1WJPA

Solution structure of zf-c2h2 domains from human zinc finger protein 295
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
107
Chain Sequence
b'GSSGSSGASPVENKEVYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKCEYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMAPTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 295
publication title Solution structure of zf-C2H2 domains from human Zinc finger protein 295
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 18
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18450 zf_C2H2_6 Zinc Finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA02
4R2RA 2EN6A 5KL3A 2ENAA 1JK2A 2EMHA 5KL6A 2EM8A 2EOEA 4R2PA 4R2SA 2WCC3 4WSGA 3UK3C 2EPZA 2EMGA 1A1IA 2ELZA 5KL5A 2ADRA 2EOQA 2EMCA 2YTJA 4R2AA 2EOIA 2EM3A 2BB8A 2EOFA 1NCSA 2YTQA 2EM7A 4GZNC 2DGCA 2EOOA 4F6NA 4R2DA 2EMXA 2YRMA 1RMDA 1TF3A 1A1FA 4M9VC 2EPCA 2EN3A 3MHSC 4R2QA 3EPJA 2JPAA 2WBUA 2MKNA 2YSPA 2EN1A 2EMBA 2EM2A 2YTGA 2EM6A 2EQ0A 5KL2A 3M99B 2EMWA 2WBSA 4F2JC 1WJPA 4IS1C 2DLQA 2EPAA 2YRHA 1AAYA 2EMZA 4FK5C 2YTIA 2EM9A 2YTNA 1BB8A 2EJ4A 2EL4A 2EMIA 4X9JA 2EM4A 3EPLA 1Z1BA 1F2IG 2GLIA 1A1LA 1YUIA 1P47A 1X3CA 2EL6A 4R2CA 2ENHA 2EMFA 1X6HA 2EN4A 2MDGA 2LV2A 1BBOA 2EE8A 1KJKA 2EOJA 2YTFA 2YTOA 2DLKA 2LVHA 2EQ1A 2EOXA 5KL7A 2EOHA 1TN9A 1ZR9A 2EN7A 2R1FA 1UN6B 2EM5A 2EM0A 2YTEA 1YSAC 2E72A 2EN2A 3MHHC 2YU8A 2LT7A 1ZU1A 2YU5A 2M9AA 2CSHA 1A1GA 2LO3A 2GHFA 1X6EA 1MEYC 2VRDA 2CTDA 1G2FC 1TF6A 2EPPA 2J7JA 1A1KA 1A1JA 2MKDA 2EOMA 1B69A 3EPKA 2EOSA 2EPUA 4F6MA 1LLMC 1ZAAC 1G2DC 2EQ3A 4IJDA 3VHTB 2D9HA 2WBTA 2YTPA 2RSIA 2EMLA 1JK1A 2DMIA 2EMAA 2EPRA 2EP3A 2CT1A 1DGCA 2EOYA 2DRPA 2RPCA 2EOZA 2EN8A 2EMYA 2EORA 2HGHA 2LCEA 2EPXA 2YTDA 2YSOA 1UBDC 1X5WA 2ENCA 2JP9A 2PRTA 2I13A 2EMKA 2YRKA 2EL5A 3EPHA 2NABA 2A25A 1A1HA 5KL4A 4R2EA 2ELYA 1X6FA 1YUJA
chains in the Genus database with same CATH superfamily
2EN6A 5A69A 1T4OA 5KL3A 2JVAA 2EM8A 4R2PA 4R2SA 5IV8B 4WSGA 2EPZA 2ODRD 3J80C 4LTYA 5KL5A 2EOQA 4R2AA 4DR7E 1EH7A 4DR5E 4M9VC 2EN3A 3AUZA 2JPAA 2WBUA 4BBYA 2EWLA 2I9IA 3H09A 2EMBA 4MLQA 1J26A 4F9BB 4DR1E 2EM6A 2LTSA 2EMWA 2WBSA 2B3TB 3BIDA 2YTIA 3ADGA 2EM9A 1STUA 2EJ4A 2EL4A 3ADLA 2EMIA 4X9JA 2EM4A 3EPLA 1Z1BA 2HJJA 1F2IG 2B7VA 4I8OA 1X3CA 3JAMC 2DIXA 2LUQA 2EL6A 2M4IA 5LMUE 1YPNA 4JI5E 2EN4A 2LE2A 1BBOA 4JI4E 1BBGA 5TSEA 1PDAA 1T4LB 1YYKA 4WSPA 4DUYE 2EQ1A 3OMLA 2UUAE 3RMPA 2L3JA 1TN9A 1PKPA 2WZOA 5AC5A 4DR3E 2KHXA 1HNXE 4DV4E 1O0WA 2H36X 4LF6E 1IQOA 2EM0A 1XMQE 2VQEE 1WXRA 2YU5A 4ZYGA 1A1GA 2YWQA 2LO3A 3ADJA 1MEYC 3HTXA 1G2FC 4LF8E 4O5GA 2EPPA 4ZYDA 5F3WA 3HPSA 2B7TA 5LL6R 4F6MA 3VHTB 3TQMA 5A6JA 2WBTA 5CFFE 4O24A 4MLVA 1UILA 2DMIA 3K6QA 2EMAA 5AASA 1X48A 3BF2A 4GEQB 2EN8A 1XNQE 5AE2A 4B3TE 4LFAE 2LMZA 1WRJA 2JR1A 3F6HA 2LJHA 1T4NA 2A25A 2EPNA 2EPKX 2M1SA 2HHHE 2ELYA 3OTOE 2ENAA 2EMHA 5KL6A 2EOEA 2WCC3 2JXPA 3UK3C 2RSMA 2JOXA 2KONA 2ELZA 1RC7A 3MSWA 2ADRA 5BR8E 2EMCA 1UHZA 2EM3A 2LUPB 4YHHE 2N8XA 2EM7A 4GZNC 1I94E 4F6NA 4R2DA 5IXMB 2V83A 1A1FA 2V86A 2EPLX 2VF1A 1N36E 3C6KA 3EPJA 4M30A 2BBGA 1N3GA 5A6AA 2YSPA 2EN1A 3KZYA 4RH8A 2EZ6A 2EM2A 4LU9A 3J7AG 1WHNA 3M99B 4JI7E 4K0KE 4IS1C 3VYYA 1AAYA 5LLQA 1PJQA 2YTNA 1PJSA 2EPOA 3C4TA 4X8WA 5AE3A 1DI2A 1A1LA 2L2MA 1P47A 2NUGA 2MC6A 2VQFE 1X6HA 1GQEA 2CPNA 2V8QB 2UXBE 4JI3E 5KL7A 2NUFA 1X49A 2MDRA 4R8OA 1L4SA 2L2NA 4GKJE 5T6JA 1YSAC 3MHHC 2LT7A 2UUBE 2K4VA 2FV4B 2UUCE 2M9AA 2RS7A 2E1MA 4KWYA 2GHFA 4Q28A 2IHR1 2VE7C 4LF4E 5DNYA 2MKDA 1SFEA 2EOMA 4DV7E 3EPKA 4JYAE 1N32E 1LLMC 2EMLA 2UU9E 3HXLA 1SR9A 4DR2E 2G7HA 1NEIA 4M2ZA 1DGCA 4WYQB 2EOYA 2DRPA 3ADIA 2RPCA 2EOZA 4WXCA 2HGHA 4O4KA 2LCEA 2YT4A 2M7QA 2YPNA 3C4BA 5AC4A 2PRTA 4GKKE 2RQLA 4LFBE 2EL5A 4BC9A 3KZZA 2N3GA 4OOGC 4X64E 1X6FA 4R2RA 2EPMX 4X66E 4KZSA 5AE1A 1JK2A 4NHRA 1T39A 4L8NA 2EMGA 1A1IA 4DV3E 1FJGE 2YTJA 4WXDA 2BB8A 2EOFA 1NCSA 4BCAA 2L92A 3ECRA 2EMXA 2YRMA 1RMDA 4BHCA 1PJTA 1YYWA 2RS6A 4Q35B 1IBLE 2DB2A 5KL2A 1X47A 2NUEA 2DLQA 1DQ3A 1HNZE 5A6BA 2EPAA 2YRHA 4P7DA 2EMZA 1BB8A 2B9DA 2GLIA 2JOBA 2UXDE 1YUIA 4NXNE 4DV6E 1QU6A 4BHBA 2E5LE 2MDGA 1KJKA 2EOJA 2YTFA 4R03A 2YTOA 4BC7A 1EKZA 2DLKA 2L6MA 2LVHA 3LMLA 4M0VA 4X65E 3VK6A 4B3ME 1AH5A 2EOHA 4F9CB 1ZR9A 2EN7A 4DKKA 2V89A 2R1FA 2V85A 1HR0E 2LJUA 2EN2A 2YU8A 4DV5E 1ZU1A 4NZVA 1X6EA 2VRDA 4DUZE 1A1KA 4HEIA 1A1JA 4F54A 4JV5E 5LMNE 1ZAAC 1WHQA 4IJDA 1G2DC 2D9HA 1N33E 3T1HE 2RSIA 3THNA 1J5EE 1HNWE 5A6KA 2V88A 4DV2E 2DSYA 1RQ0A 4WFTA 4X62E 2F8BA 1EH6A 2YZTA 1IBKE 3HPZA 1XNRE 3IWCA 2EMYA 2EORA 3FIGA 2K7IA 2Q8UA 4ZYEA 3P1XA 3JTZA 4AQYE 2YSOA 4WX9A 3ZOQB 3EPHA 4JI2E 2NABA 2L33A 4DR6E 5KL4A 4R2EA 2LRSA 1TF6A 1YUJA 1YYOA 5IWAE 4BMJA 2LBSB 5ADZA 2NA2A 2V87A 1QNTA 4P78A 4LF9E 1T38A 2EOIA 4JI6E 2YTQA 4JI1E 1IQSA 2DMYA 2EOOA 2DGCA 3IWBA 3J7Yp 3LLHA 1TF3A 1GTKA 4DV0E 2EPCA 3J81C 3T1YE 3MHSC 4R2QA 2MKNA 1XMOE 2FTXB 4KHPE 2KOUA 2YTGA 1YFHA 2EQ0A 5FLXC 4F2JC 1WJPA 1YZ9A 3BGHA 4FK5C 2GPIA 3L00A 2L2KB 1IMUA 4LF7E 3HQ1A 1KYQA 1ZBQA 3EQ1A 4N4RB 4ZYHA 3F6GA 4J8ZA 4L5NC 4R2CA 2ENHA 1IBME 2EMFA 5IT9C 4BS9A 4OX9E 2LV2A 2EE8A 3AV0A 2EOXA 2ZM6E 2JY9A 4LF5E 4HTGA 1FKAE 2JYAA 3IWDA 1EH8A 2L8TA 1UN6B 2EM5A 2YTEA 5A6BD 2E72A 2JWOA 4F9AB 2RTXA 5A2QC 2CSHA 4O43A 3DF6A 3BBGA 3QG5C 1N34E 3THOB 4DR4E 2CTDA 3KWRA 2FGGA 2J7JA 4TUGA 3VYXA 1B69A 4DV1E 2L3CA 2HC5A 2EOSA 2EPUA 3JU0A 2MC5A 2ODRC 2EQ3A 4RHBB 2YTPA 4LFCE 4B3RE 1JK1A 1MGTA 4JI0E 2EPRA 2EP3A 1ZBTA 2CT1A 3DJWA 2LTRA 1GZ6A 4JI8E 4WPYA 4YY3E 4NXME 2F4VE 2R76A 2N3HA 2EPXA 2YTDA 2UXCE 1UBDC 1X5WA 4B3SE 2ENCA 2JP9A 2I13A 2EMKA 2YRKA 4DMIA 1A1HA 4TUIA 3C6MA
chains in the Genus database with same CATH topology
4R2RA 2EN6A 5KL3A 2ENAA 1JK2A 2EMHA 5KL6A 2EM8A 2EOEA 4R2PA 4R2SA 2WCC3 4WSGA 3UK3C 2EPZA 2EMGA 1A1IA 2ELZA 5KL5A 2ADRA 2EOQA 2EMCA 2YTJA 4R2AA 2EOIA 2EM3A 2BB8A 2EOFA 1NCSA 2YTQA 2EM7A 4GZNC 2DGCA 2EOOA 4F6NA 4R2DA 2EMXA 2YRMA 1RMDA 1TF3A 1A1FA 4M9VC 2EPCA 2EN3A 3MHSC 4R2QA 3EPJA 2JPAA 2WBUA 2MKNA 2YSPA 2EN1A 2EMBA 2EM2A 2YTGA 2EM6A 2EQ0A 5KL2A 3M99B 2EMWA 2WBSA 4F2JC 1WJPA 4IS1C 2DLQA 2EPAA 2YRHA 1AAYA 2EMZA 4FK5C 2YTIA 2EM9A 2YTNA 1BB8A 2EJ4A 2EL4A 2EMIA 4X9JA 2EM4A 3EPLA 1Z1BA 1F2IG 2GLIA 1A1LA 1YUIA 1P47A 1X3CA 2EL6A 4R2CA 2ENHA 2EMFA 1X6HA 2EN4A 2MDGA 2LV2A 1BBOA 2EE8A 1KJKA 2EOJA 2YTFA 2YTOA 2DLKA 2LVHA 2EQ1A 2EOXA 5KL7A 2EOHA 1TN9A 1ZR9A 2EN7A 2R1FA 1UN6B 2EM5A 2EM0A 2YTEA 1YSAC 2E72A 2EN2A 3MHHC 2YU8A 2LT7A 1ZU1A 2YU5A 2M9AA 2CSHA 1A1GA 2LO3A 2GHFA 1X6EA 1MEYC 2VRDA 2CTDA 1G2FC 1TF6A 2EPPA 2J7JA 1A1KA 1A1JA 2MKDA 2EOMA 1B69A 3EPKA 2EOSA 2EPUA 4F6MA 1LLMC 1ZAAC 1G2DC 2EQ3A 4IJDA 3VHTB 2D9HA 2WBTA 2YTPA 2RSIA 2EMLA 1JK1A 2DMIA 2EMAA 2EPRA 2EP3A 2CT1A 1DGCA 2EOYA 2DRPA 2RPCA 2EOZA 2EN8A 2EMYA 2EORA 2HGHA 2LCEA 2EPXA 2YTDA 2YSOA 1UBDC 1X5WA 2ENCA 2JP9A 2PRTA 2I13A 2EMKA 2YRKA 2EL5A 3EPHA 2NABA 2A25A 1A1HA 5KL4A 4R2EA 2ELYA 1X6FA 1YUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2R A;  2EN6 A;  5KL3 A;  2ENA A;  1JK2 A;  2EMH A;  5KL6 A;  2EM8 A;  2EOE A;  4R2P A;  4R2S A;  2WCC 3;  4WSG A;  3UK3 C;  2EPZ A;  2EMG A;  1A1I A;  2ELZ A;  5KL5 A;  2ADR A;  2EOQ A;  2EMC A;  2YTJ A;  4R2A A;  2EOI A;  2EM3 A;  2BB8 A;  2EOF A;  1NCS A;  2YTQ A;  2EM7 A;  4GZN C;  2DGC A;  2EOO A;  4F6N A;  4R2D A;  2EMX A;  2YRM A;  1RMD A;  1TF3 A;  1A1F A;  4M9V C;  2EPC A;  2EN3 A;  3MHS C;  4R2Q A;  3EPJ A;  2JPA A;  2WBU A;  2MKN A;  2YSP A;  2EN1 A;  2EMB A;  2EM2 A;  2YTG A;  2EM6 A;  2EQ0 A;  5KL2 A;  3M99 B;  2EMW A;  2WBS A;  4F2J C;  1WJP A;  4IS1 C;  2DLQ A;  2EPA A;  2YRH A;  1AAY A;  2EMZ A;  4FK5 C;  2YTI A;  2EM9 A;  2YTN A;  1BB8 A;  2EJ4 A;  2EL4 A;  2EMI A;  4X9J A;  2EM4 A;  3EPL A;  1Z1B A;  1F2I G;  2GLI A;  1A1L A;  1YUI A;  1P47 A;  1X3C A;  2EL6 A;  4R2C A;  2ENH A;  2EMF A;  1X6H A;  2EN4 A;  2MDG A;  2LV2 A;  1BBO A;  2EE8 A;  1KJK A;  2EOJ A;  2YTF A;  2YTO A;  2DLK A;  2LVH A;  2EQ1 A;  2EOX A;  5KL7 A;  2EOH A;  1TN9 A;  1ZR9 A;  2EN7 A;  2R1F A;  1UN6 B;  2EM5 A;  2EM0 A;  2YTE A;  1YSA C;  2E72 A;  2EN2 A;  3MHH C;  2YU8 A;  2LT7 A;  1ZU1 A;  2YU5 A;  2M9A A;  2CSH A;  1A1G A;  2LO3 A;  2GHF A;  1X6E A;  1MEY C;  2VRD A;  2CTD A;  1G2F C;  1TF6 A;  2EPP A;  2J7J A;  1A1K A;  1A1J A;  2MKD A;  2EOM A;  1B69 A;  3EPK A;  2EOS A;  2EPU A;  4F6M A;  1LLM C;  1ZAA C;  1G2D C;  2EQ3 A;  4IJD A;  3VHT B;  2D9H A;  2WBT A;  2YTP A;  2RSI A;  2EML A;  1JK1 A;  2DMI A;  2EMA A;  2EPR A;  2EP3 A;  2CT1 A;  1DGC A;  2EOY A;  2DRP A;  2RPC A;  2EOZ A;  2EN8 A;  2EMY A;  2EOR A;  2HGH A;  2LCE A;  2EPX A;  2YTD A;  2YSO A;  1UBD C;  1X5W A;  2ENC A;  2JP9 A;  2PRT A;  2I13 A;  2EMK A;  2YRK A;  2EL5 A;  3EPH A;  2NAB A;  2A25 A;  1A1H A;  5KL4 A;  4R2E A;  2ELY A;  1X6F A;  1YUJ A; 
#chains in the Genus database with same CATH topology
 2EN6 A;  5A69 A;  1T4O A;  5KL3 A;  2JVA A;  2EM8 A;  4R2P A;  4R2S A;  5IV8 B;  4WSG A;  2EPZ A;  2ODR D;  3J80 C;  4LTY A;  5KL5 A;  2EOQ A;  4R2A A;  4DR7 E;  1EH7 A;  4DR5 E;  4M9V C;  2EN3 A;  3AUZ A;  2JPA A;  2WBU A;  4BBY A;  2EWL A;  2I9I A;  3H09 A;  2EMB A;  4MLQ A;  1J26 A;  4F9B B;  4DR1 E;  2EM6 A;  2LTS A;  2EMW A;  2WBS A;  2B3T B;  3BID A;  2YTI A;  3ADG A;  2EM9 A;  1STU A;  2EJ4 A;  2EL4 A;  3ADL A;  2EMI A;  4X9J A;  2EM4 A;  3EPL A;  1Z1B A;  2HJJ A;  1F2I G;  2B7V A;  4I8O A;  1X3C A;  3JAM C;  2DIX A;  2LUQ A;  2EL6 A;  2M4I A;  5LMU E;  1YPN A;  4JI5 E;  2EN4 A;  2LE2 A;  1BBO A;  4JI4 E;  1BBG A;  5TSE A;  1PDA A;  1T4L B;  1YYK A;  4WSP A;  4DUY E;  2EQ1 A;  3OML A;  2UUA E;  3RMP A;  2L3J A;  1TN9 A;  1PKP A;  2WZO A;  5AC5 A;  4DR3 E;  2KHX A;  1HNX E;  4DV4 E;  1O0W A;  2H36 X;  4LF6 E;  1IQO A;  2EM0 A;  1XMQ E;  2VQE E;  1WXR A;  2YU5 A;  4ZYG A;  1A1G A;  2YWQ A;  2LO3 A;  3ADJ A;  1MEY C;  3HTX A;  1G2F C;  4LF8 E;  4O5G A;  2EPP A;  4ZYD A;  5F3W A;  3HPS A;  2B7T A;  5LL6 R;  4F6M A;  3VHT B;  3TQM A;  5A6J A;  2WBT A;  5CFF E;  4O24 A;  4MLV A;  1UIL A;  2DMI A;  3K6Q A;  2EMA A;  5AAS A;  1X48 A;  3BF2 A;  4GEQ B;  2EN8 A;  1XNQ E;  5AE2 A;  4B3T E;  4LFA E;  2LMZ A;  1WRJ A;  2JR1 A;  3F6H A;  2LJH A;  1T4N A;  2A25 A;  2EPN A;  2EPK X;  2M1S A;  2HHH E;  2ELY A;  3OTO E;  2ENA A;  2EMH A;  5KL6 A;  2EOE A;  2WCC 3;  2JXP A;  3UK3 C;  2RSM A;  2JOX A;  2KON A;  2ELZ A;  1RC7 A;  3MSW A;  2ADR A;  5BR8 E;  2EMC A;  1UHZ A;  2EM3 A;  2LUP B;  4YHH E;  2N8X A;  2EM7 A;  4GZN C;  1I94 E;  4F6N A;  4R2D A;  5IXM B;  2V83 A;  1A1F A;  2V86 A;  2EPL X;  2VF1 A;  1N36 E;  3C6K A;  3EPJ A;  4M30 A;  2BBG A;  1N3G A;  5A6A A;  2YSP A;  2EN1 A;  3KZY A;  4RH8 A;  2EZ6 A;  2EM2 A;  4LU9 A;  3J7A G;  1WHN A;  3M99 B;  4JI7 E;  4K0K E;  4IS1 C;  3VYY A;  1AAY A;  5LLQ A;  1PJQ A;  2YTN A;  1PJS A;  2EPO A;  3C4T A;  4X8W A;  5AE3 A;  1DI2 A;  1A1L A;  2L2M A;  1P47 A;  2NUG A;  2MC6 A;  2VQF E;  1X6H A;  1GQE A;  2CPN A;  2V8Q B;  2UXB E;  4JI3 E;  5KL7 A;  2NUF A;  1X49 A;  2MDR A;  4R8O A;  1L4S A;  2L2N A;  4GKJ E;  5T6J A;  1YSA C;  3MHH C;  2LT7 A;  2UUB E;  2K4V A;  2FV4 B;  2UUC E;  2M9A A;  2RS7 A;  2E1M A;  4KWY A;  2GHF A;  4Q28 A;  2IHR 1;  2VE7 C;  4LF4 E;  5DNY A;  2MKD A;  1SFE A;  2EOM A;  4DV7 E;  3EPK A;  4JYA E;  1N32 E;  1LLM C;  2EML A;  2UU9 E;  3HXL A;  1SR9 A;  4DR2 E;  2G7H A;  1NEI A;  4M2Z A;  1DGC A;  4WYQ B;  2EOY A;  2DRP A;  3ADI A;  2RPC A;  2EOZ A;  4WXC A;  2HGH A;  4O4K A;  2LCE A;  2YT4 A;  2M7Q A;  2YPN A;  3C4B A;  5AC4 A;  2PRT A;  4GKK E;  2RQL A;  4LFB E;  2EL5 A;  4BC9 A;  3KZZ A;  2N3G A;  4OOG C;  4X64 E;  1X6F A;  4R2R A;  2EPM X;  4X66 E;  4KZS A;  5AE1 A;  1JK2 A;  4NHR A;  1T39 A;  4L8N A;  2EMG A;  1A1I A;  4DV3 E;  1FJG E;  2YTJ A;  4WXD A;  2BB8 A;  2EOF A;  1NCS A;  4BCA A;  2L92 A;  3ECR A;  2EMX A;  2YRM A;  1RMD A;  4BHC A;  1PJT A;  1YYW A;  2RS6 A;  4Q35 B;  1IBL E;  2DB2 A;  5KL2 A;  1X47 A;  2NUE A;  2DLQ A;  1DQ3 A;  1HNZ E;  5A6B A;  2EPA A;  2YRH A;  4P7D A;  2EMZ A;  1BB8 A;  2B9D A;  2GLI A;  2JOB A;  2UXD E;  1YUI A;  4NXN E;  4DV6 E;  1QU6 A;  4BHB A;  2E5L E;  2MDG A;  1KJK A;  2EOJ A;  2YTF A;  4R03 A;  2YTO A;  4BC7 A;  1EKZ A;  2DLK A;  2L6M A;  2LVH A;  3LML A;  4M0V A;  4X65 E;  3VK6 A;  4B3M E;  1AH5 A;  2EOH A;  4F9C B;  1ZR9 A;  2EN7 A;  4DKK A;  2V89 A;  2R1F A;  2V85 A;  1HR0 E;  2LJU A;  2EN2 A;  2YU8 A;  4DV5 E;  1ZU1 A;  4NZV A;  1X6E A;  2VRD A;  4DUZ E;  1A1K A;  4HEI A;  1A1J A;  4F54 A;  4JV5 E;  5LMN E;  1ZAA C;  1WHQ A;  4IJD A;  1G2D C;  2D9H A;  1N33 E;  3T1H E;  2RSI A;  3THN A;  1J5E E;  1HNW E;  5A6K A;  2V88 A;  4DV2 E;  2DSY A;  1RQ0 A;  4WFT A;  4X62 E;  2F8B A;  1EH6 A;  2YZT A;  1IBK E;  3HPZ A;  1XNR E;  3IWC A;  2EMY A;  2EOR A;  3FIG A;  2K7I A;  2Q8U A;  4ZYE A;  3P1X A;  3JTZ A;  4AQY E;  2YSO A;  4WX9 A;  3ZOQ B;  3EPH A;  4JI2 E;  2NAB A;  2L33 A;  4DR6 E;  5KL4 A;  4R2E A;  2LRS A;  1TF6 A;  1YUJ A;  1YYO A;  5IWA E;  4BMJ A;  2LBS B;  5ADZ A;  2NA2 A;  2V87 A;  1QNT A;  4P78 A;  4LF9 E;  1T38 A;  2EOI A;  4JI6 E;  2YTQ A;  4JI1 E;  1IQS A;  2DMY A;  2EOO A;  2DGC A;  3IWB A;  3J7Y p;  3LLH A;  1TF3 A;  1GTK A;  4DV0 E;  2EPC A;  3J81 C;  3T1Y E;  3MHS C;  4R2Q A;  2MKN A;  1XMO E;  2FTX B;  4KHP E;  2KOU A;  2YTG A;  1YFH A;  2EQ0 A;  5FLX C;  4F2J C;  1WJP A;  1YZ9 A;  3BGH A;  4FK5 C;  2GPI A;  3L00 A;  2L2K B;  1IMU A;  4LF7 E;  3HQ1 A;  1KYQ A;  1ZBQ A;  3EQ1 A;  4N4R B;  4ZYH A;  3F6G A;  4J8Z A;  4L5N C;  4R2C A;  2ENH A;  1IBM E;  2EMF A;  5IT9 C;  4BS9 A;  4OX9 E;  2LV2 A;  2EE8 A;  3AV0 A;  2EOX A;  2ZM6 E;  2JY9 A;  4LF5 E;  4HTG A;  1FKA E;  2JYA A;  3IWD A;  1EH8 A;  2L8T A;  1UN6 B;  2EM5 A;  2YTE A;  5A6B D;  2E72 A;  2JWO A;  4F9A B;  2RTX A;  5A2Q C;  2CSH A;  4O43 A;  3DF6 A;  3BBG A;  3QG5 C;  1N34 E;  3THO B;  4DR4 E;  2CTD A;  3KWR A;  2FGG A;  2J7J A;  4TUG A;  3VYX A;  1B69 A;  4DV1 E;  2L3C A;  2HC5 A;  2EOS A;  2EPU A;  3JU0 A;  2MC5 A;  2ODR C;  2EQ3 A;  4RHB B;  2YTP A;  4LFC E;  4B3R E;  1JK1 A;  1MGT A;  4JI0 E;  2EPR A;  2EP3 A;  1ZBT A;  2CT1 A;  3DJW A;  2LTR A;  1GZ6 A;  4JI8 E;  4WPY A;  4YY3 E;  4NXM E;  2F4V E;  2R76 A;  2N3H A;  2EPX A;  2YTD A;  2UXC E;  1UBD C;  1X5W A;  4B3S E;  2ENC A;  2JP9 A;  2I13 A;  2EMK A;  2YRK A;  4DMI A;  1A1H A;  4TUI A;  3C6M A; 
#chains in the Genus database with same CATH homology
 4R2R A;  2EN6 A;  5KL3 A;  2ENA A;  1JK2 A;  2EMH A;  5KL6 A;  2EM8 A;  2EOE A;  4R2P A;  4R2S A;  2WCC 3;  4WSG A;  3UK3 C;  2EPZ A;  2EMG A;  1A1I A;  2ELZ A;  5KL5 A;  2ADR A;  2EOQ A;  2EMC A;  2YTJ A;  4R2A A;  2EOI A;  2EM3 A;  2BB8 A;  2EOF A;  1NCS A;  2YTQ A;  2EM7 A;  4GZN C;  2DGC A;  2EOO A;  4F6N A;  4R2D A;  2EMX A;  2YRM A;  1RMD A;  1TF3 A;  1A1F A;  4M9V C;  2EPC A;  2EN3 A;  3MHS C;  4R2Q A;  3EPJ A;  2JPA A;  2WBU A;  2MKN A;  2YSP A;  2EN1 A;  2EMB A;  2EM2 A;  2YTG A;  2EM6 A;  2EQ0 A;  5KL2 A;  3M99 B;  2EMW A;  2WBS A;  4F2J C;  1WJP A;  4IS1 C;  2DLQ A;  2EPA A;  2YRH A;  1AAY A;  2EMZ A;  4FK5 C;  2YTI A;  2EM9 A;  2YTN A;  1BB8 A;  2EJ4 A;  2EL4 A;  2EMI A;  4X9J A;  2EM4 A;  3EPL A;  1Z1B A;  1F2I G;  2GLI A;  1A1L A;  1YUI A;  1P47 A;  1X3C A;  2EL6 A;  4R2C A;  2ENH A;  2EMF A;  1X6H A;  2EN4 A;  2MDG A;  2LV2 A;  1BBO A;  2EE8 A;  1KJK A;  2EOJ A;  2YTF A;  2YTO A;  2DLK A;  2LVH A;  2EQ1 A;  2EOX A;  5KL7 A;  2EOH A;  1TN9 A;  1ZR9 A;  2EN7 A;  2R1F A;  1UN6 B;  2EM5 A;  2EM0 A;  2YTE A;  1YSA C;  2E72 A;  2EN2 A;  3MHH C;  2YU8 A;  2LT7 A;  1ZU1 A;  2YU5 A;  2M9A A;  2CSH A;  1A1G A;  2LO3 A;  2GHF A;  1X6E A;  1MEY C;  2VRD A;  2CTD A;  1G2F C;  1TF6 A;  2EPP A;  2J7J A;  1A1K A;  1A1J A;  2MKD A;  2EOM A;  1B69 A;  3EPK A;  2EOS A;  2EPU A;  4F6M A;  1LLM C;  1ZAA C;  1G2D C;  2EQ3 A;  4IJD A;  3VHT B;  2D9H A;  2WBT A;  2YTP A;  2RSI A;  2EML A;  1JK1 A;  2DMI A;  2EMA A;  2EPR A;  2EP3 A;  2CT1 A;  1DGC A;  2EOY A;  2DRP A;  2RPC A;  2EOZ A;  2EN8 A;  2EMY A;  2EOR A;  2HGH A;  2LCE A;  2EPX A;  2YTD A;  2YSO A;  1UBD C;  1X5W A;  2ENC A;  2JP9 A;  2PRT A;  2I13 A;  2EMK A;  2YRK A;  2EL5 A;  3EPH A;  2NAB A;  2A25 A;  1A1H A;  5KL4 A;  4R2E A;  2ELY A;  1X6F A;  1YUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...