1WJPA

Solution structure of zf-c2h2 domains from human zinc finger protein 295
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
107
Chain Sequence
GSSGSSGASPVENKEVYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKCEYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMAPTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 295
publication title Solution structure of zf-C2H2 domains from human Zinc finger protein 295
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 18
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18450 zf_C2H2_6 Zinc Finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA02
2EOJA 2YTFA 2A25A 1RMDA 2EL5A 2EM3A 1YUJA 5KL7A 2YSPA 2DGCA 3MHSC 2R1FA 2EN2A 2EOFA 5KL4A 1G2FC 2EOZA 2EP3A 1BBOA 2MKNA 1UN6B 2EMCA 2WBUA 2EM0A 2EOOA 2EOHA 2EMHA 2HGHA 1A1LA 2WBTA 2YTEA 1A1KA 2EMIA 1X6FA 2ENCA 2JP9A 2YTDA 1F2IG 2YTOA 1A1HA 3MHHC 1X6EA 4FK5C 2EORA 2EE8A 2EOQA 1X5WA 1Z1BA 2EM9A 1B69A 2LCEA 3EPHA 2EN4A 1A1FA 2EMKA 2YU8A 2EM8A 2YRHA 4F2JC 1AAYA 2EQ1A 2DMIA 2EPCA 2LO3A 2DLKA 2ENHA 2EOMA 2YSOA 2EJ4A 4WSGA 2YRMA 4M9VC 2DRPA 2EPPA 1TF6A 2YU5A 2EMAA 2EPUA 3VHTB 1P47A 2YTGA 2YTIA 2YTPA 3EPLA 2LT7A 4GZNC 5KL6A 2EOIA 3M99B 2YRKA 1A1JA 4R2CA 1DGCA 2I13A 4R2QA 1NCSA 1ZU1A 2BB8A 2PRTA 2MDGA 3EPJA 2EOSA 4IJDA 1TF3A 2CSHA 2D9HA 2ELYA 2RPCA 5KL3A 1TN9A 1ZR9A 2EMFA 4F6MA 4R2RA 4R2EA 2EN8A 2EL4A 2EM2A 2EMYA 2EM4A 1UBDC 1G2DC 2GHFA 2EQ0A 5KL5A 2WBSA 1KJKA 2YTJA 2EOYA 2J7JA 4R2DA 2LVHA 1ZAAC 1WJPA 2LV2A 2YTNA 2M9AA 1LLMC 2EMLA 1JK2A 1X3CA 1A1IA 2ADRA 2CTDA 2EMBA 2WCC3 1YSAC 2EM6A 2EM7A 2EN6A 2EMXA 3EPKA 2EN1A 1A1GA 2NABA 1YUIA 1X6HA 2EQ3A 2EMZA 1JK1A 2EN3A 2ENAA 2EPRA 2DLQA 2E72A 2YTQA 3UK3C 2VRDA 2EMWA 2EPXA 4R2PA 2EN7A 2ELZA 2EOEA 2EL6A 1MEYC 2RSIA 4F6NA 2EMGA 4X9JA 4R2SA 2JPAA 4R2AA 2EPAA 2MKDA 5KL2A 2CT1A 2GLIA 2EPZA 1BB8A 2EOXA 2EM5A 4IS1C
chains in the Genus database with same CATH superfamily
5ADZA 5A6BD 1YYKA 1RMDA 1WXRA 1YUJA 1PJTA 4B3SE 2DGCA 2K4VA 1BBOA 4JI6E 1L4SA 1DQ3A 5IT9C 2RQLA 2VF1A 4LTYA 2HGHA 4Q35B 4DV0E 2EMIA 1AH5A 2VQEE 4F9CB 3MHHC 2JOBA 3KZZA 4B3ME 2HJJA 4M0VA 1X5WA 4LFBE 2EM9A 1B69A 1YZ9A 2V87A 2MDRA 3ECRA 5A6KA 1A1FA 2EMKA 2UUCE 2DB2A 2EM8A 3HXLA 4BC9A 3JU0A 2V88A 3ADIA 4Q28A 1ZBTA 2EOMA 3OMLA 4DR2E 4GEQB 2YRMA 3BIDA 4LU9A 2DRPA 2YU5A 2H36X 4LFCE 4LF5E 3DF6A 2UXBE 4DR3E 3BBGA 5KL6A 3M99B 4KHPE 3DJWA 2L3CA 4MLQA 5A2QC 3ADLA 1NCSA 1ZU1A 2MDGA 3EPJA 4IJDA 1YYOA 1TF3A 1ZR9A 2JXPA 4X8WA 4R2RA 4R2EA 1UBDC 4P7DA 4WYQB 5KL5A 2EPLX 1ZAAC 3FIGA 2B3TB 2M9AA 2DMYA 5BR8E 2F4VE 1JK2A 2NA2A 1X3CA 2WCC3 2EM6A 2FV4B 4JI0E 2EM7A 3EPKA 2EPMX 4X65E 1X6HA 4JI8E 4P78A 4ZYDA 1JK1A 4JI3E 2JYAA 2K7IA 2JVAA 2RS7A 2NUEA 4YHHE 2CPNA 2EPXA 4I8OA 2EL6A 2RSIA 4F6NA 2JPAA 2UXDE 4DKKA 2EM5A 2EOJA 2EPKX 5A69A 1XNRE 2JWOA 4RH8A 3VYYA 1FKAE 2YSPA 2EN2A 4DV3E 1IBKE 4JYAE 4DV5E 3P1XA 4DR6E 4K0KE 2MKNA 1XMOE 1UN6B 2WBUA 4DV4E 2LTRA 2HC5A 2V83A 1KYQA 1N33E 4GKJE 2EMHA 3T1HE 2L2KB 4X64E 1PDAA 1A1KA 1X6FA 1N34E 4JI7E 3OTOE 2YTOA 1EH7A 2M4IA 5IXMB 4FK5C 2EPNA 4NXME 2EE8A 4DV2E 4N4RB 5AC5A 1Z1BA 2EN4A 2YRHA 1BBGA 2EQ1A 4BMJA 2EPCA 1GQEA 2L33A 3THNA 2B7VA 5CFFE 2HHHE 2L8TA 4WX9A 2EJ4A 4O24A 2RTXA 2L6MA 1T38A 1O0WA 1EH6A 1DI2A 2M7QA 3HPZA 2YTPA 2WZOA 1I94E 2YPNA 2LT7A 3J7AG 2EOIA 1WHQA 2E5LE 1T4OA 2KHXA 4R2QA 2BB8A 1T39A 1N36E 4HTGA 1FJGE 4WSPA 1GZ6A 1YPNA 2WBSA 5FLXC 1KJKA 2EOYA 2LVHA 4RHBB 2KOUA 2FGGA 2UUAE 1A1IA 5AASA 2CTDA 4WXDA 1PJSA 2RS6A 2EMXA 2LBSB 4DV7E 2L2MA 2EMZA 4O43A 4JI2E 3LMLA 4ZYEA 2NUGA 2LE2A 4WPYA 3UK3C 2VRDA 2YT4A 1J26A 2L2NA 4JI1E 2EMGA 4X9JA 4DV6E 4R2AA 3LLHA 2GLIA 1BB8A 2EOXA 2YTFA 2YWQA 3J81C 2V89A 2EL5A 3F6HA 2ODRC 5KL7A 2N3HA 4TUGA 1YYWA 1MGTA 4F54A 4X62E 5KL4A 1G2FC 2EP3A 1IQOA 2EM0A 2EOOA 5DNYA 3T1YE 4DR7E 3ADGA 2EPOA 2VE7C 4F9BB 1WRJA 1A1LA 2WBTA 4JV5E 5IWAE 2JP9A 2YTDA 5A6BA 1RC7A 2V8QB 5AE2A 1A1HA 4L8NA 1X6EA 2KONA 1X48A 3J7Yp 2EORA 4J8ZA 4TUIA 4O5GA 2EOQA 3JAMC 1ZBQA 3EPHA 4JI4E 4DR4E 3C4BA 4R8OA 3C6KA 5A6AA 2DMIA 2LO3A 2LUPB 3VYXA 1UILA 3ADJA 2N8XA 4M9VC 1TF6A 5AC4A 4M30A 1P47A 3VHTB 2YTGA 2I9IA 3EPLA 2F8BA 4GZNC 2R76A 2M1SA 4B3TE 4BCAA 2ODRD 2YRKA 4R2CA 2L3JA 4M2ZA 4DR5E 1NEIA 2EOSA 1RQ0A 2CSHA 2D9HA 2ELYA 2RPCA 3KZYA 2N3GA 2EMFA 5A6JA 2E1MA 2EL4A 2ZM6E 2UXCE 2LTSA 1G2DC 2GHFA 2EQ0A 1HNXE 2FTXB 4R2DA 1HNZE 2L92A 2VQFE 1WJPA 2LV2A 5IV8B 2UUBE 2JY9A 2JOXA 3BF2A 2RSMA 3L00A 1EH8A 2ADRA 3AV0A 3HTXA 5AE3A 1PKPA 4NZVA 3BGHA 2DSYA 1A1GA 2NABA 4KZSA 2V86A 1T4NA 3QG5C 4F9AB 2ENAA 3JTZA 2DLQA 2YTQA 2IHR1 4R2PA 3IWCA 2EOEA 3C6MA 4WFTA 4HEIA 4R2SA 3IWBA 5KL2A 4R03A 1T4LB 4LFAE 2EPZA 3J80C 3TQMA 4IS1C 1SR9A 1GTKA 2A25A 4WXCA 2EM3A 1PJQA 2Q8UA 3MHSC 2R1FA 4OX9E 2EOFA 2EOZA 3H09A 2EZ6A 4B3RE 2EMCA 5T6JA 4OOGC 4BHBA 2EOHA 4NXNE 1X47A 3MSWA 2NUFA 4LF8E 3RMPA 2YTEA 2JR1A 1IBME 2ENCA 1N3GA 1F2IG 2B9DA 4LF7E 3HQ1A 5LLQA 4DMIA 4YY3E 4DR1E 4BS9A 2LMZA 4NHRA 2MC5A 2V85A 4BC7A 1HR0E 2LRSA 1HNWE 2LCEA 4DV1E 5LMUE 1IBLE 2YU8A 4MLVA 2YZTA 4F2JC 1AAYA 3THOB 3K6QA 1EKZA 3IWDA 2DLKA 2ENHA 3ZOQB 4GKKE 5AE1A 4DUZE 2YSOA 1QU6A 1YFHA 1UHZA 4WSGA 2EPPA 4ZYGA 4BHCA 3EQ1A 2EMAA 3HPSA 5LL6R 2EPUA 2UU9E 2YTIA 1A1JA 1DGCA 2I13A 1XNQE 2PRTA 4ZYHA 2LUQA 4DUYE 1TN9A 5KL3A 1QNTA 3KWRA 4LF6E 2LJHA 4KWYA 4BBYA 4F6MA 1XMQE 2EN8A 2EM2A 2EMYA 2EM4A 4L5NC 2YTJA 5F3WA 2J7JA 4LF4E 4JI5E 2B7TA 2YTNA 5LMNE 2BBGA 4LF9E 1LLMC 2EMLA 1N32E 1J5EE 2EMBA 1SFEA 1YSAC 1WHNA 2EN6A 3C4TA 2EN1A 4X66E 1YUIA 2EQ3A 2GPIA 1X49A 2EN3A 2EPRA 2E72A 2EWLA 1IQSA 2DIXA 2G7HA 2EMWA 4AQYE 4O4KA 2EN7A 2ELZA 2MC6A 5TSEA 3F6GA 1MEYC 1IMUA 3AUZA 1STUA 2EPAA 2MKDA 2LJUA 2CT1A 3VK6A
chains in the Genus database with same CATH topology
2EOJA 2YTFA 2A25A 1RMDA 2EL5A 2EM3A 1YUJA 5KL7A 2YSPA 2DGCA 3MHSC 2R1FA 2EN2A 2EOFA 5KL4A 1G2FC 2EOZA 2EP3A 1BBOA 2MKNA 1UN6B 2EMCA 2WBUA 2EM0A 2EOOA 2EOHA 2EMHA 2HGHA 1A1LA 2WBTA 2YTEA 1A1KA 2EMIA 1X6FA 2ENCA 2JP9A 2YTDA 1F2IG 2YTOA 1A1HA 3MHHC 1X6EA 4FK5C 2EORA 2EE8A 2EOQA 1X5WA 1Z1BA 2EM9A 1B69A 2LCEA 3EPHA 2EN4A 1A1FA 2EMKA 2YU8A 2EM8A 2YRHA 4F2JC 1AAYA 2EQ1A 2DMIA 2EPCA 2LO3A 2DLKA 2ENHA 2EOMA 2YSOA 2EJ4A 4WSGA 2YRMA 4M9VC 2DRPA 2EPPA 1TF6A 2YU5A 2EMAA 2EPUA 3VHTB 1P47A 2YTGA 2YTIA 2YTPA 3EPLA 2LT7A 4GZNC 5KL6A 2EOIA 3M99B 2YRKA 1A1JA 4R2CA 1DGCA 2I13A 4R2QA 1NCSA 1ZU1A 2BB8A 2PRTA 2MDGA 3EPJA 2EOSA 4IJDA 1TF3A 2CSHA 2D9HA 2ELYA 2RPCA 5KL3A 1TN9A 1ZR9A 2EMFA 4F6MA 4R2RA 4R2EA 2EN8A 2EL4A 2EM2A 2EMYA 2EM4A 1UBDC 1G2DC 2GHFA 2EQ0A 5KL5A 2WBSA 1KJKA 2YTJA 2EOYA 2J7JA 4R2DA 2LVHA 1ZAAC 1WJPA 2LV2A 2YTNA 2M9AA 1LLMC 2EMLA 1JK2A 1X3CA 1A1IA 2ADRA 2CTDA 2EMBA 2WCC3 1YSAC 2EM6A 2EM7A 2EN6A 2EMXA 3EPKA 2EN1A 1A1GA 2NABA 1YUIA 1X6HA 2EQ3A 2EMZA 1JK1A 2EN3A 2ENAA 2EPRA 2DLQA 2E72A 2YTQA 3UK3C 2VRDA 2EMWA 2EPXA 4R2PA 2EN7A 2ELZA 2EOEA 2EL6A 1MEYC 2RSIA 4F6NA 2EMGA 4X9JA 4R2SA 2JPAA 4R2AA 2EPAA 2MKDA 5KL2A 2CT1A 2GLIA 2EPZA 1BB8A 2EOXA 2EM5A 4IS1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOJ A;  2YTF A;  2A25 A;  1RMD A;  2EL5 A;  2EM3 A;  1YUJ A;  5KL7 A;  2YSP A;  2DGC A;  3MHS C;  2R1F A;  2EN2 A;  2EOF A;  5KL4 A;  1G2F C;  2EOZ A;  2EP3 A;  1BBO A;  2MKN A;  1UN6 B;  2EMC A;  2WBU A;  2EM0 A;  2EOO A;  2EOH A;  2EMH A;  2HGH A;  1A1L A;  2WBT A;  2YTE A;  1A1K A;  2EMI A;  1X6F A;  2ENC A;  2JP9 A;  2YTD A;  1F2I G;  2YTO A;  1A1H A;  3MHH C;  1X6E A;  4FK5 C;  2EOR A;  2EE8 A;  2EOQ A;  1X5W A;  1Z1B A;  2EM9 A;  1B69 A;  2LCE A;  3EPH A;  2EN4 A;  1A1F A;  2EMK A;  2YU8 A;  2EM8 A;  2YRH A;  4F2J C;  1AAY A;  2EQ1 A;  2DMI A;  2EPC A;  2LO3 A;  2DLK A;  2ENH A;  2EOM A;  2YSO A;  2EJ4 A;  4WSG A;  2YRM A;  4M9V C;  2DRP A;  2EPP A;  1TF6 A;  2YU5 A;  2EMA A;  2EPU A;  3VHT B;  1P47 A;  2YTG A;  2YTI A;  2YTP A;  3EPL A;  2LT7 A;  4GZN C;  5KL6 A;  2EOI A;  3M99 B;  2YRK A;  1A1J A;  4R2C A;  1DGC A;  2I13 A;  4R2Q A;  1NCS A;  1ZU1 A;  2BB8 A;  2PRT A;  2MDG A;  3EPJ A;  2EOS A;  4IJD A;  1TF3 A;  2CSH A;  2D9H A;  2ELY A;  2RPC A;  5KL3 A;  1TN9 A;  1ZR9 A;  2EMF A;  4F6M A;  4R2R A;  4R2E A;  2EN8 A;  2EL4 A;  2EM2 A;  2EMY A;  2EM4 A;  1UBD C;  1G2D C;  2GHF A;  2EQ0 A;  5KL5 A;  2WBS A;  1KJK A;  2YTJ A;  2EOY A;  2J7J A;  4R2D A;  2LVH A;  1ZAA C;  1WJP A;  2LV2 A;  2YTN A;  2M9A A;  1LLM C;  2EML A;  1JK2 A;  1X3C A;  1A1I A;  2ADR A;  2CTD A;  2EMB A;  2WCC 3;  1YSA C;  2EM6 A;  2EM7 A;  2EN6 A;  2EMX A;  3EPK A;  2EN1 A;  1A1G A;  2NAB A;  1YUI A;  1X6H A;  2EQ3 A;  2EMZ A;  1JK1 A;  2EN3 A;  2ENA A;  2EPR A;  2DLQ A;  2E72 A;  2YTQ A;  3UK3 C;  2VRD A;  2EMW A;  2EPX A;  4R2P A;  2EN7 A;  2ELZ A;  2EOE A;  2EL6 A;  1MEY C;  2RSI A;  4F6N A;  2EMG A;  4X9J A;  4R2S A;  2JPA A;  4R2A A;  2EPA A;  2MKD A;  5KL2 A;  2CT1 A;  2GLI A;  2EPZ A;  1BB8 A;  2EOX A;  2EM5 A;  4IS1 C; 
#chains in the Genus database with same CATH topology
 5ADZ A;  5A6B D;  1YYK A;  1RMD A;  1WXR A;  1YUJ A;  1PJT A;  4B3S E;  2DGC A;  2K4V A;  1BBO A;  4JI6 E;  1L4S A;  1DQ3 A;  5IT9 C;  2RQL A;  2VF1 A;  4LTY A;  2HGH A;  4Q35 B;  4DV0 E;  2EMI A;  1AH5 A;  2VQE E;  4F9C B;  3MHH C;  2JOB A;  3KZZ A;  4B3M E;  2HJJ A;  4M0V A;  1X5W A;  4LFB E;  2EM9 A;  1B69 A;  1YZ9 A;  2V87 A;  2MDR A;  3ECR A;  5A6K A;  1A1F A;  2EMK A;  2UUC E;  2DB2 A;  2EM8 A;  3HXL A;  4BC9 A;  3JU0 A;  2V88 A;  3ADI A;  4Q28 A;  1ZBT A;  2EOM A;  3OML A;  4DR2 E;  4GEQ B;  2YRM A;  3BID A;  4LU9 A;  2DRP A;  2YU5 A;  2H36 X;  4LFC E;  4LF5 E;  3DF6 A;  2UXB E;  4DR3 E;  3BBG A;  5KL6 A;  3M99 B;  4KHP E;  3DJW A;  2L3C A;  4MLQ A;  5A2Q C;  3ADL A;  1NCS A;  1ZU1 A;  2MDG A;  3EPJ A;  4IJD A;  1YYO A;  1TF3 A;  1ZR9 A;  2JXP A;  4X8W A;  4R2R A;  4R2E A;  1UBD C;  4P7D A;  4WYQ B;  5KL5 A;  2EPL X;  1ZAA C;  3FIG A;  2B3T B;  2M9A A;  2DMY A;  5BR8 E;  2F4V E;  1JK2 A;  2NA2 A;  1X3C A;  2WCC 3;  2EM6 A;  2FV4 B;  4JI0 E;  2EM7 A;  3EPK A;  2EPM X;  4X65 E;  1X6H A;  4JI8 E;  4P78 A;  4ZYD A;  1JK1 A;  4JI3 E;  2JYA A;  2K7I A;  2JVA A;  2RS7 A;  2NUE A;  4YHH E;  2CPN A;  2EPX A;  4I8O A;  2EL6 A;  2RSI A;  4F6N A;  2JPA A;  2UXD E;  4DKK A;  2EM5 A;  2EOJ A;  2EPK X;  5A69 A;  1XNR E;  2JWO A;  4RH8 A;  3VYY A;  1FKA E;  2YSP A;  2EN2 A;  4DV3 E;  1IBK E;  4JYA E;  4DV5 E;  3P1X A;  4DR6 E;  4K0K E;  2MKN A;  1XMO E;  1UN6 B;  2WBU A;  4DV4 E;  2LTR A;  2HC5 A;  2V83 A;  1KYQ A;  1N33 E;  4GKJ E;  2EMH A;  3T1H E;  2L2K B;  4X64 E;  1PDA A;  1A1K A;  1X6F A;  1N34 E;  4JI7 E;  3OTO E;  2YTO A;  1EH7 A;  2M4I A;  5IXM B;  4FK5 C;  2EPN A;  4NXM E;  2EE8 A;  4DV2 E;  4N4R B;  5AC5 A;  1Z1B A;  2EN4 A;  2YRH A;  1BBG A;  2EQ1 A;  4BMJ A;  2EPC A;  1GQE A;  2L33 A;  3THN A;  2B7V A;  5CFF E;  2HHH E;  2L8T A;  4WX9 A;  2EJ4 A;  4O24 A;  2RTX A;  2L6M A;  1T38 A;  1O0W A;  1EH6 A;  1DI2 A;  2M7Q A;  3HPZ A;  2YTP A;  2WZO A;  1I94 E;  2YPN A;  2LT7 A;  3J7A G;  2EOI A;  1WHQ A;  2E5L E;  1T4O A;  2KHX A;  4R2Q A;  2BB8 A;  1T39 A;  1N36 E;  4HTG A;  1FJG E;  4WSP A;  1GZ6 A;  1YPN A;  2WBS A;  5FLX C;  1KJK A;  2EOY A;  2LVH A;  4RHB B;  2KOU A;  2FGG A;  2UUA E;  1A1I A;  5AAS A;  2CTD A;  4WXD A;  1PJS A;  2RS6 A;  2EMX A;  2LBS B;  4DV7 E;  2L2M A;  2EMZ A;  4O43 A;  4JI2 E;  3LML A;  4ZYE A;  2NUG A;  2LE2 A;  4WPY A;  3UK3 C;  2VRD A;  2YT4 A;  1J26 A;  2L2N A;  4JI1 E;  2EMG A;  4X9J A;  4DV6 E;  4R2A A;  3LLH A;  2GLI A;  1BB8 A;  2EOX A;  2YTF A;  2YWQ A;  3J81 C;  2V89 A;  2EL5 A;  3F6H A;  2ODR C;  5KL7 A;  2N3H A;  4TUG A;  1YYW A;  1MGT A;  4F54 A;  4X62 E;  5KL4 A;  1G2F C;  2EP3 A;  1IQO A;  2EM0 A;  2EOO A;  5DNY A;  3T1Y E;  4DR7 E;  3ADG A;  2EPO A;  2VE7 C;  4F9B B;  1WRJ A;  1A1L A;  2WBT A;  4JV5 E;  5IWA E;  2JP9 A;  2YTD A;  5A6B A;  1RC7 A;  2V8Q B;  5AE2 A;  1A1H A;  4L8N A;  1X6E A;  2KON A;  1X48 A;  3J7Y p;  2EOR A;  4J8Z A;  4TUI A;  4O5G A;  2EOQ A;  3JAM C;  1ZBQ A;  3EPH A;  4JI4 E;  4DR4 E;  3C4B A;  4R8O A;  3C6K A;  5A6A A;  2DMI A;  2LO3 A;  2LUP B;  3VYX A;  1UIL A;  3ADJ A;  2N8X A;  4M9V C;  1TF6 A;  5AC4 A;  4M30 A;  1P47 A;  3VHT B;  2YTG A;  2I9I A;  3EPL A;  2F8B A;  4GZN C;  2R76 A;  2M1S A;  4B3T E;  4BCA A;  2ODR D;  2YRK A;  4R2C A;  2L3J A;  4M2Z A;  4DR5 E;  1NEI A;  2EOS A;  1RQ0 A;  2CSH A;  2D9H A;  2ELY A;  2RPC A;  3KZY A;  2N3G A;  2EMF A;  5A6J A;  2E1M A;  2EL4 A;  2ZM6 E;  2UXC E;  2LTS A;  1G2D C;  2GHF A;  2EQ0 A;  1HNX E;  2FTX B;  4R2D A;  1HNZ E;  2L92 A;  2VQF E;  1WJP A;  2LV2 A;  5IV8 B;  2UUB E;  2JY9 A;  2JOX A;  3BF2 A;  2RSM A;  3L00 A;  1EH8 A;  2ADR A;  3AV0 A;  3HTX A;  5AE3 A;  1PKP A;  4NZV A;  3BGH A;  2DSY A;  1A1G A;  2NAB A;  4KZS A;  2V86 A;  1T4N A;  3QG5 C;  4F9A B;  2ENA A;  3JTZ A;  2DLQ A;  2YTQ A;  2IHR 1;  4R2P A;  3IWC A;  2EOE A;  3C6M A;  4WFT A;  4HEI A;  4R2S A;  3IWB A;  5KL2 A;  4R03 A;  1T4L B;  4LFA E;  2EPZ A;  3J80 C;  3TQM A;  4IS1 C;  1SR9 A;  1GTK A;  2A25 A;  4WXC A;  2EM3 A;  1PJQ A;  2Q8U A;  3MHS C;  2R1F A;  4OX9 E;  2EOF A;  2EOZ A;  3H09 A;  2EZ6 A;  4B3R E;  2EMC A;  5T6J A;  4OOG C;  4BHB A;  2EOH A;  4NXN E;  1X47 A;  3MSW A;  2NUF A;  4LF8 E;  3RMP A;  2YTE A;  2JR1 A;  1IBM E;  2ENC A;  1N3G A;  1F2I G;  2B9D A;  4LF7 E;  3HQ1 A;  5LLQ A;  4DMI A;  4YY3 E;  4DR1 E;  4BS9 A;  2LMZ A;  4NHR A;  2MC5 A;  2V85 A;  4BC7 A;  1HR0 E;  2LRS A;  1HNW E;  2LCE A;  4DV1 E;  5LMU E;  1IBL E;  2YU8 A;  4MLV A;  2YZT A;  4F2J C;  1AAY A;  3THO B;  3K6Q A;  1EKZ A;  3IWD A;  2DLK A;  2ENH A;  3ZOQ B;  4GKK E;  5AE1 A;  4DUZ E;  2YSO A;  1QU6 A;  1YFH A;  1UHZ A;  4WSG A;  2EPP A;  4ZYG A;  4BHC A;  3EQ1 A;  2EMA A;  3HPS A;  5LL6 R;  2EPU A;  2UU9 E;  2YTI A;  1A1J A;  1DGC A;  2I13 A;  1XNQ E;  2PRT A;  4ZYH A;  2LUQ A;  4DUY E;  1TN9 A;  5KL3 A;  1QNT A;  3KWR A;  4LF6 E;  2LJH A;  4KWY A;  4BBY A;  4F6M A;  1XMQ E;  2EN8 A;  2EM2 A;  2EMY A;  2EM4 A;  4L5N C;  2YTJ A;  5F3W A;  2J7J A;  4LF4 E;  4JI5 E;  2B7T A;  2YTN A;  5LMN E;  2BBG A;  4LF9 E;  1LLM C;  2EML A;  1N32 E;  1J5E E;  2EMB A;  1SFE A;  1YSA C;  1WHN A;  2EN6 A;  3C4T A;  2EN1 A;  4X66 E;  1YUI A;  2EQ3 A;  2GPI A;  1X49 A;  2EN3 A;  2EPR A;  2E72 A;  2EWL A;  1IQS A;  2DIX A;  2G7H A;  2EMW A;  4AQY E;  4O4K A;  2EN7 A;  2ELZ A;  2MC6 A;  5TSE A;  3F6G A;  1MEY C;  1IMU A;  3AUZ A;  1STU A;  2EPA A;  2MKD A;  2LJU A;  2CT1 A;  3VK6 A; 
#chains in the Genus database with same CATH homology
 2EOJ A;  2YTF A;  2A25 A;  1RMD A;  2EL5 A;  2EM3 A;  1YUJ A;  5KL7 A;  2YSP A;  2DGC A;  3MHS C;  2R1F A;  2EN2 A;  2EOF A;  5KL4 A;  1G2F C;  2EOZ A;  2EP3 A;  1BBO A;  2MKN A;  1UN6 B;  2EMC A;  2WBU A;  2EM0 A;  2EOO A;  2EOH A;  2EMH A;  2HGH A;  1A1L A;  2WBT A;  2YTE A;  1A1K A;  2EMI A;  1X6F A;  2ENC A;  2JP9 A;  2YTD A;  1F2I G;  2YTO A;  1A1H A;  3MHH C;  1X6E A;  4FK5 C;  2EOR A;  2EE8 A;  2EOQ A;  1X5W A;  1Z1B A;  2EM9 A;  1B69 A;  2LCE A;  3EPH A;  2EN4 A;  1A1F A;  2EMK A;  2YU8 A;  2EM8 A;  2YRH A;  4F2J C;  1AAY A;  2EQ1 A;  2DMI A;  2EPC A;  2LO3 A;  2DLK A;  2ENH A;  2EOM A;  2YSO A;  2EJ4 A;  4WSG A;  2YRM A;  4M9V C;  2DRP A;  2EPP A;  1TF6 A;  2YU5 A;  2EMA A;  2EPU A;  3VHT B;  1P47 A;  2YTG A;  2YTI A;  2YTP A;  3EPL A;  2LT7 A;  4GZN C;  5KL6 A;  2EOI A;  3M99 B;  2YRK A;  1A1J A;  4R2C A;  1DGC A;  2I13 A;  4R2Q A;  1NCS A;  1ZU1 A;  2BB8 A;  2PRT A;  2MDG A;  3EPJ A;  2EOS A;  4IJD A;  1TF3 A;  2CSH A;  2D9H A;  2ELY A;  2RPC A;  5KL3 A;  1TN9 A;  1ZR9 A;  2EMF A;  4F6M A;  4R2R A;  4R2E A;  2EN8 A;  2EL4 A;  2EM2 A;  2EMY A;  2EM4 A;  1UBD C;  1G2D C;  2GHF A;  2EQ0 A;  5KL5 A;  2WBS A;  1KJK A;  2YTJ A;  2EOY A;  2J7J A;  4R2D A;  2LVH A;  1ZAA C;  1WJP A;  2LV2 A;  2YTN A;  2M9A A;  1LLM C;  2EML A;  1JK2 A;  1X3C A;  1A1I A;  2ADR A;  2CTD A;  2EMB A;  2WCC 3;  1YSA C;  2EM6 A;  2EM7 A;  2EN6 A;  2EMX A;  3EPK A;  2EN1 A;  1A1G A;  2NAB A;  1YUI A;  1X6H A;  2EQ3 A;  2EMZ A;  1JK1 A;  2EN3 A;  2ENA A;  2EPR A;  2DLQ A;  2E72 A;  2YTQ A;  3UK3 C;  2VRD A;  2EMW A;  2EPX A;  4R2P A;  2EN7 A;  2ELZ A;  2EOE A;  2EL6 A;  1MEY C;  2RSI A;  4F6N A;  2EMG A;  4X9J A;  4R2S A;  2JPA A;  4R2A A;  2EPA A;  2MKD A;  5KL2 A;  2CT1 A;  2GLI A;  2EPZ A;  1BB8 A;  2EOX A;  2EM5 A;  4IS1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...