 2V83A 2G7HA 2V86A 2VF1A 2JR1A 3F6HA 3FIGA 5AE2A 4F9AB 4R8OA 1YYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWC A;  3IWD A;  3IWB A; 
#chains in the Genus database with same CATH topology
 3AV0 A;  3HPZ A;  4N4R B;  2GHF A;  1X48 A;  1ZR9 A;  5IXM B;  2LUP B;  3VYX A;  2JOX A;  3AUZ A;  2EE8 A;  2L2M A;  4P7D A;  1KYQ A;  1G2D C;  2RPC A;  1RC7 A;  2BBG A;  4O43 A;  4IJD A;  4WFT A;  2EM4 A;  4WYQ B;  2JXP A;  4R2P A;  4DR6 E;  2RS7 A;  4IS1 C;  2NUF A;  4WSP A;  4BHB A;  3LLH A;  3VYY A;  2JPA A;  2L3J A;  1IQO A;  1LLM C;  3C6M A;  1FKA E;  5AE1 A;  4R2S A;  2DMY A;  2KOU A;  2WBU A;  2EQ0 A;  4X66 E;  2ODR C;  2EPP A;  1KJK A;  5A6B D;  2UU9 E;  5AAS A;  3C4T A;  5LMN E;  2VQE E;  2HJJ A;  3HPS A;  2LBS B;  1WHN A;  5AC5 A;  2FTX B;  4LFB E;  4DV7 E;  4R2E A;  2EN3 A;  2V89 A;  2WBS A;  2L2N A;  5A69 A;  2B3T B;  3P1X A;  2EPN A;  2YU5 A;  4R03 A;  5KL6 A;  3MHS C;  1N36 E;  1BB8 A;  2YZT A;  3J81 C;  2FV4 B;  2H36 X;  4O24 A;  3K6Q A;  3JAM C;  4GZN C;  2DLQ A;  2JYA A;  1IBL E;  2E1M A;  5KL7 A;  1X3C A;  3KZY A;  4RH8 A;  4R2A A;  4X9J A;  5LLQ A;  1IBK E;  1TF3 A;  4BS9 A;  5KL5 A;  4M9V C;  2K7I A;  1PKP A;  3J7A G;  1L4S A;  2MC5 A;  1JK2 A;  5A6A A;  4BC9 A;  4BBY A;  1NCS A;  2YTQ A;  4HEI A;  5IWA E;  2EOI A;  3BF2 A;  4KHP E;  2M9A A;  1BBG A;  2YTE A;  1A1K A;  1MEY C;  2EOE A;  5KL2 A;  4P78 A;  4LF5 E;  1ZBQ A;  1A1I A;  3KZZ A;  2B7T A;  1TN9 A;  1T4L B;  1AH5 A;  4JI8 E;  2HHH E;  1GTK A;  1J26 A;  2V86 A;  2DMI A;  3FIG A;  3F6H A;  4DV2 E;  1T38 A;  4F6N A;  2NUE A;  2BB8 A;  2EWL A;  3HQ1 A;  4DMI A;  3C4B A;  3EQ1 A;  2VRD A;  4LTY A;  1QU6 A;  3TQM A;  2EML A;  4X65 E;  2UXB E;  4R2D A;  5A6B A;  1YPN A;  5BR8 E;  2EMA A;  2EM7 A;  4M30 A;  2EPR A;  2B9D A;  2EN4 A;  4R2Q A;  2EMB A;  2EQ3 A;  1EH8 A;  2EM6 A;  3T1Y E;  3RMP A;  2YTN A;  2EPZ A;  4JI3 E;  2UUA E;  4R2C A;  1XMQ E;  2LJH A;  1T39 A;  3EPJ A;  2LRS A;  4OOG C;  5CFF E;  2EMY A;  3HXL A;  1YFH A;  1T4N A;  4WX9 A;  4LFA E;  2YTP A;  3THN A;  2YRH A;  1X6H A;  5LL6 R;  4JI5 E;  2F8B A;  2YSP A;  1YZ9 A;  2EPK X;  3JTZ A;  3T1H E;  3ADI A;  2EM3 A;  4L5N C;  1P47 A;  2ELZ A;  2N8X A;  2EMH A;  1MGT A;  1B69 A;  4OX9 E;  2YTJ A;  2EMF A;  2V8Q B;  2EN6 A;  3M99 B;  2RTX A;  2YRM A;  4X62 E;  3ECR A;  4LF4 E;  5IV8 B;  2JVA A;  4X64 E;  1HR0 E;  1UHZ A;  1RMD A;  2EPU A;  3OTO E;  1N33 E;  2L33 A;  1GZ6 A;  2EPA A;  4DKK A;  2R1F A;  4M0V A;  4BC7 A;  4ZYD A;  2GLI A;  2WCC 3;  2B7V A;  1XNQ E;  4JI7 E;  2EPM X;  1I94 E;  1EKZ A;  4BCA A;  1PJS A;  1WRJ A;  2EMZ A;  4DV1 E;  2MKD A;  2YTI A;  4DV5 E;  2D9H A;  1IQS A;  4ZYH A;  2EM0 A;  2MDG A;  1HNZ E;  4LFC E;  5LMU E;  1YSA C;  1GQE A;  2UXD E;  4JV5 E;  4YHH E;  2I13 A;  2F4V E;  1A1L A;  2EN1 A;  2EN8 A;  2MC6 A;  1YYO A;  4YY3 E;  4FK5 C;  2DLK A;  3L00 A;  3MSW A;  2EL6 A;  1DQ3 A;  2ENH A;  2EM9 A;  4DR7 E;  3BBG A;  4Q28 A;  2EPO A;  1EH7 A;  1PJQ A;  2MDR A;  4GKJ E;  2M7Q A;  3H09 A;  2LMZ A;  2EM2 A;  2JR1 A;  2LE2 A;  3BGH A;  3KWR A;  2HGH A;  2EOO A;  4L8N A;  4KWY A;  4R2R A;  1G2F C;  4GEQ B;  1X47 A;  2NA2 A;  2EOM A;  2EMW A;  4JI4 E;  2LUQ A;  1J5E E;  2JY9 A;  4RHB B;  1YUJ A;  2UUB E;  4LF6 E;  1UBD C;  4O5G A;  2LJU A;  2UUC E;  5IT9 C;  2ENC A;  1Z1B A;  2EOJ A;  1XMO E;  2WBT A;  1ZAA C;  5DNY A;  2M1S A;  3VHT B;  2IHR 1;  3ADL A;  5AC4 A;  1RQ0 A;  1N3G A;  4DR4 E;  2EL4 A;  1N32 E;  2R76 A;  2PRT A;  1PDA A;  2V87 A;  1FJG E;  2CT1 A;  1DGC A;  4TUG A;  1O0W A;  2LVH A;  1N34 E;  1JK1 A;  1HNW E;  2A25 A;  4JI6 E;  1UIL A;  1A1J A;  4I8O A;  2JP9 A;  4JI1 E;  3C6K A;  2V88 A;  2EOQ A;  4F54 A;  2E72 A;  1X5W A;  4DV6 E;  4AQY E;  2RQL A;  4ZYE A;  2LTS A;  2EPC A;  3ADJ A;  2UXC E;  1IMU A;  5KL3 A;  2EPL X;  4KZS A;  4NXN E;  2MKN A;  2YRK A;  3VK6 A;  1SFE A;  5A6J A;  3MHH C;  4DUY E;  2EOH A;  2ENA A;  4J8Z A;  2EMX A;  4DV0 E;  3ZOQ B;  4M2Z A;  2EP3 A;  2J7J A;  4LU9 A;  2JOB A;  3DF6 A;  3BID A;  3UK3 C;  2FGG A;  3OML A;  4WXC A;  2Q8U A;  2L8T A;  2LT7 A;  4BMJ A;  3IWB A;  2RSI A;  4NHR A;  2EN2 A;  1A1G A;  2EL5 A;  3THO B;  2CTD A;  1STU A;  2LTR A;  4DUZ E;  2EZ6 A;  2YWQ A;  4WPY A;  1ZBT A;  4WXD A;  5A2Q C;  2L6M A;  2EOR A;  3J80 C;  1NEI A;  2L2K B;  3HTX A;  4LF7 E;  5AE3 A;  3EPK A;  4B3R E;  1DI2 A;  2GPI A;  4MLV A;  2RSM A;  2VQF E;  2G7H A;  3F6G A;  4F9A B;  2EOX A;  5TSE A;  2EOZ A;  1BBO A;  5T6J A;  4F9C B;  2EQ1 A;  2CPN A;  2EMG A;  4B3S E;  4B3M E;  2EN7 A;  2L92 A;  4GKK E;  2EM8 A;  2EOF A;  2DSY A;  3QG5 C;  1SR9 A;  4O4K A;  1IBM E;  2ZM6 E;  4DV4 E;  4DR1 E;  2YSO A;  2YT4 A;  2WZO A;  5F3W A;  4HTG A;  2KHX A;  1XNR E;  4DR2 E;  1X6F A;  4X8W A;  2EMC A;  4DR5 E;  4WSG A;  2JWO A;  1HNX E;  2ADR A;  2LCE A;  1UN6 B;  3EPH A;  2I9I A;  4TUI A;  2E5L E;  3EPL A;  1AAY A;  2RS6 A;  5KL4 A;  4F9B B;  3ADG A;  1F2I G;  3JU0 A;  1QNT A;  2DRP A;  5A6K A;  4JI0 E;  4NZV A;  3IWD A;  2EOY A;  4Q35 B;  4DV3 E;  2ELY A;  2N3H A;  1A1F A;  4K0K E;  2NAB A;  2L3C A;  2EOS A;  2K4V A;  1T4O A;  4NXM E;  1A1H A;  4BHC A;  2V85 A;  2CSH A;  2EJ4 A;  4MLQ A;  4JYA E;  4LF9 E;  1TF6 A;  2DB2 A;  2DIX A;  1YUI A;  2ODR D;  2M4I A;  2HC5 A;  4B3T E;  4F2J C;  2YTO A;  1YYK A;  2EMK A;  1X6E A;  1PJT A;  4LF8 E;  2LV2 A;  2VE7 C;  4DR3 E;  2YPN A;  1ZU1 A;  2YTD A;  1WXR A;  2DGC A;  2KON A;  3LML A;  2EM5 A;  5ADZ A;  4ZYG A;  1EH6 A;  2YU8 A;  5FLX C;  3DJW A;  2NUG A;  4JI2 E;  2N3G A;  2LO3 A;  1WHQ A;  2YTF A;  1X49 A;  3IWC A;  3J7Y p;  4F6M A;  2YTG A;  2EMI A;  1WJP A;  2EPX A;  2V83 A;  2VF1 A;  5AE2 A;  1YYW A;  4R8O A; 
#chains in the Genus database with same CATH homology
 2LE2 A;  2NUE A;  2EWL A;  3AV0 A;  3HPZ A;  3HQ1 A;  4DMI A;  3KWR A;  1X48 A;  4L8N A;  3C4B A;  2LUP B;  4GEQ B;  1X47 A;  2NA2 A;  5T6J A;  3VYX A;  4LTY A;  2JOX A;  1QU6 A;  3AUZ A;  4JI4 E;  2LUQ A;  4F9C B;  4X65 E;  4P7D A;  2L2M A;  2UXB E;  1J5E E;  4M30 A;  2CPN A;  5BR8 E;  2JY9 A;  1RC7 A;  4B3S E;  2UUB E;  4LF6 E;  4B3M E;  2B9D A;  4WFT A;  2L92 A;  3T1Y E;  4WYQ B;  3RMP A;  4JI3 E;  4GKK E;  2UUA E;  1XMQ E;  2DSY A;  4DR6 E;  2LJH A;  2UUC E;  2RS7 A;  5IT9 C;  2NUF A;  4WSP A;  1SR9 A;  2LRS A;  4OOG C;  5CFF E;  1IBM E;  3LLH A;  3HXL A;  2ZM6 E;  1XMO E;  4DV4 E;  4DR1 E;  3VYY A;  5DNY A;  2M1S A;  1T4N A;  2YT4 A;  2WZO A;  5F3W A;  4LFA E;  2IHR 1;  2KHX A;  2L3J A;  3ADL A;  1XNR E;  4DR2 E;  1FKA E;  1RQ0 A;  4X8W A;  5AE1 A;  4DR5 E;  2JWO A;  5LL6 R;  4JI5 E;  2F8B A;  1YZ9 A;  4DR4 E;  3T1H E;  3JTZ A;  1HNX E;  3ADI A;  2DMY A;  4DV2 E;  2KOU A;  4X66 E;  2ODR C;  1N32 E;  4TUI A;  4L5N C;  2E5L E;  2UU9 E;  2V87 A;  1FJG E;  5AAS A;  3C4T A;  4TUG A;  1O0W A;  5LMN E;  1N34 E;  2VQE E;  1HNW E;  3HPS A;  4OX9 E;  2LBS B;  1WHN A;  4JI6 E;  2RS6 A;  2FTX B;  1UIL A;  4F9B B;  4LFB E;  3ADG A;  4DV7 E;  3JU0 A;  4I8O A;  4JI1 E;  2V8Q B;  2V88 A;  2V89 A;  2RTX A;  4F54 A;  4X62 E;  4JI0 E;  4DV6 E;  4AQY E;  2L2N A;  4LF4 E;  2B3T B;  2LTS A;  3IWD A;  2JVA A;  3ADJ A;  3P1X A;  4X64 E;  2N3H A;  4DV3 E;  1HR0 E;  2UXC E;  1UHZ A;  4K0K E;  4R03 A;  3OTO E;  1N33 E;  2L3C A;  2L33 A;  4KZS A;  1N36 E;  2YZT A;  1GZ6 A;  3J81 C;  2K4V A;  4NXN E;  1T4O A;  2FV4 B;  2H36 X;  4M0V A;  4BC7 A;  4DKK A;  3K6Q A;  4NXM E;  3VK6 A;  3JAM C;  2V85 A;  2B7V A;  1XNQ E;  4JI7 E;  1IBL E;  2E1M A;  4JYA E;  4DUY E;  4LF9 E;  2DB2 A;  2DIX A;  4J8Z A;  2ODR D;  1I94 E;  1EKZ A;  4BCA A;  4DV0 E;  1IBK E;  3ZOQ B;  4BS9 A;  2M4I A;  4DV1 E;  4M2Z A;  4B3T E;  1PKP A;  3J7A G;  4DV5 E;  4LU9 A;  1YYK A;  2JOB A;  3DF6 A;  2FGG A;  3OML A;  2MC5 A;  1HNZ E;  4LFC E;  2L8T A;  5LMU E;  4LF8 E;  4BMJ A;  1J26 A;  1GQE A;  3IWB A;  2VE7 C;  4BC9 A;  4BBY A;  4JV5 E;  2UXD E;  4DR3 E;  4YHH E;  5IWA E;  2F4V E;  1WXR A;  4KHP E;  2KON A;  2MC6 A;  3LML A;  1STU A;  2LTR A;  4DUZ E;  1YYO A;  5ADZ A;  2EZ6 A;  4WPY A;  4YY3 E;  5FLX C;  3DJW A;  1ZBT A;  5A2Q C;  3MSW A;  2NUG A;  4JI2 E;  3F6G A;  4P78 A;  2N3G A;  1DQ3 A;  1WHQ A;  2L6M A;  4DR7 E;  3J80 C;  4LF5 E;  1ZBQ A;  2L2K B;  3HTX A;  4Q28 A;  1X49 A;  2MDR A;  3IWC A;  4LF7 E;  5AE3 A;  2B7T A;  4B3R E;  1DI2 A;  4GKJ E;  3J7Y p;  2M7Q A;  2RSM A;  3H09 A;  1T4L B;  2LMZ A;  4JI8 E;  2HHH E;  2VQF E;  2V83 A;  2G7H A;  2V86 A;  2VF1 A;  2JR1 A;  3F6H A;  3FIG A;  5AE2 A;  4F9A B;  4R8O A;  1YYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...