3IWCA

T. maritima adometdc complex with s-adenosylmethionine methyl ester
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
58
Chain Sequence
HLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEIGIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-adenosylmethionine decarboxylase
publication title Complexes of Thermotoga maritimaS-adenosylmethionine decarboxylase provide insights into substrate specificity.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 8
structure length 58
sequence length 58
chains with identical sequence C
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.750 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3iwcA00
3IWCA 3IWBA 3IWDA
chains in the Genus database with same CATH superfamily
4O24A 3J81C 2EZ6A 2B7VA 1RC7A 1HR0E 1YPNA 1T39A 1SFEA 4LU9A 1X49A 3VYYA 1EH8A 2JR1A 4F9AB 1X47A 2EM0A 2LUPB 3ADJA 3M99B 4M2ZA 1WXRA 1EH6A 2EMKA 1P47A 2EPCA 2EMCA 2EPRA 4OX9E 2NABA 2LCEA 4DUYE 2RTXA 4F2JC 1FKAE 4B3RE 3MSWA 2EN6A 2MC5A 2V89A 4R2DA 2EOXA 2L8TA 3EQ1A 4BC9A 4YHHE 2KONA 4DV7E 1MEYC 1UBDC 3K6QA 2MKDA 3JTZA 4ZYEA 2EOEA 3KZYA 2EOFA 1O0WA 2V83A 3THNA 4R2CA 2E1MA 2I13A 2EL5A 3HQ1A 4F6MA 2UXCE 2EMBA 2EN3A 2EOQA 4BCAA 2LBSB 3BIDA 4R2SA 4LF5E 2G7HA 4B3SE 1SR9A 1J5EE 5BR8E 2RQLA 3KZZA 4P7DA 2ZM6E 3C6MA 2MDGA 1BBOA 1WHQA 2ENHA 2H36X 1QNTA 4KWYA 4TUIA 4X65E 2L3JA 4LF9E 1WJPA 2ADRA 4M30A 2LT7A 2V8QB 2EPMX 2KHXA 4IS1C 2NUEA 2I9IA 3AUZA 1ZAAC 5LLQA 3J80C 1YYWA 1T4NA 4BHCA 4F6NA 2VF1A 4WXCA 4J8ZA 3IWBA 5F3WA 4LF4E 2LRSA 1EKZA 1HNWE 2MDRA 2LVHA 4DR2E 3EPHA 1IBKE 2L3CA 4WYQB 2CSHA 1QU6A 2JWOA 2JPAA 2VQFE 1STUA 4TUGA 2EM6A 2EOZA 2EOJA 4KHPE 2YPNA 3ADGA 1PJTA 2LE2A 5A6KA 5ADZA 2WBUA 2V87A 3MHHC 5A6BA 1A1FA 4DV6E 2EMYA 4M9VC 4DV0E 3EPJA 2CPNA 1I94E 4X62E 4WSPA 3F6GA 3TQMA 4R2PA 2JOXA 1A1KA 3H09A 2EMFA 1YYOA 2EJ4A 1IBME 2EMXA 1J26A 2RPCA 4NZVA 1DGCA 4HTGA 3THOB 1UN6B 3C6KA 1T4OA 5DNYA 5A69A 1HNXE 4WPYA 4JI3E 3FIGA 2HHHE 2N8XA 5LMNE 4K0KE 4OOGC 2EPLX 4JI7E 4GKJE 2JXPA 2FGGA 4O43A 2K4VA 4BBYA 1JK1A 3T1HE 4JI2E 1TF3A 2YU8A 1YZ9A 4O5GA 5CFFE 2EM5A 2EMIA 5LL6R 5IV8B 2EN8A 4JV5E 2YTDA 3DJWA 4MLVA 2UUBE 4O4KA 4BC7A 1IQSA 1IBLE 2M7QA 2EQ0A 5LMUE 2ENCA 1WHNA 2L33A 2B9DA 4X66E 2CT1A 1L4SA 2EM2A 4DKKA 2ODRD 3HPZA 4DV4E 3LMLA 1UILA 1YSAC 1XNRE 1N33E 3C4TA 1GZ6A 2D9HA 2EWLA 2B3TB 4WFTA 4R2RA 5AC5A 2L2NA 1XMOE 5KL7A 2RSMA 2DB2A 5TSEA 1RMDA 1RQ0A 2HJJA 5A6JA 5IXMB 2UUAE 1X6EA 2V88A 4DR6E 2F8BA 3LLHA 1NCSA 4ZYHA 4F9BB 4DR4E 4RHBB 5FLXC 4LTYA 5IT9C 3J7Yp 2DMIA 2L2KB 1JK2A 2DGCA 3AV0A 2HC5A 4RH8A 1ZR9A 2EE8A 2BBGA 1N32E 2RS6A 1ZBQA 2M9AA 2YTOA 3KWRA 4IJDA 2VE7C 1X6FA 2DSYA 4NXNE 3HXLA 2YZTA 3BF2A 2ELYA 4ZYGA 2K7IA 5AE1A 4R2EA 2EN7A 1GTKA 1YUIA 2EPNA 5KL2A 5KL5A 2EM4A 1T4LB 2JYAA 3UK3C 4Q35B 4X64E 3OMLA 3F6HA 4F9CB 5AE2A 4DV1E 2E72A 2V86A 4L8NA 4P78A 4R2AA 5A6BD 2EN4A 2F4VE 2YWQA 2Q8UA 3T1YE 2UUCE 3EPLA 5A2QC 2N3HA 4DR1E 1F2IG 2EM8A 2VRDA 4DR7E 3BGHA 3HPSA 2GPIA 4AQYE 2N3GA 2L92A 5AASA 4WX9A 4JYAE 3DF6A 2EP3A 4FK5C 2MC6A 5KL3A 2LTRA 2YTGA 3C4BA 3RMPA 2RSIA 3VHTB 2WCC3 1X6HA 4GKKE 1N36E 2EMAA 1FJGE 5KL4A 4DV5E 2FTXB 2UU9E 1TF6A 2YRKA 2RS7A 1PJSA 4BS9A 2VQEE 1BB8A 2YTQA 3OTOE 4LFBE 1A1LA 4JI1E 2EM7A 2L6MA 2KOUA 1Z1BA 3QG5C 1HNZE 3JU0A 2M4IA 1KJKA 4BMJA 2LV2A 1N3GA 2ENAA 2YSPA 4JI6E 2NA2A 1ZU1A 3J7AG 4GEQB 1XMQE 1XNQE 4DR3E 2DMYA 2JOBA 2JP9A 2YTJA 2LMZA 1NEIA 4JI5E 2EMZA 2WZOA 2FV4B 1X5WA 1A1HA 2EQ1A 2EN1A 1MGTA 3EPKA 5AC4A 1YUJA 5IWAE 1A1GA 1YYKA 1T38A 1UHZA 2ODRC 4I8OA 1TN9A 1ZBTA 4JI0E 1EH7A 4BHBA 3BBGA 2PRTA 2GLIA 4YY3E 4Q28A 2EPOA 4DR5E 4JI4E 2UXDE 4LFCE 2HGHA 2EL4A 2YTFA 2MKNA 1N34E 4JI8E 1PJQA 1A1JA 1IMUA 4R2QA 4R03A 4WSGA 2EORA 2NUGA 1DQ3A 1YFHA 2J7JA 4X9JA 4X8WA 2A25A 2R1FA 1G2DC 2YTPA 2R76A 1IQOA 1WRJA 2DRPA 1AH5A 3VYXA 2YRMA 2EOMA 3ECRA 1AAYA 4N4RB 1B69A 4LF8E 2EPXA 2EL6A 4KZSA 2E5LE 3P1XA 2M1SA 3L00A 1X3CA 2YTNA 4WXDA 4NXME 4ZYDA 4DV2E 2LTSA 1DI2A 2EM9A 3ADLA 3IWDA 1KYQA 2EPZA 2UXBE 2EPKX 2V85A 5T6JA 2DIXA 4HEIA 2NUFA 5AE3A 4LFAE 3ADIA 4MLQA 2EQ3A 2EOIA 2EMHA 2JVAA 4NHRA 1GQEA 2JY9A 2EOHA 2EOSA 4B3TE 2EMLA 2YSOA 2GHFA 2LJUA 2LUQA 3ZOQB 2WBSA 2EPAA 2EPUA 2EOYA 1PKPA 2B7TA 2DLKA 2LJHA 2YTIA 2EPPA 1BBGA 1G2FC 3VK6A 4M0VA 5A6AA 2YRHA 4DV3E 3HTXA 2EOOA 2IHR1 4DUZE 2EMGA 4LF6E 4L5NC 2EM3A 4R8OA 2LO3A 3JAMC 2EMWA 2CTDA 4GZNC 2ELZA 3MHSC 2EN2A 2YTEA 1A1IA 5KL6A 1LLMC 3IWCA 2DLQA 1PDAA 1X48A 2BB8A 2L2MA 2YU5A 4B3ME 4DMIA 2WBTA 4LF7E 2YT4A 4F54A
chains in the Genus database with same CATH topology
4DV0E 4X64E 3J81C 2CPNA 3OMLA 3F6HA 4WSPA 3F6GA 4X62E 2B7VA 4F9CB 5AE2A 4DR5E 4JI4E 2JOXA 4LFCE 3H09A 4DV1E 1YYOA 2V86A 4L8NA 1RC7A 4P78A 1HR0E 1N34E 4LU9A 4JI8E 2F4VE 1IBME 1X49A 3VYYA 1J26A 3T1YE 4R03A 2UUCE 5A2QC 2JR1A 2N3HA 4F9AB 1X47A 4DR1E 2NUGA 2LUPB 3ADJA 1DQ3A 4M2ZA 4DR7E 1T4OA 1WXRA 5DNYA 3HPSA 4X8WA 4AQYE 1HNXE 4WPYA 4JI3E 2N3GA 4OX9E 3FIGA 2L92A 5AASA 4JYAE 4DUYE 2HHHE 3VYXA 2RTXA 3DF6A 5LMNE 1FKAE 4B3RE 4K0KE 4OOGC 3MSWA 2MC5A 2V89A 4JI7E 4GKJE 2FGGA 2MC6A 2K4VA 2L8TA 4BC9A 4BBYA 2LTRA 3C4BA 4KZSA 4YHHE 3RMPA 3T1HE 2E5LE 2KONA 3P1XA 4JI2E 2M1SA 1YZ9A 4DV7E 3K6QA 4GKKE 3JTZA 5CFFE 5LL6R 1N36E 4NXME 1O0WA 4DV2E 2LTSA 2V83A 1FJGE 4JV5E 2E1MA 3DJWA 4DV5E 1DI2A 2FTXB 2UU9E 4LF8E 3HQ1A 4BC7A 2UUBE 3ADLA 2UXDE 1IBLE 2UXCE 2M7QA 2RS7A 3IWDA 4BS9A 2VQEE 5LMUE 2UXBE 4BCAA 2LBSB 1WHNA 2V85A 2L33A 3OTOE 4LFBE 2B9DA 4LF5E 2G7HA 4B3SE 1SR9A 5T6JA 2DIXA 4X66E 1J5EE 5BR8E 4JI1E 2NUFA 5AE3A 2L6MA 2KOUA 1HNZE 4LFAE 3ADIA 3JU0A 2M4IA 4P7DA 2ODRD 3HPZA 4DKKA 3LMLA 1UILA 2ZM6E 4DV4E 1XNRE 1N33E 2JVAA 3C4TA 1GZ6A 1GQEA 4BMJA 1WHQA 2JY9A 4TUIA 2H36X 2EWLA 2B3TB 4WFTA 4X65E 2L3JA 2L2NA 1XMOE 4LF9E 4B3TE 2RSMA 2DB2A 4M30A 4JI6E 1RQ0A 2NA2A 2V8QB 2KHXA 2UUAE 2LUQA 3ZOQB 3J7AG 2V88A 4GEQB 4DR6E 2NUEA 2F8BA 1XMQE 1PKPA 2B7TA 2LJHA 3AUZA 3LLHA 1XNQE 3J80C 4DR3E 2DMYA 1YYWA 1T4NA 2JOBA 3VK6A 4M0VA 4F9BB 2EZ6A 5FLXC 4DR4E 4LTYA 5IT9C 2VF1A 2LMZA 3J7Yp 2L2KB 3AV0A 4J8ZA 3IWBA 5F3WA 4LF4E 4JI5E 2LRSA 4DV3E 1EKZA 3HTXA 1N32E 2IHR1 4DUZE 2WZOA 1HNWE 2FV4B 2MDRA 4DR2E 1IBKE 4LF6E 2RS6A 1ZBQA 4L5NC 4R8OA 3KWRA 3JAMC 2L3CA 4WYQB 1QU6A 2VE7C 2JWOA 2VQFE 2DSYA 1STUA 5IWAE 4NXNE 4TUGA 3HXLA 2YZTA 1YYKA 4KHPE 1UHZA 2ODRC 3ADGA 3IWCA 1X48A 4I8OA 1ZBTA 2LE2A 2L2MA 5AE1A 4JI0E 4B3ME 4DMIA 5ADZA 2V87A 4LF7E 2YT4A 1I94E 4DV6E 1T4LB 4YY3E 4Q28A 4F54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWC A;  3IWB A;  3IWD A; 
#chains in the Genus database with same CATH topology
 4O24 A;  3J81 C;  2EZ6 A;  2B7V A;  1RC7 A;  1HR0 E;  1YPN A;  1T39 A;  1SFE A;  4LU9 A;  1X49 A;  3VYY A;  1EH8 A;  2JR1 A;  4F9A B;  1X47 A;  2EM0 A;  2LUP B;  3ADJ A;  3M99 B;  4M2Z A;  1WXR A;  1EH6 A;  2EMK A;  1P47 A;  2EPC A;  2EMC A;  2EPR A;  4OX9 E;  2NAB A;  2LCE A;  4DUY E;  2RTX A;  4F2J C;  1FKA E;  4B3R E;  3MSW A;  2EN6 A;  2MC5 A;  2V89 A;  4R2D A;  2EOX A;  2L8T A;  3EQ1 A;  4BC9 A;  4YHH E;  2KON A;  4DV7 E;  1MEY C;  1UBD C;  3K6Q A;  2MKD A;  3JTZ A;  4ZYE A;  2EOE A;  3KZY A;  2EOF A;  1O0W A;  2V83 A;  3THN A;  4R2C A;  2E1M A;  2I13 A;  2EL5 A;  3HQ1 A;  4F6M A;  2UXC E;  2EMB A;  2EN3 A;  2EOQ A;  4BCA A;  2LBS B;  3BID A;  4R2S A;  4LF5 E;  2G7H A;  4B3S E;  1SR9 A;  1J5E E;  5BR8 E;  2RQL A;  3KZZ A;  4P7D A;  2ZM6 E;  3C6M A;  2MDG A;  1BBO A;  1WHQ A;  2ENH A;  2H36 X;  1QNT A;  4KWY A;  4TUI A;  4X65 E;  2L3J A;  4LF9 E;  1WJP A;  2ADR A;  4M30 A;  2LT7 A;  2V8Q B;  2EPM X;  2KHX A;  4IS1 C;  2NUE A;  2I9I A;  3AUZ A;  1ZAA C;  5LLQ A;  3J80 C;  1YYW A;  1T4N A;  4BHC A;  4F6N A;  2VF1 A;  4WXC A;  4J8Z A;  3IWB A;  5F3W A;  4LF4 E;  2LRS A;  1EKZ A;  1HNW E;  2MDR A;  2LVH A;  4DR2 E;  3EPH A;  1IBK E;  2L3C A;  4WYQ B;  2CSH A;  1QU6 A;  2JWO A;  2JPA A;  2VQF E;  1STU A;  4TUG A;  2EM6 A;  2EOZ A;  2EOJ A;  4KHP E;  2YPN A;  3ADG A;  1PJT A;  2LE2 A;  5A6K A;  5ADZ A;  2WBU A;  2V87 A;  3MHH C;  5A6B A;  1A1F A;  4DV6 E;  2EMY A;  4M9V C;  4DV0 E;  3EPJ A;  2CPN A;  1I94 E;  4X62 E;  4WSP A;  3F6G A;  3TQM A;  4R2P A;  2JOX A;  1A1K A;  3H09 A;  2EMF A;  1YYO A;  2EJ4 A;  1IBM E;  2EMX A;  1J26 A;  2RPC A;  4NZV A;  1DGC A;  4HTG A;  3THO B;  1UN6 B;  3C6K A;  1T4O A;  5DNY A;  5A69 A;  1HNX E;  4WPY A;  4JI3 E;  3FIG A;  2HHH E;  2N8X A;  5LMN E;  4K0K E;  4OOG C;  2EPL X;  4JI7 E;  4GKJ E;  2JXP A;  2FGG A;  4O43 A;  2K4V A;  4BBY A;  1JK1 A;  3T1H E;  4JI2 E;  1TF3 A;  2YU8 A;  1YZ9 A;  4O5G A;  5CFF E;  2EM5 A;  2EMI A;  5LL6 R;  5IV8 B;  2EN8 A;  4JV5 E;  2YTD A;  3DJW A;  4MLV A;  2UUB E;  4O4K A;  4BC7 A;  1IQS A;  1IBL E;  2M7Q A;  2EQ0 A;  5LMU E;  2ENC A;  1WHN A;  2L33 A;  2B9D A;  4X66 E;  2CT1 A;  1L4S A;  2EM2 A;  4DKK A;  2ODR D;  3HPZ A;  4DV4 E;  3LML A;  1UIL A;  1YSA C;  1XNR E;  1N33 E;  3C4T A;  1GZ6 A;  2D9H A;  2EWL A;  2B3T B;  4WFT A;  4R2R A;  5AC5 A;  2L2N A;  1XMO E;  5KL7 A;  2RSM A;  2DB2 A;  5TSE A;  1RMD A;  1RQ0 A;  2HJJ A;  5A6J A;  5IXM B;  2UUA E;  1X6E A;  2V88 A;  4DR6 E;  2F8B A;  3LLH A;  1NCS A;  4ZYH A;  4F9B B;  4DR4 E;  4RHB B;  5FLX C;  4LTY A;  5IT9 C;  3J7Y p;  2DMI A;  2L2K B;  1JK2 A;  2DGC A;  3AV0 A;  2HC5 A;  4RH8 A;  1ZR9 A;  2EE8 A;  2BBG A;  1N32 E;  2RS6 A;  1ZBQ A;  2M9A A;  2YTO A;  3KWR A;  4IJD A;  2VE7 C;  1X6F A;  2DSY A;  4NXN E;  3HXL A;  2YZT A;  3BF2 A;  2ELY A;  4ZYG A;  2K7I A;  5AE1 A;  4R2E A;  2EN7 A;  1GTK A;  1YUI A;  2EPN A;  5KL2 A;  5KL5 A;  2EM4 A;  1T4L B;  2JYA A;  3UK3 C;  4Q35 B;  4X64 E;  3OML A;  3F6H A;  4F9C B;  5AE2 A;  4DV1 E;  2E72 A;  2V86 A;  4L8N A;  4P78 A;  4R2A A;  5A6B D;  2EN4 A;  2F4V E;  2YWQ A;  2Q8U A;  3T1Y E;  2UUC E;  3EPL A;  5A2Q C;  2N3H A;  4DR1 E;  1F2I G;  2EM8 A;  2VRD A;  4DR7 E;  3BGH A;  3HPS A;  2GPI A;  4AQY E;  2N3G A;  2L92 A;  5AAS A;  4WX9 A;  4JYA E;  3DF6 A;  2EP3 A;  4FK5 C;  2MC6 A;  5KL3 A;  2LTR A;  2YTG A;  3C4B A;  3RMP A;  2RSI A;  3VHT B;  2WCC 3;  1X6H A;  4GKK E;  1N36 E;  2EMA A;  1FJG E;  5KL4 A;  4DV5 E;  2FTX B;  2UU9 E;  1TF6 A;  2YRK A;  2RS7 A;  1PJS A;  4BS9 A;  2VQE E;  1BB8 A;  2YTQ A;  3OTO E;  4LFB E;  1A1L A;  4JI1 E;  2EM7 A;  2L6M A;  2KOU A;  1Z1B A;  3QG5 C;  1HNZ E;  3JU0 A;  2M4I A;  1KJK A;  4BMJ A;  2LV2 A;  1N3G A;  2ENA A;  2YSP A;  4JI6 E;  2NA2 A;  1ZU1 A;  3J7A G;  4GEQ B;  1XMQ E;  1XNQ E;  4DR3 E;  2DMY A;  2JOB A;  2JP9 A;  2YTJ A;  2LMZ A;  1NEI A;  4JI5 E;  2EMZ A;  2WZO A;  2FV4 B;  1X5W A;  1A1H A;  2EQ1 A;  2EN1 A;  1MGT A;  3EPK A;  5AC4 A;  1YUJ A;  5IWA E;  1A1G A;  1YYK A;  1T38 A;  1UHZ A;  2ODR C;  4I8O A;  1TN9 A;  1ZBT A;  4JI0 E;  1EH7 A;  4BHB A;  3BBG A;  2PRT A;  2GLI A;  4YY3 E;  4Q28 A;  2EPO A;  4DR5 E;  4JI4 E;  2UXD E;  4LFC E;  2HGH A;  2EL4 A;  2YTF A;  2MKN A;  1N34 E;  4JI8 E;  1PJQ A;  1A1J A;  1IMU A;  4R2Q A;  4R03 A;  4WSG A;  2EOR A;  2NUG A;  1DQ3 A;  1YFH A;  2J7J A;  4X9J A;  4X8W A;  2A25 A;  2R1F A;  1G2D C;  2YTP A;  2R76 A;  1IQO A;  1WRJ A;  2DRP A;  1AH5 A;  3VYX A;  2YRM A;  2EOM A;  3ECR A;  1AAY A;  4N4R B;  1B69 A;  4LF8 E;  2EPX A;  2EL6 A;  4KZS A;  2E5L E;  3P1X A;  2M1S A;  3L00 A;  1X3C A;  2YTN A;  4WXD A;  4NXM E;  4ZYD A;  4DV2 E;  2LTS A;  1DI2 A;  2EM9 A;  3ADL A;  3IWD A;  1KYQ A;  2EPZ A;  2UXB E;  2EPK X;  2V85 A;  5T6J A;  2DIX A;  4HEI A;  2NUF A;  5AE3 A;  4LFA E;  3ADI A;  4MLQ A;  2EQ3 A;  2EOI A;  2EMH A;  2JVA A;  4NHR A;  1GQE A;  2JY9 A;  2EOH A;  2EOS A;  4B3T E;  2EML A;  2YSO A;  2GHF A;  2LJU A;  2LUQ A;  3ZOQ B;  2WBS A;  2EPA A;  2EPU A;  2EOY A;  1PKP A;  2B7T A;  2DLK A;  2LJH A;  2YTI A;  2EPP A;  1BBG A;  1G2F C;  3VK6 A;  4M0V A;  5A6A A;  2YRH A;  4DV3 E;  3HTX A;  2EOO A;  2IHR 1;  4DUZ E;  2EMG A;  4LF6 E;  4L5N C;  2EM3 A;  4R8O A;  2LO3 A;  3JAM C;  2EMW A;  2CTD A;  4GZN C;  2ELZ A;  3MHS C;  2EN2 A;  2YTE A;  1A1I A;  5KL6 A;  1LLM C;  3IWC A;  2DLQ A;  1PDA A;  1X48 A;  2BB8 A;  2L2M A;  2YU5 A;  4B3M E;  4DMI A;  2WBT A;  4LF7 E;  2YT4 A;  4F54 A; 
#chains in the Genus database with same CATH homology
 4DV0 E;  4X64 E;  3J81 C;  2CPN A;  3OML A;  3F6H A;  4WSP A;  3F6G A;  4X62 E;  2B7V A;  4F9C B;  5AE2 A;  4DR5 E;  4JI4 E;  2JOX A;  4LFC E;  3H09 A;  4DV1 E;  1YYO A;  2V86 A;  4L8N A;  1RC7 A;  4P78 A;  1HR0 E;  1N34 E;  4LU9 A;  4JI8 E;  2F4V E;  1IBM E;  1X49 A;  3VYY A;  1J26 A;  3T1Y E;  4R03 A;  2UUC E;  5A2Q C;  2JR1 A;  2N3H A;  4F9A B;  1X47 A;  4DR1 E;  2NUG A;  2LUP B;  3ADJ A;  1DQ3 A;  4M2Z A;  4DR7 E;  1T4O A;  1WXR A;  5DNY A;  3HPS A;  4X8W A;  4AQY E;  1HNX E;  4WPY A;  4JI3 E;  2N3G A;  4OX9 E;  3FIG A;  2L92 A;  5AAS A;  4JYA E;  4DUY E;  2HHH E;  3VYX A;  2RTX A;  3DF6 A;  5LMN E;  1FKA E;  4B3R E;  4K0K E;  4OOG C;  3MSW A;  2MC5 A;  2V89 A;  4JI7 E;  4GKJ E;  2FGG A;  2MC6 A;  2K4V A;  2L8T A;  4BC9 A;  4BBY A;  2LTR A;  3C4B A;  4KZS A;  4YHH E;  3RMP A;  3T1H E;  2E5L E;  2KON A;  3P1X A;  4JI2 E;  2M1S A;  1YZ9 A;  4DV7 E;  3K6Q A;  4GKK E;  3JTZ A;  5CFF E;  5LL6 R;  1N36 E;  4NXM E;  1O0W A;  4DV2 E;  2LTS A;  2V83 A;  1FJG E;  4JV5 E;  2E1M A;  3DJW A;  4DV5 E;  1DI2 A;  2FTX B;  2UU9 E;  4LF8 E;  3HQ1 A;  4BC7 A;  2UUB E;  3ADL A;  2UXD E;  1IBL E;  2UXC E;  2M7Q A;  2RS7 A;  3IWD A;  4BS9 A;  2VQE E;  5LMU E;  2UXB E;  4BCA A;  2LBS B;  1WHN A;  2V85 A;  2L33 A;  3OTO E;  4LFB E;  2B9D A;  4LF5 E;  2G7H A;  4B3S E;  1SR9 A;  5T6J A;  2DIX A;  4X66 E;  1J5E E;  5BR8 E;  4JI1 E;  2NUF A;  5AE3 A;  2L6M A;  2KOU A;  1HNZ E;  4LFA E;  3ADI A;  3JU0 A;  2M4I A;  4P7D A;  2ODR D;  3HPZ A;  4DKK A;  3LML A;  1UIL A;  2ZM6 E;  4DV4 E;  1XNR E;  1N33 E;  2JVA A;  3C4T A;  1GZ6 A;  1GQE A;  4BMJ A;  1WHQ A;  2JY9 A;  4TUI A;  2H36 X;  2EWL A;  2B3T B;  4WFT A;  4X65 E;  2L3J A;  2L2N A;  1XMO E;  4LF9 E;  4B3T E;  2RSM A;  2DB2 A;  4M30 A;  4JI6 E;  1RQ0 A;  2NA2 A;  2V8Q B;  2KHX A;  2UUA E;  2LUQ A;  3ZOQ B;  3J7A G;  2V88 A;  4GEQ B;  4DR6 E;  2NUE A;  2F8B A;  1XMQ E;  1PKP A;  2B7T A;  2LJH A;  3AUZ A;  3LLH A;  1XNQ E;  3J80 C;  4DR3 E;  2DMY A;  1YYW A;  1T4N A;  2JOB A;  3VK6 A;  4M0V A;  4F9B B;  2EZ6 A;  5FLX C;  4DR4 E;  4LTY A;  5IT9 C;  2VF1 A;  2LMZ A;  3J7Y p;  2L2K B;  3AV0 A;  4J8Z A;  3IWB A;  5F3W A;  4LF4 E;  4JI5 E;  2LRS A;  4DV3 E;  1EKZ A;  3HTX A;  1N32 E;  2IHR 1;  4DUZ E;  2WZO A;  1HNW E;  2FV4 B;  2MDR A;  4DR2 E;  1IBK E;  4LF6 E;  2RS6 A;  1ZBQ A;  4L5N C;  4R8O A;  3KWR A;  3JAM C;  2L3C A;  4WYQ B;  1QU6 A;  2VE7 C;  2JWO A;  2VQF E;  2DSY A;  1STU A;  5IWA E;  4NXN E;  4TUG A;  3HXL A;  2YZT A;  1YYK A;  4KHP E;  1UHZ A;  2ODR C;  3ADG A;  3IWC A;  1X48 A;  4I8O A;  1ZBT A;  2LE2 A;  2L2M A;  5AE1 A;  4JI0 E;  4B3M E;  4DMI A;  5ADZ A;  2V87 A;  4LF7 E;  2YT4 A;  1I94 E;  4DV6 E;  1T4L B;  4YY3 E;  4Q28 A;  4F54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...