3IWCA

T. maritima adometdc complex with s-adenosylmethionine methyl ester
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
58
Chain Sequence
HLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEIGIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords S-adenosylmethionine decarboxylase
publication title Complexes of Thermotoga maritimaS-adenosylmethionine decarboxylase provide insights into substrate specificity.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 8
structure length 58
sequence length 58
chains with identical sequence C
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.750 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3iwcA00
3IWBA 3IWCA 3IWDA
chains in the Genus database with same CATH superfamily
2EOHA 2LJUA 2VQEE 1ZAAC 2VF1A 3HTXA 2V86A 3VYXA 1T39A 3HQ1A 2EM5A 3ADJA 3MSWA 2B7VA 3H09A 1A1FA 3IWDA 2EZ6A 3HXLA 2EM0A 4R2DA 2KONA 4WSPA 4F9AB 5AE3A 4X65E 3VYYA 1T4NA 4R8OA 1KYQA 4DKKA 4R2PA 2F4VE 2EPUA 5FLXC 2EPPA 4DV3E 2JOBA 2JWOA 1P47A 4HTGA 1YZ9A 2UUBE 2M9AA 1BB8A 2D9HA 3AUZA 4JYAE 2YTQA 2V88A 3ADGA 4DV1E 1SFEA 2UUAE 4JI6E 2JR1A 2EN3A 2LTRA 4L8NA 2YTGA 2MDRA 3EPJA 2EOZA 3KZZA 2EOJA 2DGCA 2EOEA 1WHNA 3M99B 2V8QB 4WXDA 2EWLA 4IS1C 2LT7A 1L4SA 2HJJA 5A69A 4LF9E 2L3CA 4DR5E 2WBTA 2EMXA 2LJHA 5LMUE 4BBYA 1WJPA 1Z1BA 3ECRA 4WXCA 3J81C 4JI2E 2EOOA 4BC7A 4R2RA 4BCAA 2LBSB 4LFCE 2UUCE 4R2AA 2DB2A 2IHR1 2DLKA 2V89A 1IBKE 1YYKA 1ZBQA 4JI4E 1IQOA 2ELZA 1GTKA 2EMFA 2EPAA 1PDAA 2DIXA 1KJKA 1PJQA 5LLQA 2EE8A 5T6JA 2VQFE 2I9IA 2UXDE 2GHFA 4DV4E 1EH7A 2YSPA 3MHHC 4F6MA 4OOGC 4LF8E 2RS6A 4AQYE 2PRTA 1A1GA 1UILA 2WCC3 2HHHE 4X64E 3MHSC 2EMIA 2EP3A 5A6BA 2EMBA 2DSYA 3UK3C 1IBLE 2YTFA 1I94E 4OX9E 2EM4A 3IWCA 2EMKA 2EMGA 5A6JA 1G2DC 4X66E 1YSAC 4RH8A 3EPHA 1G2FC 3F6GA 2EN8A 4JV5E 1XNQE 2EPOA 2EMLA 4R03A 2EOQA 2ODRC 5A2QC 5A6BD 5LMNE 1GQEA 4DR4E 2JY9A 2L2NA 2CT1A 4WYQB 2UXCE 2ELYA 3T1YE 1NCSA 2MDGA 5KL2A 2L2KB 2EM9A 2E1MA 4JI8E 3J7AG 2NUFA 4BHCA 1XNRE 1J26A 2EN7A 5TSEA 3TQMA 1STUA 3C6KA 2EN4A 2JVAA 1PKPA 2G7HA 1EH6A 2EQ0A 1O0WA 5IWAE 2ODRD 2FTXB 2KHXA 2LVHA 1JK2A 1IQSA 1ZU1A 1HNXE 3T1HE 2J7JA 2YTOA 5IT9C 4NXNE 2EL4A 2UU9E 3AV0A 1RMDA 2EOFA 4GZNC 3K6QA 1J5EE 2RQLA 1FKAE 5KL6A 1MGTA 2ADRA 2LUQA 5AC5A 2YTIA 2GLIA 2YTDA 2ENHA 3THNA 1HNWE 4KZSA 4BMJA 1T4OA 2JPAA 2YRKA 1YUJA 4Q35B 4X62E 2WBSA 1TF6A 2V87A 2NUEA 2EOMA 2LTSA 2EN1A 4DUZE 1YFHA 2R76A 2EQ1A 1XMQE 1AH5A 2MKDA 4WPYA 4DR1E 5KL3A 4LU9A 5DNYA 5CFFE 4B3TE 2EPCA 3HPSA 1NEIA 2YTEA 1DGCA 2B3TB 2EOYA 2H36X 4F9CB 4MLQA 4DV6E 2FV4B 1X6FA 5AE2A 2YTPA 4DR2E 2EORA 4DMIA 2R1FA 4P78A 2LO3A 2YWQA 4O4KA 3BBGA 1LLMC 1N34E 2EMZA 2ENAA 2K4VA 2MC5A 5A6KA 2NABA 4R2CA 2M7QA 2I13A 3EPLA 1GZ6A 5BR8E 2YU8A 5IXMB 4DV0E 2CPNA 2L3JA 2DMIA 2F8BA 4LF5E 3EPKA 2YTNA 1B69A 5AASA 3DF6A 3C6MA 3OMLA 4GKJE 1PJSA 1X49A 1X48A 4BHBA 3BIDA 5KL7A 4KWYA 2E72A 1QNTA 4N4RB 2GPIA 2DMYA 5IV8B 1TF3A 3LLHA 5ADZA 2N3GA 2EM7A 4F2JC 4BS9A 2EJ4A 1UN6B 2ENCA 5KL5A 1JK1A 3OTOE 1IBME 4X8WA 2HC5A 4B3RE 1F2IG 4LF7E 4M2ZA 3THOB 2V83A 4O43A 4GKKE 1EH8A 2YT4A 4YY3E 2M1SA 1IMUA 2YRHA 2LV2A 1PJTA 2EPNA 1N3GA 3VHTB 1YYOA 2FGGA 1DI2A 3JTZA 4K0KE 5F3WA 2MKNA 1X47A 2V85A 1YYWA 2WBUA 2L2MA 3F6HA 2DLQA 2L92A 1ZBTA 2YPNA 2NA2A 2VRDA 1A1JA 1YPNA 4DV7E 1YUIA 3LMLA 2N3HA 4F6NA 4L5NC 2EM8A 2EPKX 2RS7A 1WXRA 1XMOE 4O24A 4DV2E 1A1LA 1X6EA 2LRSA 4J8ZA 3BGHA 1HNZE 5AE1A 2WZOA 4MLVA 1X5WA 2CSHA 2CTDA 2EPMX 2RTXA 1UBDC 2MC6A 2VE7C 1T4LB 2JYAA 4BC9A 2EPXA 4B3SE 4LFBE 4I8OA 4YHHE 1N33E 3BF2A 1AAYA 3QG5C 2JOXA 2HGHA 4P7DA 4R2QA 4M0VA 1RQ0A 3IWBA 4JI0E 3JU0A 3JAMC 4TUIA 1A1IA 4NHRA 2EMWA 2DRPA 3KWRA 3ADIA 2KOUA 3C4BA 2EMYA 4HEIA 5LL6R 4JI5E 2EN2A 2NUGA 4ZYHA 4IJDA 4F54A 4X9JA 4B3ME 1RC7A 2EQ3A 2LMZA 5A6AA 2M4IA 4FK5C 2ZM6E 5AC4A 2EN6A 1X6HA 2EMHA 4O5GA 1T38A 4DR6E 4RHBB 2EOSA 4ZYEA 3FIGA 1N36E 2K7IA 2EPRA 2N8XA 4NXME 2EOXA 4JI7E 1N32E 2B7TA 2YU5A 3VK6A 2EM2A 3KZYA 4NZVA 4ZYGA 3EQ1A 3C4TA 1FJGE 2UXBE 2EPZA 3ZOQB 4R2SA 4LF4E 4DV5E 2BBGA 2BB8A 2EOIA 3P1XA 4R2EA 1BBOA 2RPCA 1EKZA 3J7Yp 4JI3E 2L6MA 1TN9A 2LCEA 2EM6A 4M9VC 4LTYA 2E5LE 2LUPB 4LF6E 1ZR9A 2EL5A 2L33A 4M30A 2RSIA 2YTJA 2L8TA 3HPZA 2EPLX 2EMCA 2JXPA 4WX9A 3DJWA 4WSGA 1QU6A 5KL4A 4WFTA 2JP9A 2YRMA 4DR3E 2YZTA 1SR9A 3ADLA 4GEQB 2YSOA 1MEYC 1DQ3A 2Q8UA 1HR0E 2EL6A 3J80C 4TUGA 3L00A 1WHQA 4DUYE 4Q28A 4LFAE 4JI1E 1A1HA 2A25A 1WRJA 1UHZA 2EM3A 2EMAA 4F9BB 4KHPE 4DR7E 1BBGA 2B9DA 1A1KA 2LE2A 3RMPA 4ZYDA 1X3CA 2RSMA
chains in the Genus database with same CATH topology
2CPNA 2NUGA 2L3JA 4LF5E 2F8BA 4JV5E 4F54A 2VQEE 2VF1A 3HTXA 2V86A 1XNQE 3VYXA 3HQ1A 3ADJA 3MSWA 4B3ME 4R03A 2B7VA 3H09A 1RC7A 2LMZA 2ODRC 3IWDA 5A2QC 5AASA 2EZ6A 3DF6A 5LMNE 1GQEA 3OMLA 4DR4E 2JY9A 4GKJE 2L2NA 4WYQB 1X49A 1X48A 3HXLA 2UXCE 2M4IA 2ZM6E 3T1YE 2KONA 4WSPA 4F9AB 5AE3A 4X65E 3VYYA 1T4NA 4R8OA 2L2KB 4JI5E 2E1MA 4JI8E 4DKKA 2NUFA 2DMYA 3J7AG 4DR6E 2F4VE 3FIGA 5FLXC 1XNRE 1J26A 4DV3E 1N36E 2JOBA 2JWOA 1STUA 4NXME 4JI7E 2JVAA 1PKPA 3LLHA 1N32E 2B7TA 2G7HA 5ADZA 1YZ9A 2UUBE 2N3GA 1O0WA 3VK6A 5IWAE 4BS9A 4B3RE 2ODRD 2FTXB 3AUZA 3C4TA 4JYAE 1FJGE 2KHXA 2UXBE 2V88A 3ADGA 4DV1E 2UUAE 3ZOQB 1HNXE 4JI6E 2JR1A 3T1HE 4NXNE 3OTOE 5IT9C 4X8WA 1IBME 3AV0A 2LTRA 4DV5E 4L8NA 2UU9E 4LF4E 4LF7E 4M2ZA 2MDRA 3K6QA 2V83A 4GKKE 3P1XA 2YT4A 1J5EE 4YY3E 1WHNA 2V8QB 1EKZA 2EWLA 2M1SA 1FKAE 3J7Yp 4JI3E 4LF9E 5BR8E 2L3CA 4DR5E 2L6MA 2LUQA 2LJHA 5LMUE 1YYOA 4BBYA 2FGGA 4LTYA 3J81C 4JI2E 1DI2A 4BC7A 3JTZA 4BCAA 2LBSB 5F3WA 2E5LE 4LFCE 4K0KE 1X47A 2LUPB 2V85A 2UUCE 4LF6E 1YYWA 2DB2A 2IHR1 2L2MA 2L33A 2V89A 3F6HA 2L92A 1ZBTA 1IBKE 1YYKA 1ZBQA 2NA2A 4M30A 4JI4E 4KZSA 1HNWE 4DV7E 4BMJA 1T4OA 2L8TA 3HPZA 3LMLA 4X62E 2N3HA 4L5NC 2V87A 2DIXA 3DJWA 2NUEA 1QU6A 2LTSA 5T6JA 2VQFE 2RS7A 4WFTA 4DUZE 1WXRA 2UXDE 1XMOE 4DV2E 2LRSA 4DV4E 2YZTA 4DR3E 1SR9A 4J8ZA 1XMQE 1HNZE 3ADLA 5AE1A 4WPYA 4DR1E 2WZOA 4OOGC 4LF8E 4GEQB 4LU9A 2RS6A 5DNYA 5CFFE 4AQYE 2RTXA 1DQ3A 2MC6A 1HR0E 4B3TE 3HPSA 2VE7C 1UILA 1T4LB 3J80C 4TUGA 2B3TB 4BC9A 2HHHE 2H36X 3F6GA 4F9CB 4X64E 4B3SE 1WHQA 4LFBE 4I8OA 4YHHE 2FV4B 5AE2A 4Q28A 4DUYE 4DV6E 4DR2E 4LFAE 2DSYA 1N33E 4JI1E 1IBLE 4DMIA 1I94E 4OX9E 4P78A 2JOXA 3IWCA 4P7DA 4M0VA 1RQ0A 1UHZA 3IWBA 1N34E 4JI0E 3JU0A 3JAMC 4TUIA 2K4VA 2MC5A 4F9BB 4KHPE 4X66E 4DR7E 2B9DA 2M7QA 3KWRA 3ADIA 2KOUA 2LE2A 3C4BA 3RMPA 1GZ6A 5LL6R 4DV0E 2RSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWB A;  3IWC A;  3IWD A; 
#chains in the Genus database with same CATH topology
 2EOH A;  2LJU A;  2VQE E;  1ZAA C;  2VF1 A;  3HTX A;  2V86 A;  3VYX A;  1T39 A;  3HQ1 A;  2EM5 A;  3ADJ A;  3MSW A;  2B7V A;  3H09 A;  1A1F A;  3IWD A;  2EZ6 A;  3HXL A;  2EM0 A;  4R2D A;  2KON A;  4WSP A;  4F9A B;  5AE3 A;  4X65 E;  3VYY A;  1T4N A;  4R8O A;  1KYQ A;  4DKK A;  4R2P A;  2F4V E;  2EPU A;  5FLX C;  2EPP A;  4DV3 E;  2JOB A;  2JWO A;  1P47 A;  4HTG A;  1YZ9 A;  2UUB E;  2M9A A;  1BB8 A;  2D9H A;  3AUZ A;  4JYA E;  2YTQ A;  2V88 A;  3ADG A;  4DV1 E;  1SFE A;  2UUA E;  4JI6 E;  2JR1 A;  2EN3 A;  2LTR A;  4L8N A;  2YTG A;  2MDR A;  3EPJ A;  2EOZ A;  3KZZ A;  2EOJ A;  2DGC A;  2EOE A;  1WHN A;  3M99 B;  2V8Q B;  4WXD A;  2EWL A;  4IS1 C;  2LT7 A;  1L4S A;  2HJJ A;  5A69 A;  4LF9 E;  2L3C A;  4DR5 E;  2WBT A;  2EMX A;  2LJH A;  5LMU E;  4BBY A;  1WJP A;  1Z1B A;  3ECR A;  4WXC A;  3J81 C;  4JI2 E;  2EOO A;  4BC7 A;  4R2R A;  4BCA A;  2LBS B;  4LFC E;  2UUC E;  4R2A A;  2DB2 A;  2IHR 1;  2DLK A;  2V89 A;  1IBK E;  1YYK A;  1ZBQ A;  4JI4 E;  1IQO A;  2ELZ A;  1GTK A;  2EMF A;  2EPA A;  1PDA A;  2DIX A;  1KJK A;  1PJQ A;  5LLQ A;  2EE8 A;  5T6J A;  2VQF E;  2I9I A;  2UXD E;  2GHF A;  4DV4 E;  1EH7 A;  2YSP A;  3MHH C;  4F6M A;  4OOG C;  4LF8 E;  2RS6 A;  4AQY E;  2PRT A;  1A1G A;  1UIL A;  2WCC 3;  2HHH E;  4X64 E;  3MHS C;  2EMI A;  2EP3 A;  5A6B A;  2EMB A;  2DSY A;  3UK3 C;  1IBL E;  2YTF A;  1I94 E;  4OX9 E;  2EM4 A;  3IWC A;  2EMK A;  2EMG A;  5A6J A;  1G2D C;  4X66 E;  1YSA C;  4RH8 A;  3EPH A;  1G2F C;  3F6G A;  2EN8 A;  4JV5 E;  1XNQ E;  2EPO A;  2EML A;  4R03 A;  2EOQ A;  2ODR C;  5A2Q C;  5A6B D;  5LMN E;  1GQE A;  4DR4 E;  2JY9 A;  2L2N A;  2CT1 A;  4WYQ B;  2UXC E;  2ELY A;  3T1Y E;  1NCS A;  2MDG A;  5KL2 A;  2L2K B;  2EM9 A;  2E1M A;  4JI8 E;  3J7A G;  2NUF A;  4BHC A;  1XNR E;  1J26 A;  2EN7 A;  5TSE A;  3TQM A;  1STU A;  3C6K A;  2EN4 A;  2JVA A;  1PKP A;  2G7H A;  1EH6 A;  2EQ0 A;  1O0W A;  5IWA E;  2ODR D;  2FTX B;  2KHX A;  2LVH A;  1JK2 A;  1IQS A;  1ZU1 A;  1HNX E;  3T1H E;  2J7J A;  2YTO A;  5IT9 C;  4NXN E;  2EL4 A;  2UU9 E;  3AV0 A;  1RMD A;  2EOF A;  4GZN C;  3K6Q A;  1J5E E;  2RQL A;  1FKA E;  5KL6 A;  1MGT A;  2ADR A;  2LUQ A;  5AC5 A;  2YTI A;  2GLI A;  2YTD A;  2ENH A;  3THN A;  1HNW E;  4KZS A;  4BMJ A;  1T4O A;  2JPA A;  2YRK A;  1YUJ A;  4Q35 B;  4X62 E;  2WBS A;  1TF6 A;  2V87 A;  2NUE A;  2EOM A;  2LTS A;  2EN1 A;  4DUZ E;  1YFH A;  2R76 A;  2EQ1 A;  1XMQ E;  1AH5 A;  2MKD A;  4WPY A;  4DR1 E;  5KL3 A;  4LU9 A;  5DNY A;  5CFF E;  4B3T E;  2EPC A;  3HPS A;  1NEI A;  2YTE A;  1DGC A;  2B3T B;  2EOY A;  2H36 X;  4F9C B;  4MLQ A;  4DV6 E;  2FV4 B;  1X6F A;  5AE2 A;  2YTP A;  4DR2 E;  2EOR A;  4DMI A;  2R1F A;  4P78 A;  2LO3 A;  2YWQ A;  4O4K A;  3BBG A;  1LLM C;  1N34 E;  2EMZ A;  2ENA A;  2K4V A;  2MC5 A;  5A6K A;  2NAB A;  4R2C A;  2M7Q A;  2I13 A;  3EPL A;  1GZ6 A;  5BR8 E;  2YU8 A;  5IXM B;  4DV0 E;  2CPN A;  2L3J A;  2DMI A;  2F8B A;  4LF5 E;  3EPK A;  2YTN A;  1B69 A;  5AAS A;  3DF6 A;  3C6M A;  3OML A;  4GKJ E;  1PJS A;  1X49 A;  1X48 A;  4BHB A;  3BID A;  5KL7 A;  4KWY A;  2E72 A;  1QNT A;  4N4R B;  2GPI A;  2DMY A;  5IV8 B;  1TF3 A;  3LLH A;  5ADZ A;  2N3G A;  2EM7 A;  4F2J C;  4BS9 A;  2EJ4 A;  1UN6 B;  2ENC A;  5KL5 A;  1JK1 A;  3OTO E;  1IBM E;  4X8W A;  2HC5 A;  4B3R E;  1F2I G;  4LF7 E;  4M2Z A;  3THO B;  2V83 A;  4O43 A;  4GKK E;  1EH8 A;  2YT4 A;  4YY3 E;  2M1S A;  1IMU A;  2YRH A;  2LV2 A;  1PJT A;  2EPN A;  1N3G A;  3VHT B;  1YYO A;  2FGG A;  1DI2 A;  3JTZ A;  4K0K E;  5F3W A;  2MKN A;  1X47 A;  2V85 A;  1YYW A;  2WBU A;  2L2M A;  3F6H A;  2DLQ A;  2L92 A;  1ZBT A;  2YPN A;  2NA2 A;  2VRD A;  1A1J A;  1YPN A;  4DV7 E;  1YUI A;  3LML A;  2N3H A;  4F6N A;  4L5N C;  2EM8 A;  2EPK X;  2RS7 A;  1WXR A;  1XMO E;  4O24 A;  4DV2 E;  1A1L A;  1X6E A;  2LRS A;  4J8Z A;  3BGH A;  1HNZ E;  5AE1 A;  2WZO A;  4MLV A;  1X5W A;  2CSH A;  2CTD A;  2EPM X;  2RTX A;  1UBD C;  2MC6 A;  2VE7 C;  1T4L B;  2JYA A;  4BC9 A;  2EPX A;  4B3S E;  4LFB E;  4I8O A;  4YHH E;  1N33 E;  3BF2 A;  1AAY A;  3QG5 C;  2JOX A;  2HGH A;  4P7D A;  4R2Q A;  4M0V A;  1RQ0 A;  3IWB A;  4JI0 E;  3JU0 A;  3JAM C;  4TUI A;  1A1I A;  4NHR A;  2EMW A;  2DRP A;  3KWR A;  3ADI A;  2KOU A;  3C4B A;  2EMY A;  4HEI A;  5LL6 R;  4JI5 E;  2EN2 A;  2NUG A;  4ZYH A;  4IJD A;  4F54 A;  4X9J A;  4B3M E;  1RC7 A;  2EQ3 A;  2LMZ A;  5A6A A;  2M4I A;  4FK5 C;  2ZM6 E;  5AC4 A;  2EN6 A;  1X6H A;  2EMH A;  4O5G A;  1T38 A;  4DR6 E;  4RHB B;  2EOS A;  4ZYE A;  3FIG A;  1N36 E;  2K7I A;  2EPR A;  2N8X A;  4NXM E;  2EOX A;  4JI7 E;  1N32 E;  2B7T A;  2YU5 A;  3VK6 A;  2EM2 A;  3KZY A;  4NZV A;  4ZYG A;  3EQ1 A;  3C4T A;  1FJG E;  2UXB E;  2EPZ A;  3ZOQ B;  4R2S A;  4LF4 E;  4DV5 E;  2BBG A;  2BB8 A;  2EOI A;  3P1X A;  4R2E A;  1BBO A;  2RPC A;  1EKZ A;  3J7Y p;  4JI3 E;  2L6M A;  1TN9 A;  2LCE A;  2EM6 A;  4M9V C;  4LTY A;  2E5L E;  2LUP B;  4LF6 E;  1ZR9 A;  2EL5 A;  2L33 A;  4M30 A;  2RSI A;  2YTJ A;  2L8T A;  3HPZ A;  2EPL X;  2EMC A;  2JXP A;  4WX9 A;  3DJW A;  4WSG A;  1QU6 A;  5KL4 A;  4WFT A;  2JP9 A;  2YRM A;  4DR3 E;  2YZT A;  1SR9 A;  3ADL A;  4GEQ B;  2YSO A;  1MEY C;  1DQ3 A;  2Q8U A;  1HR0 E;  2EL6 A;  3J80 C;  4TUG A;  3L00 A;  1WHQ A;  4DUY E;  4Q28 A;  4LFA E;  4JI1 E;  1A1H A;  2A25 A;  1WRJ A;  1UHZ A;  2EM3 A;  2EMA A;  4F9B B;  4KHP E;  4DR7 E;  1BBG A;  2B9D A;  1A1K A;  2LE2 A;  3RMP A;  4ZYD A;  1X3C A;  2RSM A; 
#chains in the Genus database with same CATH homology
 2CPN A;  2NUG A;  2L3J A;  4LF5 E;  2F8B A;  4JV5 E;  4F54 A;  2VQE E;  2VF1 A;  3HTX A;  2V86 A;  1XNQ E;  3VYX A;  3HQ1 A;  3ADJ A;  3MSW A;  4B3M E;  4R03 A;  2B7V A;  3H09 A;  1RC7 A;  2LMZ A;  2ODR C;  3IWD A;  5A2Q C;  5AAS A;  2EZ6 A;  3DF6 A;  5LMN E;  1GQE A;  3OML A;  4DR4 E;  2JY9 A;  4GKJ E;  2L2N A;  4WYQ B;  1X49 A;  1X48 A;  3HXL A;  2UXC E;  2M4I A;  2ZM6 E;  3T1Y E;  2KON A;  4WSP A;  4F9A B;  5AE3 A;  4X65 E;  3VYY A;  1T4N A;  4R8O A;  2L2K B;  4JI5 E;  2E1M A;  4JI8 E;  4DKK A;  2NUF A;  2DMY A;  3J7A G;  4DR6 E;  2F4V E;  3FIG A;  5FLX C;  1XNR E;  1J26 A;  4DV3 E;  1N36 E;  2JOB A;  2JWO A;  1STU A;  4NXM E;  4JI7 E;  2JVA A;  1PKP A;  3LLH A;  1N32 E;  2B7T A;  2G7H A;  5ADZ A;  1YZ9 A;  2UUB E;  2N3G A;  1O0W A;  3VK6 A;  5IWA E;  4BS9 A;  4B3R E;  2ODR D;  2FTX B;  3AUZ A;  3C4T A;  4JYA E;  1FJG E;  2KHX A;  2UXB E;  2V88 A;  3ADG A;  4DV1 E;  2UUA E;  3ZOQ B;  1HNX E;  4JI6 E;  2JR1 A;  3T1H E;  4NXN E;  3OTO E;  5IT9 C;  4X8W A;  1IBM E;  3AV0 A;  2LTR A;  4DV5 E;  4L8N A;  2UU9 E;  4LF4 E;  4LF7 E;  4M2Z A;  2MDR A;  3K6Q A;  2V83 A;  4GKK E;  3P1X A;  2YT4 A;  1J5E E;  4YY3 E;  1WHN A;  2V8Q B;  1EKZ A;  2EWL A;  2M1S A;  1FKA E;  3J7Y p;  4JI3 E;  4LF9 E;  5BR8 E;  2L3C A;  4DR5 E;  2L6M A;  2LUQ A;  2LJH A;  5LMU E;  1YYO A;  4BBY A;  2FGG A;  4LTY A;  3J81 C;  4JI2 E;  1DI2 A;  4BC7 A;  3JTZ A;  4BCA A;  2LBS B;  5F3W A;  2E5L E;  4LFC E;  4K0K E;  1X47 A;  2LUP B;  2V85 A;  2UUC E;  4LF6 E;  1YYW A;  2DB2 A;  2IHR 1;  2L2M A;  2L33 A;  2V89 A;  3F6H A;  2L92 A;  1ZBT A;  1IBK E;  1YYK A;  1ZBQ A;  2NA2 A;  4M30 A;  4JI4 E;  4KZS A;  1HNW E;  4DV7 E;  4BMJ A;  1T4O A;  2L8T A;  3HPZ A;  3LML A;  4X62 E;  2N3H A;  4L5N C;  2V87 A;  2DIX A;  3DJW A;  2NUE A;  1QU6 A;  2LTS A;  5T6J A;  2VQF E;  2RS7 A;  4WFT A;  4DUZ E;  1WXR A;  2UXD E;  1XMO E;  4DV2 E;  2LRS A;  4DV4 E;  2YZT A;  4DR3 E;  1SR9 A;  4J8Z A;  1XMQ E;  1HNZ E;  3ADL A;  5AE1 A;  4WPY A;  4DR1 E;  2WZO A;  4OOG C;  4LF8 E;  4GEQ B;  4LU9 A;  2RS6 A;  5DNY A;  5CFF E;  4AQY E;  2RTX A;  1DQ3 A;  2MC6 A;  1HR0 E;  4B3T E;  3HPS A;  2VE7 C;  1UIL A;  1T4L B;  3J80 C;  4TUG A;  2B3T B;  4BC9 A;  2HHH E;  2H36 X;  3F6G A;  4F9C B;  4X64 E;  4B3S E;  1WHQ A;  4LFB E;  4I8O A;  4YHH E;  2FV4 B;  5AE2 A;  4Q28 A;  4DUY E;  4DV6 E;  4DR2 E;  4LFA E;  2DSY A;  1N33 E;  4JI1 E;  1IBL E;  4DMI A;  1I94 E;  4OX9 E;  4P78 A;  2JOX A;  3IWC A;  4P7D A;  4M0V A;  1RQ0 A;  1UHZ A;  3IWB A;  1N34 E;  4JI0 E;  3JU0 A;  3JAM C;  4TUI A;  2K4V A;  2MC5 A;  4F9B B;  4KHP E;  4X66 E;  4DR7 E;  2B9D A;  2M7Q A;  3KWR A;  3ADI A;  2KOU A;  2LE2 A;  3C4B A;  3RMP A;  1GZ6 A;  5LL6 R;  4DV0 E;  2RSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...