1WJPA

Solution structure of zf-c2h2 domains from human zinc finger protein 295
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
107
Chain Sequence
GSSGSSGASPVENKEVYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKCEYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMAPTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of zf-C2H2 domains from human Zinc finger protein 295
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Zinc finger protein 295
total genus 18
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18450 zf_C2H2_6 Zinc Finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA02
2BB8A 2EOXA 2GHFA 2HGHA 2EOZA 2EOOA 1ZR9A 4R2RA 1G2FC 1BBOA 2VRDA 2EOMA 2EMWA 2EQ1A 2EMLA 2EE8A 4R2DA 2EMAA 2EM7A 2EMGA 2RPCA 1G2DC 2EPRA 1YUJA 2EN4A 2EN7A 4IJDA 1UBDC 4R2QA 2EMBA 2EQ3A 2EM6A 2EM4A 2YTNA 2EPZA 2EM8A 2EOFA 4R2CA 4R2PA 4IS1C 3EPJA 2ENCA 1Z1BA 2EOJA 2EMYA 2WBTA 1ZAAC 2JPAA 2YSOA 3VHTB 2YTPA 2YRHA 1X6HA 1X6FA 1LLMC 2EMCA 4WSGA 2YSPA 4R2SA 2WBUA 2EQ0A 2EM3A 2ADRA 2EL4A 2LCEA 1UN6B 2EPPA 3EPHA 1KJKA 2PRTA 3EPLA 1P47A 1AAYA 2CT1A 1DGCA 2LVHA 2ELZA 1JK1A 2A25A 2EMHA 1B69A 5KL4A 2YTJA 1A1JA 1F2IG 2EMFA 4R2EA 2DRPA 2EN6A 2JP9A 2EN3A 3M99B 2EOQA 2YRMA 2E72A 1X5WA 2WBSA 2EOYA 2EPCA 2ELYA 2YU5A 1A1FA 2NABA 1RMDA 2EPUA 5KL3A 5KL6A 3MHSC 1BB8A 2EOSA 2EPAA 2GLIA 2R1FA 2MKNA 2YRKA 1A1HA 2WCC3 4GZNC 2DLQA 2CSHA 2EJ4A 3MHHC 5KL7A 1X3CA 2EOHA 4R2AA 1TF6A 1YUIA 2ENAA 2EMXA 4X9JA 2EMZA 1TF3A 2MKDA 5KL5A 2YTIA 4M9VC 2EP3A 2J7JA 4F2JC 2YTOA 3UK3C 2EMKA 2D9HA 2EM0A 2MDGA 1JK2A 1X6EA 2LT7A 1YSAC 2LV2A 2RSIA 1NCSA 2I13A 2EN2A 2YTQA 2EOIA 1A1GA 2EL5A 1ZU1A 2YTDA 2DGCA 1A1LA 2CTDA 2EN8A 2EN1A 2EM5A 2M9AA 2YTEA 4FK5C 1A1KA 2YU8A 1MEYC 2DLKA 2EOEA 5KL2A 2EL6A 2ENHA 2LO3A 2EORA 2EM9A 2YTFA 1A1IA 3EPKA 4F6MA 2YTGA 1TN9A 2EMIA 1WJPA 2EPXA 2EM2A 2DMIA 4F6NA
chains in the Genus database with same CATH superfamily
3AV0A 3HPZA 4N4RB 2GHFA 1X48A 1ZR9A 5IXMB 2LUPB 3VYXA 2JOXA 3AUZA 2EE8A 2L2MA 4P7DA 1KYQA 1G2DC 2RPCA 1RC7A 2BBGA 4O43A 4IJDA 4WFTA 2EM4A 4WYQB 2JXPA 4R2PA 4DR6E 2RS7A 4IS1C 2NUFA 4WSPA 4BHBA 3LLHA 3VYYA 2JPAA 2L3JA 1IQOA 1LLMC 3C6MA 1FKAE 5AE1A 4R2SA 2DMYA 2KOUA 2WBUA 2EQ0A 4X66E 2ODRC 2EPPA 1KJKA 5A6BD 2UU9E 5AASA 3C4TA 5LMNE 2VQEE 2HJJA 3HPSA 2LBSB 1WHNA 5AC5A 2FTXB 4LFBE 4DV7E 4R2EA 2EN3A 2V89A 2WBSA 2L2NA 5A69A 2B3TB 3P1XA 2EPNA 2YU5A 4R03A 5KL6A 3MHSC 1N36E 1BB8A 2YZTA 3J81C 2FV4B 2H36X 4O24A 3K6QA 3JAMC 4GZNC 2DLQA 2JYAA 1IBLE 2E1MA 5KL7A 1X3CA 3KZYA 4RH8A 4R2AA 4X9JA 5LLQA 1IBKE 1TF3A 4BS9A 5KL5A 4M9VC 2K7IA 1PKPA 3J7AG 1L4SA 2MC5A 1JK2A 5A6AA 4BC9A 4BBYA 1NCSA 2YTQA 4HEIA 5IWAE 2EOIA 3BF2A 4KHPE 2M9AA 1BBGA 2YTEA 1A1KA 1MEYC 2EOEA 5KL2A 4P78A 4LF5E 1ZBQA 1A1IA 3KZZA 2B7TA 1TN9A 1T4LB 1AH5A 4JI8E 2HHHE 1GTKA 1J26A 2V86A 2DMIA 3FIGA 3F6HA 4DV2E 1T38A 4F6NA 2NUEA 2BB8A 2EWLA 3HQ1A 4DMIA 3C4BA 3EQ1A 2VRDA 4LTYA 1QU6A 3TQMA 2EMLA 4X65E 2UXBE 4R2DA 5A6BA 1YPNA 5BR8E 2EMAA 2EM7A 4M30A 2EPRA 2B9DA 2EN4A 4R2QA 2EMBA 2EQ3A 1EH8A 2EM6A 3T1YE 3RMPA 2YTNA 2EPZA 4JI3E 2UUAE 4R2CA 1XMQE 2LJHA 1T39A 3EPJA 2LRSA 4OOGC 5CFFE 2EMYA 3HXLA 1YFHA 1T4NA 4WX9A 4LFAE 2YTPA 3THNA 2YRHA 1X6HA 5LL6R 4JI5E 2F8BA 2YSPA 1YZ9A 2EPKX 3JTZA 3T1HE 3ADIA 2EM3A 4L5NC 1P47A 2ELZA 2N8XA 2EMHA 1MGTA 1B69A 4OX9E 2YTJA 2EMFA 2V8QB 2EN6A 3M99B 2RTXA 2YRMA 4X62E 3ECRA 4LF4E 5IV8B 2JVAA 4X64E 1HR0E 1UHZA 1RMDA 2EPUA 3OTOE 1N33E 2L33A 1GZ6A 2EPAA 4DKKA 2R1FA 4M0VA 4BC7A 4ZYDA 2GLIA 2WCC3 2B7VA 1XNQE 4JI7E 2EPMX 1I94E 1EKZA 4BCAA 1PJSA 1WRJA 2EMZA 4DV1E 2MKDA 2YTIA 4DV5E 2D9HA 1IQSA 4ZYHA 2EM0A 2MDGA 1HNZE 4LFCE 5LMUE 1YSAC 1GQEA 2UXDE 4JV5E 4YHHE 2I13A 2F4VE 1A1LA 2EN1A 2EN8A 2MC6A 1YYOA 4YY3E 4FK5C 2DLKA 3L00A 3MSWA 2EL6A 1DQ3A 2ENHA 2EM9A 4DR7E 3BBGA 4Q28A 2EPOA 1EH7A 1PJQA 2MDRA 4GKJE 2M7QA 3H09A 2LMZA 2EM2A 2JR1A 2LE2A 3BGHA 3KWRA 2HGHA 2EOOA 4L8NA 4KWYA 4R2RA 1G2FC 4GEQB 1X47A 2NA2A 2EOMA 2EMWA 4JI4E 2LUQA 1J5EE 2JY9A 4RHBB 1YUJA 2UUBE 4LF6E 1UBDC 4O5GA 2LJUA 2UUCE 5IT9C 2ENCA 1Z1BA 2EOJA 1XMOE 2WBTA 1ZAAC 5DNYA 2M1SA 3VHTB 2IHR1 3ADLA 5AC4A 1RQ0A 1N3GA 4DR4E 2EL4A 1N32E 2R76A 2PRTA 1PDAA 2V87A 1FJGE 2CT1A 1DGCA 4TUGA 1O0WA 2LVHA 1N34E 1JK1A 1HNWE 2A25A 4JI6E 1UILA 1A1JA 4I8OA 2JP9A 4JI1E 3C6KA 2V88A 2EOQA 4F54A 2E72A 1X5WA 4DV6E 4AQYE 2RQLA 4ZYEA 2LTSA 2EPCA 3ADJA 2UXCE 1IMUA 5KL3A 2EPLX 4KZSA 4NXNE 2MKNA 2YRKA 3VK6A 1SFEA 5A6JA 3MHHC 4DUYE 2EOHA 2ENAA 4J8ZA 2EMXA 4DV0E 3ZOQB 4M2ZA 2EP3A 2J7JA 4LU9A 2JOBA 3DF6A 3BIDA 3UK3C 2FGGA 3OMLA 4WXCA 2Q8UA 2L8TA 2LT7A 4BMJA 3IWBA 2RSIA 4NHRA 2EN2A 1A1GA 2EL5A 3THOB 2CTDA 1STUA 2LTRA 4DUZE 2EZ6A 2YWQA 4WPYA 1ZBTA 4WXDA 5A2QC 2L6MA 2EORA 3J80C 1NEIA 2L2KB 3HTXA 4LF7E 5AE3A 3EPKA 4B3RE 1DI2A 2GPIA 4MLVA 2RSMA 2VQFE 2G7HA 3F6GA 4F9AB 2EOXA 5TSEA 2EOZA 1BBOA 5T6JA 4F9CB 2EQ1A 2CPNA 2EMGA 4B3SE 4B3ME 2EN7A 2L92A 4GKKE 2EM8A 2EOFA 2DSYA 3QG5C 1SR9A 4O4KA 1IBME 2ZM6E 4DV4E 4DR1E 2YSOA 2YT4A 2WZOA 5F3WA 4HTGA 2KHXA 1XNRE 4DR2E 1X6FA 4X8WA 2EMCA 4DR5E 4WSGA 2JWOA 1HNXE 2ADRA 2LCEA 1UN6B 3EPHA 2I9IA 4TUIA 2E5LE 3EPLA 1AAYA 2RS6A 5KL4A 4F9BB 3ADGA 1F2IG 3JU0A 1QNTA 2DRPA 5A6KA 4JI0E 4NZVA 3IWDA 2EOYA 4Q35B 4DV3E 2ELYA 2N3HA 1A1FA 4K0KE 2NABA 2L3CA 2EOSA 2K4VA 1T4OA 4NXME 1A1HA 4BHCA 2V85A 2CSHA 2EJ4A 4MLQA 4JYAE 4LF9E 1TF6A 2DB2A 2DIXA 1YUIA 2ODRD 2M4IA 2HC5A 4B3TE 4F2JC 2YTOA 1YYKA 2EMKA 1X6EA 1PJTA 4LF8E 2LV2A 2VE7C 4DR3E 2YPNA 1ZU1A 2YTDA 1WXRA 2DGCA 2KONA 3LMLA 2EM5A 5ADZA 4ZYGA 1EH6A 2YU8A 5FLXC 3DJWA 2NUGA 4JI2E 2N3GA 2LO3A 1WHQA 2YTFA 1X49A 3IWCA 3J7Yp 4F6MA 2YTGA 2EMIA 1WJPA 2EPXA 2V83A 2VF1A 5AE2A 1YYWA 4R8OA
chains in the Genus database with same CATH topology
2BB8A 2EOXA 2GHFA 2HGHA 2EOZA 2EOOA 1ZR9A 4R2RA 1G2FC 1BBOA 2VRDA 2EOMA 2EMWA 2EQ1A 2EMLA 2EE8A 4R2DA 2EMAA 2EM7A 2EMGA 2RPCA 1G2DC 2EPRA 1YUJA 2EN4A 2EN7A 4IJDA 1UBDC 4R2QA 2EMBA 2EQ3A 2EM6A 2EM4A 2YTNA 2EPZA 2EM8A 2EOFA 4R2CA 4R2PA 4IS1C 3EPJA 2ENCA 1Z1BA 2EOJA 2EMYA 2WBTA 1ZAAC 2JPAA 2YSOA 3VHTB 2YTPA 2YRHA 1X6HA 1X6FA 1LLMC 2EMCA 4WSGA 2YSPA 4R2SA 2WBUA 2EQ0A 2EM3A 2ADRA 2EL4A 2LCEA 1UN6B 2EPPA 3EPHA 1KJKA 2PRTA 3EPLA 1P47A 1AAYA 2CT1A 1DGCA 2LVHA 2ELZA 1JK1A 2A25A 2EMHA 1B69A 5KL4A 2YTJA 1A1JA 1F2IG 2EMFA 4R2EA 2DRPA 2EN6A 2JP9A 2EN3A 3M99B 2EOQA 2YRMA 2E72A 1X5WA 2WBSA 2EOYA 2EPCA 2ELYA 2YU5A 1A1FA 2NABA 1RMDA 2EPUA 5KL3A 5KL6A 3MHSC 1BB8A 2EOSA 2EPAA 2GLIA 2R1FA 2MKNA 2YRKA 1A1HA 2WCC3 4GZNC 2DLQA 2CSHA 2EJ4A 3MHHC 5KL7A 1X3CA 2EOHA 4R2AA 1TF6A 1YUIA 2ENAA 2EMXA 4X9JA 2EMZA 1TF3A 2MKDA 5KL5A 2YTIA 4M9VC 2EP3A 2J7JA 4F2JC 2YTOA 3UK3C 2EMKA 2D9HA 2EM0A 2MDGA 1JK2A 1X6EA 2LT7A 1YSAC 2LV2A 2RSIA 1NCSA 2I13A 2EN2A 2YTQA 2EOIA 1A1GA 2EL5A 1ZU1A 2YTDA 2DGCA 1A1LA 2CTDA 2EN8A 2EN1A 2EM5A 2M9AA 2YTEA 4FK5C 1A1KA 2YU8A 1MEYC 2DLKA 2EOEA 5KL2A 2EL6A 2ENHA 2LO3A 2EORA 2EM9A 2YTFA 1A1IA 3EPKA 4F6MA 2YTGA 1TN9A 2EMIA 1WJPA 2EPXA 2EM2A 2DMIA 4F6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BB8 A;  2EOX A;  2GHF A;  2HGH A;  2EOZ A;  2EOO A;  1ZR9 A;  4R2R A;  1G2F C;  1BBO A;  2VRD A;  2EOM A;  2EMW A;  2EQ1 A;  2EML A;  2EE8 A;  4R2D A;  2EMA A;  2EM7 A;  2EMG A;  2RPC A;  1G2D C;  2EPR A;  1YUJ A;  2EN4 A;  2EN7 A;  4IJD A;  1UBD C;  4R2Q A;  2EMB A;  2EQ3 A;  2EM6 A;  2EM4 A;  2YTN A;  2EPZ A;  2EM8 A;  2EOF A;  4R2C A;  4R2P A;  4IS1 C;  3EPJ A;  2ENC A;  1Z1B A;  2EOJ A;  2EMY A;  2WBT A;  1ZAA C;  2JPA A;  2YSO A;  3VHT B;  2YTP A;  2YRH A;  1X6H A;  1X6F A;  1LLM C;  2EMC A;  4WSG A;  2YSP A;  4R2S A;  2WBU A;  2EQ0 A;  2EM3 A;  2ADR A;  2EL4 A;  2LCE A;  1UN6 B;  2EPP A;  3EPH A;  1KJK A;  2PRT A;  3EPL A;  1P47 A;  1AAY A;  2CT1 A;  1DGC A;  2LVH A;  2ELZ A;  1JK1 A;  2A25 A;  2EMH A;  1B69 A;  5KL4 A;  2YTJ A;  1A1J A;  1F2I G;  2EMF A;  4R2E A;  2DRP A;  2EN6 A;  2JP9 A;  2EN3 A;  3M99 B;  2EOQ A;  2YRM A;  2E72 A;  1X5W A;  2WBS A;  2EOY A;  2EPC A;  2ELY A;  2YU5 A;  1A1F A;  2NAB A;  1RMD A;  2EPU A;  5KL3 A;  5KL6 A;  3MHS C;  1BB8 A;  2EOS A;  2EPA A;  2GLI A;  2R1F A;  2MKN A;  2YRK A;  1A1H A;  2WCC 3;  4GZN C;  2DLQ A;  2CSH A;  2EJ4 A;  3MHH C;  5KL7 A;  1X3C A;  2EOH A;  4R2A A;  1TF6 A;  1YUI A;  2ENA A;  2EMX A;  4X9J A;  2EMZ A;  1TF3 A;  2MKD A;  5KL5 A;  2YTI A;  4M9V C;  2EP3 A;  2J7J A;  4F2J C;  2YTO A;  3UK3 C;  2EMK A;  2D9H A;  2EM0 A;  2MDG A;  1JK2 A;  1X6E A;  2LT7 A;  1YSA C;  2LV2 A;  2RSI A;  1NCS A;  2I13 A;  2EN2 A;  2YTQ A;  2EOI A;  1A1G A;  2EL5 A;  1ZU1 A;  2YTD A;  2DGC A;  1A1L A;  2CTD A;  2EN8 A;  2EN1 A;  2EM5 A;  2M9A A;  2YTE A;  4FK5 C;  1A1K A;  2YU8 A;  1MEY C;  2DLK A;  2EOE A;  5KL2 A;  2EL6 A;  2ENH A;  2LO3 A;  2EOR A;  2EM9 A;  2YTF A;  1A1I A;  3EPK A;  4F6M A;  2YTG A;  1TN9 A;  2EMI A;  1WJP A;  2EPX A;  2EM2 A;  2DMI A;  4F6N A; 
#chains in the Genus database with same CATH topology
 3AV0 A;  3HPZ A;  4N4R B;  2GHF A;  1X48 A;  1ZR9 A;  5IXM B;  2LUP B;  3VYX A;  2JOX A;  3AUZ A;  2EE8 A;  2L2M A;  4P7D A;  1KYQ A;  1G2D C;  2RPC A;  1RC7 A;  2BBG A;  4O43 A;  4IJD A;  4WFT A;  2EM4 A;  4WYQ B;  2JXP A;  4R2P A;  4DR6 E;  2RS7 A;  4IS1 C;  2NUF A;  4WSP A;  4BHB A;  3LLH A;  3VYY A;  2JPA A;  2L3J A;  1IQO A;  1LLM C;  3C6M A;  1FKA E;  5AE1 A;  4R2S A;  2DMY A;  2KOU A;  2WBU A;  2EQ0 A;  4X66 E;  2ODR C;  2EPP A;  1KJK A;  5A6B D;  2UU9 E;  5AAS A;  3C4T A;  5LMN E;  2VQE E;  2HJJ A;  3HPS A;  2LBS B;  1WHN A;  5AC5 A;  2FTX B;  4LFB E;  4DV7 E;  4R2E A;  2EN3 A;  2V89 A;  2WBS A;  2L2N A;  5A69 A;  2B3T B;  3P1X A;  2EPN A;  2YU5 A;  4R03 A;  5KL6 A;  3MHS C;  1N36 E;  1BB8 A;  2YZT A;  3J81 C;  2FV4 B;  2H36 X;  4O24 A;  3K6Q A;  3JAM C;  4GZN C;  2DLQ A;  2JYA A;  1IBL E;  2E1M A;  5KL7 A;  1X3C A;  3KZY A;  4RH8 A;  4R2A A;  4X9J A;  5LLQ A;  1IBK E;  1TF3 A;  4BS9 A;  5KL5 A;  4M9V C;  2K7I A;  1PKP A;  3J7A G;  1L4S A;  2MC5 A;  1JK2 A;  5A6A A;  4BC9 A;  4BBY A;  1NCS A;  2YTQ A;  4HEI A;  5IWA E;  2EOI A;  3BF2 A;  4KHP E;  2M9A A;  1BBG A;  2YTE A;  1A1K A;  1MEY C;  2EOE A;  5KL2 A;  4P78 A;  4LF5 E;  1ZBQ A;  1A1I A;  3KZZ A;  2B7T A;  1TN9 A;  1T4L B;  1AH5 A;  4JI8 E;  2HHH E;  1GTK A;  1J26 A;  2V86 A;  2DMI A;  3FIG A;  3F6H A;  4DV2 E;  1T38 A;  4F6N A;  2NUE A;  2BB8 A;  2EWL A;  3HQ1 A;  4DMI A;  3C4B A;  3EQ1 A;  2VRD A;  4LTY A;  1QU6 A;  3TQM A;  2EML A;  4X65 E;  2UXB E;  4R2D A;  5A6B A;  1YPN A;  5BR8 E;  2EMA A;  2EM7 A;  4M30 A;  2EPR A;  2B9D A;  2EN4 A;  4R2Q A;  2EMB A;  2EQ3 A;  1EH8 A;  2EM6 A;  3T1Y E;  3RMP A;  2YTN A;  2EPZ A;  4JI3 E;  2UUA E;  4R2C A;  1XMQ E;  2LJH A;  1T39 A;  3EPJ A;  2LRS A;  4OOG C;  5CFF E;  2EMY A;  3HXL A;  1YFH A;  1T4N A;  4WX9 A;  4LFA E;  2YTP A;  3THN A;  2YRH A;  1X6H A;  5LL6 R;  4JI5 E;  2F8B A;  2YSP A;  1YZ9 A;  2EPK X;  3JTZ A;  3T1H E;  3ADI A;  2EM3 A;  4L5N C;  1P47 A;  2ELZ A;  2N8X A;  2EMH A;  1MGT A;  1B69 A;  4OX9 E;  2YTJ A;  2EMF A;  2V8Q B;  2EN6 A;  3M99 B;  2RTX A;  2YRM A;  4X62 E;  3ECR A;  4LF4 E;  5IV8 B;  2JVA A;  4X64 E;  1HR0 E;  1UHZ A;  1RMD A;  2EPU A;  3OTO E;  1N33 E;  2L33 A;  1GZ6 A;  2EPA A;  4DKK A;  2R1F A;  4M0V A;  4BC7 A;  4ZYD A;  2GLI A;  2WCC 3;  2B7V A;  1XNQ E;  4JI7 E;  2EPM X;  1I94 E;  1EKZ A;  4BCA A;  1PJS A;  1WRJ A;  2EMZ A;  4DV1 E;  2MKD A;  2YTI A;  4DV5 E;  2D9H A;  1IQS A;  4ZYH A;  2EM0 A;  2MDG A;  1HNZ E;  4LFC E;  5LMU E;  1YSA C;  1GQE A;  2UXD E;  4JV5 E;  4YHH E;  2I13 A;  2F4V E;  1A1L A;  2EN1 A;  2EN8 A;  2MC6 A;  1YYO A;  4YY3 E;  4FK5 C;  2DLK A;  3L00 A;  3MSW A;  2EL6 A;  1DQ3 A;  2ENH A;  2EM9 A;  4DR7 E;  3BBG A;  4Q28 A;  2EPO A;  1EH7 A;  1PJQ A;  2MDR A;  4GKJ E;  2M7Q A;  3H09 A;  2LMZ A;  2EM2 A;  2JR1 A;  2LE2 A;  3BGH A;  3KWR A;  2HGH A;  2EOO A;  4L8N A;  4KWY A;  4R2R A;  1G2F C;  4GEQ B;  1X47 A;  2NA2 A;  2EOM A;  2EMW A;  4JI4 E;  2LUQ A;  1J5E E;  2JY9 A;  4RHB B;  1YUJ A;  2UUB E;  4LF6 E;  1UBD C;  4O5G A;  2LJU A;  2UUC E;  5IT9 C;  2ENC A;  1Z1B A;  2EOJ A;  1XMO E;  2WBT A;  1ZAA C;  5DNY A;  2M1S A;  3VHT B;  2IHR 1;  3ADL A;  5AC4 A;  1RQ0 A;  1N3G A;  4DR4 E;  2EL4 A;  1N32 E;  2R76 A;  2PRT A;  1PDA A;  2V87 A;  1FJG E;  2CT1 A;  1DGC A;  4TUG A;  1O0W A;  2LVH A;  1N34 E;  1JK1 A;  1HNW E;  2A25 A;  4JI6 E;  1UIL A;  1A1J A;  4I8O A;  2JP9 A;  4JI1 E;  3C6K A;  2V88 A;  2EOQ A;  4F54 A;  2E72 A;  1X5W A;  4DV6 E;  4AQY E;  2RQL A;  4ZYE A;  2LTS A;  2EPC A;  3ADJ A;  2UXC E;  1IMU A;  5KL3 A;  2EPL X;  4KZS A;  4NXN E;  2MKN A;  2YRK A;  3VK6 A;  1SFE A;  5A6J A;  3MHH C;  4DUY E;  2EOH A;  2ENA A;  4J8Z A;  2EMX A;  4DV0 E;  3ZOQ B;  4M2Z A;  2EP3 A;  2J7J A;  4LU9 A;  2JOB A;  3DF6 A;  3BID A;  3UK3 C;  2FGG A;  3OML A;  4WXC A;  2Q8U A;  2L8T A;  2LT7 A;  4BMJ A;  3IWB A;  2RSI A;  4NHR A;  2EN2 A;  1A1G A;  2EL5 A;  3THO B;  2CTD A;  1STU A;  2LTR A;  4DUZ E;  2EZ6 A;  2YWQ A;  4WPY A;  1ZBT A;  4WXD A;  5A2Q C;  2L6M A;  2EOR A;  3J80 C;  1NEI A;  2L2K B;  3HTX A;  4LF7 E;  5AE3 A;  3EPK A;  4B3R E;  1DI2 A;  2GPI A;  4MLV A;  2RSM A;  2VQF E;  2G7H A;  3F6G A;  4F9A B;  2EOX A;  5TSE A;  2EOZ A;  1BBO A;  5T6J A;  4F9C B;  2EQ1 A;  2CPN A;  2EMG A;  4B3S E;  4B3M E;  2EN7 A;  2L92 A;  4GKK E;  2EM8 A;  2EOF A;  2DSY A;  3QG5 C;  1SR9 A;  4O4K A;  1IBM E;  2ZM6 E;  4DV4 E;  4DR1 E;  2YSO A;  2YT4 A;  2WZO A;  5F3W A;  4HTG A;  2KHX A;  1XNR E;  4DR2 E;  1X6F A;  4X8W A;  2EMC A;  4DR5 E;  4WSG A;  2JWO A;  1HNX E;  2ADR A;  2LCE A;  1UN6 B;  3EPH A;  2I9I A;  4TUI A;  2E5L E;  3EPL A;  1AAY A;  2RS6 A;  5KL4 A;  4F9B B;  3ADG A;  1F2I G;  3JU0 A;  1QNT A;  2DRP A;  5A6K A;  4JI0 E;  4NZV A;  3IWD A;  2EOY A;  4Q35 B;  4DV3 E;  2ELY A;  2N3H A;  1A1F A;  4K0K E;  2NAB A;  2L3C A;  2EOS A;  2K4V A;  1T4O A;  4NXM E;  1A1H A;  4BHC A;  2V85 A;  2CSH A;  2EJ4 A;  4MLQ A;  4JYA E;  4LF9 E;  1TF6 A;  2DB2 A;  2DIX A;  1YUI A;  2ODR D;  2M4I A;  2HC5 A;  4B3T E;  4F2J C;  2YTO A;  1YYK A;  2EMK A;  1X6E A;  1PJT A;  4LF8 E;  2LV2 A;  2VE7 C;  4DR3 E;  2YPN A;  1ZU1 A;  2YTD A;  1WXR A;  2DGC A;  2KON A;  3LML A;  2EM5 A;  5ADZ A;  4ZYG A;  1EH6 A;  2YU8 A;  5FLX C;  3DJW A;  2NUG A;  4JI2 E;  2N3G A;  2LO3 A;  1WHQ A;  2YTF A;  1X49 A;  3IWC A;  3J7Y p;  4F6M A;  2YTG A;  2EMI A;  1WJP A;  2EPX A;  2V83 A;  2VF1 A;  5AE2 A;  1YYW A;  4R8O A; 
#chains in the Genus database with same CATH homology
 2BB8 A;  2EOX A;  2GHF A;  2HGH A;  2EOZ A;  2EOO A;  1ZR9 A;  4R2R A;  1G2F C;  1BBO A;  2VRD A;  2EOM A;  2EMW A;  2EQ1 A;  2EML A;  2EE8 A;  4R2D A;  2EMA A;  2EM7 A;  2EMG A;  2RPC A;  1G2D C;  2EPR A;  1YUJ A;  2EN4 A;  2EN7 A;  4IJD A;  1UBD C;  4R2Q A;  2EMB A;  2EQ3 A;  2EM6 A;  2EM4 A;  2YTN A;  2EPZ A;  2EM8 A;  2EOF A;  4R2C A;  4R2P A;  4IS1 C;  3EPJ A;  2ENC A;  1Z1B A;  2EOJ A;  2EMY A;  2WBT A;  1ZAA C;  2JPA A;  2YSO A;  3VHT B;  2YTP A;  2YRH A;  1X6H A;  1X6F A;  1LLM C;  2EMC A;  4WSG A;  2YSP A;  4R2S A;  2WBU A;  2EQ0 A;  2EM3 A;  2ADR A;  2EL4 A;  2LCE A;  1UN6 B;  2EPP A;  3EPH A;  1KJK A;  2PRT A;  3EPL A;  1P47 A;  1AAY A;  2CT1 A;  1DGC A;  2LVH A;  2ELZ A;  1JK1 A;  2A25 A;  2EMH A;  1B69 A;  5KL4 A;  2YTJ A;  1A1J A;  1F2I G;  2EMF A;  4R2E A;  2DRP A;  2EN6 A;  2JP9 A;  2EN3 A;  3M99 B;  2EOQ A;  2YRM A;  2E72 A;  1X5W A;  2WBS A;  2EOY A;  2EPC A;  2ELY A;  2YU5 A;  1A1F A;  2NAB A;  1RMD A;  2EPU A;  5KL3 A;  5KL6 A;  3MHS C;  1BB8 A;  2EOS A;  2EPA A;  2GLI A;  2R1F A;  2MKN A;  2YRK A;  1A1H A;  2WCC 3;  4GZN C;  2DLQ A;  2CSH A;  2EJ4 A;  3MHH C;  5KL7 A;  1X3C A;  2EOH A;  4R2A A;  1TF6 A;  1YUI A;  2ENA A;  2EMX A;  4X9J A;  2EMZ A;  1TF3 A;  2MKD A;  5KL5 A;  2YTI A;  4M9V C;  2EP3 A;  2J7J A;  4F2J C;  2YTO A;  3UK3 C;  2EMK A;  2D9H A;  2EM0 A;  2MDG A;  1JK2 A;  1X6E A;  2LT7 A;  1YSA C;  2LV2 A;  2RSI A;  1NCS A;  2I13 A;  2EN2 A;  2YTQ A;  2EOI A;  1A1G A;  2EL5 A;  1ZU1 A;  2YTD A;  2DGC A;  1A1L A;  2CTD A;  2EN8 A;  2EN1 A;  2EM5 A;  2M9A A;  2YTE A;  4FK5 C;  1A1K A;  2YU8 A;  1MEY C;  2DLK A;  2EOE A;  5KL2 A;  2EL6 A;  2ENH A;  2LO3 A;  2EOR A;  2EM9 A;  2YTF A;  1A1I A;  3EPK A;  4F6M A;  2YTG A;  1TN9 A;  2EMI A;  1WJP A;  2EPX A;  2EM2 A;  2DMI A;  4F6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...