1WJPA

Solution structure of zf-c2h2 domains from human zinc finger protein 295
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
107
Chain Sequence
GSSGSSGASPVENKEVYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKCEYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMAPTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Zinc finger protein 295
publication title Solution structure of zf-C2H2 domains from human Zinc finger protein 295
rcsb
source organism Homo sapiens
total genus 18
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18450 zf_C2H2_6 Zinc Finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1wjpA02
2EMWA 1ZR9A 3EPHA 2YTGA 2LV2A 2EOYA 1ZAAC 2YTFA 3VHTB 1YUJA 2MKNA 1G2FC 1BB8A 2EM3A 2RPCA 2EN4A 1X6HA 2GLIA 2YTNA 2ENHA 5KL5A 2E72A 2EMFA 2EQ3A 1TF6A 3UK3C 1TN9A 3MHHC 4R2AA 2EM4A 2ENAA 2EMHA 2EM8A 5KL7A 2DMIA 4X9JA 4F6NA 2LO3A 2ADRA 2EOMA 2YSOA 2EJ4A 1F2IG 2DLQA 4R2DA 1ZU1A 2EMXA 2YTDA 2EOXA 2EOHA 2EL4A 2YRMA 4R2SA 1A1GA 1A1HA 1JK1A 1A1IA 2DLKA 2YTQA 2YTOA 2YTEA 1P47A 1YSAC 2EM5A 2MDGA 2EN1A 2EOJA 2EMLA 4FK5C 1LLMC 2A25A 2CT1A 2EN7A 2EL5A 2GHFA 2YTIA 4R2PA 2EMIA 3MHSC 1YUIA 2EOZA 2EM7A 5KL2A 2EM0A 2EM6A 2EPPA 2JPAA 2DRPA 2ENCA 2YTPA 2EM2A 2EP3A 4IJDA 4IS1C 2RSIA 1A1JA 2EMKA 2EQ1A 2EMYA 4R2RA 1TF3A 1JK2A 1NCSA 2M9AA 1DGCA 2LVHA 2WBSA 2JP9A 2EMBA 1A1LA 2EOSA 2EPCA 2WBTA 1X6EA 2PRTA 2EMZA 2LCEA 2EMGA 2YTJA 2R1FA 4F2JC 1WJPA 1RMDA 4R2CA 5KL3A 4WSGA 2EOIA 3EPJA 2D9HA 2CTDA 2EOQA 1B69A 1UBDC 2I13A 2EPRA 2DGCA 4GZNC 2NABA 2EN8A 2WCC3 5KL6A 2EOEA 2EQ0A 1A1KA 2MKDA 2EPZA 2EOFA 2EPAA 1UN6B 1G2DC 2EM9A 2YRKA 4F6MA 5KL4A 4M9VC 2EL6A 3EPLA 1Z1BA 2EPXA 2EMCA 2ELZA 1MEYC 1AAYA 2HGHA 2VRDA 2EORA 1BBOA 2EN6A 2J7JA 2ELYA 1X6FA 2EN2A 2EN3A 4R2EA 2CSHA 2YRHA 1A1FA 2EMAA 2YSPA 1X3CA 2BB8A 2YU8A 2EPUA 2WBUA 3M99B 3EPKA 1KJKA 2EE8A 4R2QA 2YU5A 1X5WA 2LT7A 2EOOA
chains in the Genus database with same CATH superfamily
2EMWA 4L8NA 2UXDE 1N32E 2YTFA 3VHTB 2NUGA 2EPLX 4LF8E 1FJGE 4LTYA 2EM3A 3VK6A 2JOXA 5LLQA 4RHBB 2L3JA 3ADLA 2GLIA 3OMLA 2EQ3A 1EH8A 2UXCE 4WYQB 4F9CB 4O43A 2EM4A 2ENAA 4NXNE 2DMIA 5BR8E 4X9JA 5AE2A 2ODRC 4M0VA 2MC6A 1IBME 1F2IG 2DLQA 1ZU1A 4X65E 2K7IA 2L3CA 2JYAA 2B7TA 4R2SA 2HJJA 4TUIA 1A1HA 2DLKA 2YTEA 5AE1A 1P47A 1N36E 2EN1A 2L2MA 2EMLA 2CT1A 3ADIA 5ADZA 2YTIA 4R2PA 2FV4B 2B7VA 4WFTA 5KL2A 2EM0A 2JPAA 1T4NA 2DRPA 4ZYEA 3KZZA 2EP3A 4IS1C 1STUA 2EQ1A 2B9DA 1TF3A 2N3GA 1N3GA 1NCSA 4F9BB 2JXPA 2JP9A 3T1YE 2WZOA 2I9IA 3L00A 4BC7A 4DR2E 3THOB 2EMZA 3LLHA 2ODRD 2R1FA 1N34E 3VYYA 4WSGA 2HC5A 2LJHA 3HTXA 3C4TA 2D9HA 2CTDA 2EOQA 5A6KA 2ZM6E 5KL6A 3FIGA 4DR6E 1GZ6A 2JOBA 1YYOA 2EPZA 2EOFA 2EPAA 5LL6R 4WX9A 1G2DC 4B3RE 4F6MA 2LRSA 2JVAA 3JAMC 2EPXA 4GKJE 5IWAE 4ZYHA 1T38A 3QG5C 4JI5E 1N33E 2HGHA 2EN6A 4HTGA 2EN2A 4NXME 2EMAA 2DSYA 2JY9A 3C6KA 4ZYGA 2VF1A 2BB8A 4HEIA 4B3ME 4O5GA 4DV3E 3MSWA 2YU5A 2LT7A 2YWQA 4X8WA 2EOOA 1HNZE 2YPNA 3ZOQB 2LTRA 4BS9A 1YYKA 3OTOE 1ZR9A 4X66E 3EPHA 2YTGA 2UXBE 1ZAAC 1YUJA 5A6JA 3C4BA 3J7AG 4DV1E 1WHQA 2L8TA 5AASA 3T1HE 4DR7E 1X48A 2M7QA 3MHHC 2MC5A 1EH6A 1HR0E 4O24A 2BBGA 3HXLA 4F9AB 1SFEA 2EJ4A 4AQYE 4GEQB 3ECRA 3IWCA 2B3TB 4DKKA 2NA2A 3AUZA 2EOXA 1JK1A 1A1IA 4MLQA 2YTQA 2YTOA 1YSAC 1LLMC 2YZTA 2A25A 2EPMX 2EN7A 3BGHA 4LFCE 2GHFA 2V86A 1FKAE 1YUIA 4DUYE 2EM7A 3BIDA 2ENCA 1T4LB 2EM2A 1YYWA 1XNQE 4JI3E 4IJDA 2RSIA 2UU9E 1A1JA 4DR5E 3KZYA 2HHHE 2EMKA 2DMYA 2L2KB 4K0KE 4WXCA 2WBTA 4DMIA 2PRTA 1DI2A 4WXDA 1T39A 2EMGA 2YTJA 5FLXC 4F2JC 1WJPA 2K4VA 5TSEA 2UUCE 2V83A 2VQFE 4B3SE 2EOIA 4JI8E 3EPJA 1RQ0A 2I13A 1KYQA 3HQ1A 2JR1A 2EQ0A 2MKDA 1UILA 3ADGA 2KONA 2LTSA 4J8ZA 2NUEA 4M9VC 2EL6A 1Z1BA 3BBGA 4TUGA 4BHBA 1DQ3A 1MEYC 1AAYA 2ELYA 4R2EA 2EN3A 1IQOA 2YRHA 1YFHA 2FGGA 2GPIA 4R03A 2RSMA 3JU0A 2YU8A 3EPKA 2RQLA 4LF7E 2FTXB 2YT4A 4OOGC 2LV2A 2V89A 2EOYA 2EPKX 2MKNA 4P7DA 5AC4A 1YZ9A 2EWLA 1BB8A 1QNTA 2EN4A 4B3TE 2YTNA 3BF2A 5KL5A 2EMFA 4F54A 4DR3E 1TF6A 3UK3C 2LUQA 4R2AA 4DR4E 2N3HA 3P1XA 2EMHA 5A2QC 5LMNE 2LO3A 2ADRA 1AH5A 2EOMA 5F3WA 1WRJA 2M1SA 4R2DA 2EMXA 2YTDA 4KHPE 3F6GA 1A1GA 1IMUA 4DV4E 4MLVA 1PJSA 1J26A 2KOUA 1XMOE 5AE3A 2EM5A 2MDGA 2EOJA 5IV8B 4YHHE 2EPOA 2EL5A 2EMIA 3MHSC 2EOZA 4BHCA 2EM6A 2EPPA 1BBGA 4NHRA 2L92A 1PJTA 4BBYA 1PKPA 1I94E 4R2RA 4LF6E 1NEIA 1EKZA 1JK2A 4ZYDA 2LVHA 2WBSA 2V85A 4O4KA 2EPCA 4BC9A 3VYXA 2H36X 4JI6E 2F4VE 3THNA 4LFBE 4YY3E 2EPNA 5A6BD 5A6AA 2DIXA 4I8OA 4OX9E 5A69A 5IXMB 4M30A 1HNWE 1UHZA 3TQMA 4DV7E 2L33A 2EN8A 2NABA 1ZBTA 4Q28A 2WCC3 5T6JA 2LJUA 3J81C 2V87A 5IT9C 2YRKA 3EPLA 2RS7A 3K6QA 4L5NC 3RMPA 2J7JA 4NZVA 1X6FA 3H09A 4X64E 4LF5E 1A1FA 4RH8A 2YSPA 3LMLA 1XNRE 2LBSB 3HPZA 5A6BA 2V8QB 4LF9E 3AV0A 4Q35B 3M99B 4BCAA 1PDAA 2WBUA 1KJKA 4R2QA 1X5WA 4R8OA 2MDRA 3HPSA 4DV2E 1GTKA 4P78A 1XMQE 4JYAE 2VE7C 2L6MA 1G2FC 2F8BA 2N8XA 2UUAE 4DR1E 2RPCA 2RS6A 2VQEE 1X6HA 2ENHA 2L2NA 2E72A 4JI1E 2CPNA 1TN9A 5CFFE 3ADJA 3J80C 1MGTA 4KWYA 2EM8A 5KL7A 2LE2A 4F6NA 1IQSA 3F6HA 4JI2E 2JWOA 2EZ6A 3DJWA 4DV0E 1SR9A 2YSOA 1X47A 3JTZA 2RTXA 1J5EE 4WSPA 2E5LE 4JI4E 2EOHA 2EL4A 1T4OA 3EQ1A 2YRMA 1X49A 1QU6A 4WPYA 4X62E 4M2ZA 1PJQA 4DV6E 4FK5C 1IBKE 2Q8UA 4N4RB 3J7Yp 4JI0E 5DNYA 4DUZE 2YTPA 1ZBQA 2EMYA 2M9AA 1DGCA 5AC5A 2EMBA 1A1LA 2EOSA 1X6EA 2LCEA 1YPNA 1RMDA 2M4IA 4LU9A 4GKKE 4R2CA 5KL3A 2UUBE 2E1MA 2V88A 1B69A 1WXRA 1UBDC 2EPRA 4BMJA 1RC7A 2DGCA 4GZNC 1WHNA 2EOEA 5LMUE 2LMZA 1A1KA 3IWBA 1HNXE 1UN6B 1GQEA 4JV5E 2EM9A 5KL4A 1IBLE 2EMCA 2ELZA 2G7HA 3KWRA 4LFAE 1O0WA 2VRDA 2EORA 1BBOA 2KHXA 4JI7E 2CSHA 1EH7A 3IWDA 4DV5E 2R76A 4LF4E 1X3CA 1L4SA 2EPUA 3C6MA 2DB2A 2IHR1 2EE8A 2LUPB 3DF6A 2NUFA 4KZSA
chains in the Genus database with same CATH topology
2EMWA 1ZR9A 3EPHA 2YTGA 2LV2A 2EOYA 1ZAAC 2YTFA 3VHTB 1YUJA 2MKNA 1G2FC 1BB8A 2EM3A 2RPCA 2EN4A 1X6HA 2GLIA 2YTNA 2ENHA 5KL5A 2E72A 2EMFA 2EQ3A 1TF6A 3UK3C 1TN9A 3MHHC 4R2AA 2EM4A 2ENAA 2EMHA 2EM8A 5KL7A 2DMIA 4X9JA 4F6NA 2LO3A 2ADRA 2EOMA 2YSOA 2EJ4A 1F2IG 2DLQA 4R2DA 1ZU1A 2EMXA 2YTDA 2EOXA 2EOHA 2EL4A 2YRMA 4R2SA 1A1GA 1A1HA 1JK1A 1A1IA 2DLKA 2YTQA 2YTOA 2YTEA 1P47A 1YSAC 2EM5A 2MDGA 2EN1A 2EOJA 2EMLA 4FK5C 1LLMC 2A25A 2CT1A 2EN7A 2EL5A 2GHFA 2YTIA 4R2PA 2EMIA 3MHSC 1YUIA 2EOZA 2EM7A 5KL2A 2EM0A 2EM6A 2EPPA 2JPAA 2DRPA 2ENCA 2YTPA 2EM2A 2EP3A 4IJDA 4IS1C 2RSIA 1A1JA 2EMKA 2EQ1A 2EMYA 4R2RA 1TF3A 1JK2A 1NCSA 2M9AA 1DGCA 2LVHA 2WBSA 2JP9A 2EMBA 1A1LA 2EOSA 2EPCA 2WBTA 1X6EA 2PRTA 2EMZA 2LCEA 2EMGA 2YTJA 2R1FA 4F2JC 1WJPA 1RMDA 4R2CA 5KL3A 4WSGA 2EOIA 3EPJA 2D9HA 2CTDA 2EOQA 1B69A 1UBDC 2I13A 2EPRA 2DGCA 4GZNC 2NABA 2EN8A 2WCC3 5KL6A 2EOEA 2EQ0A 1A1KA 2MKDA 2EPZA 2EOFA 2EPAA 1UN6B 1G2DC 2EM9A 2YRKA 4F6MA 5KL4A 4M9VC 2EL6A 3EPLA 1Z1BA 2EPXA 2EMCA 2ELZA 1MEYC 1AAYA 2HGHA 2VRDA 2EORA 1BBOA 2EN6A 2J7JA 2ELYA 1X6FA 2EN2A 2EN3A 4R2EA 2CSHA 2YRHA 1A1FA 2EMAA 2YSPA 1X3CA 2BB8A 2YU8A 2EPUA 2WBUA 3M99B 3EPKA 1KJKA 2EE8A 4R2QA 2YU5A 1X5WA 2LT7A 2EOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMW A;  1ZR9 A;  3EPH A;  2YTG A;  2LV2 A;  2EOY A;  1ZAA C;  2YTF A;  3VHT B;  1YUJ A;  2MKN A;  1G2F C;  1BB8 A;  2EM3 A;  2RPC A;  2EN4 A;  1X6H A;  2GLI A;  2YTN A;  2ENH A;  5KL5 A;  2E72 A;  2EMF A;  2EQ3 A;  1TF6 A;  3UK3 C;  1TN9 A;  3MHH C;  4R2A A;  2EM4 A;  2ENA A;  2EMH A;  2EM8 A;  5KL7 A;  2DMI A;  4X9J A;  4F6N A;  2LO3 A;  2ADR A;  2EOM A;  2YSO A;  2EJ4 A;  1F2I G;  2DLQ A;  4R2D A;  1ZU1 A;  2EMX A;  2YTD A;  2EOX A;  2EOH A;  2EL4 A;  2YRM A;  4R2S A;  1A1G A;  1A1H A;  1JK1 A;  1A1I A;  2DLK A;  2YTQ A;  2YTO A;  2YTE A;  1P47 A;  1YSA C;  2EM5 A;  2MDG A;  2EN1 A;  2EOJ A;  2EML A;  4FK5 C;  1LLM C;  2A25 A;  2CT1 A;  2EN7 A;  2EL5 A;  2GHF A;  2YTI A;  4R2P A;  2EMI A;  3MHS C;  1YUI A;  2EOZ A;  2EM7 A;  5KL2 A;  2EM0 A;  2EM6 A;  2EPP A;  2JPA A;  2DRP A;  2ENC A;  2YTP A;  2EM2 A;  2EP3 A;  4IJD A;  4IS1 C;  2RSI A;  1A1J A;  2EMK A;  2EQ1 A;  2EMY A;  4R2R A;  1TF3 A;  1JK2 A;  1NCS A;  2M9A A;  1DGC A;  2LVH A;  2WBS A;  2JP9 A;  2EMB A;  1A1L A;  2EOS A;  2EPC A;  2WBT A;  1X6E A;  2PRT A;  2EMZ A;  2LCE A;  2EMG A;  2YTJ A;  2R1F A;  4F2J C;  1WJP A;  1RMD A;  4R2C A;  5KL3 A;  4WSG A;  2EOI A;  3EPJ A;  2D9H A;  2CTD A;  2EOQ A;  1B69 A;  1UBD C;  2I13 A;  2EPR A;  2DGC A;  4GZN C;  2NAB A;  2EN8 A;  2WCC 3;  5KL6 A;  2EOE A;  2EQ0 A;  1A1K A;  2MKD A;  2EPZ A;  2EOF A;  2EPA A;  1UN6 B;  1G2D C;  2EM9 A;  2YRK A;  4F6M A;  5KL4 A;  4M9V C;  2EL6 A;  3EPL A;  1Z1B A;  2EPX A;  2EMC A;  2ELZ A;  1MEY C;  1AAY A;  2HGH A;  2VRD A;  2EOR A;  1BBO A;  2EN6 A;  2J7J A;  2ELY A;  1X6F A;  2EN2 A;  2EN3 A;  4R2E A;  2CSH A;  2YRH A;  1A1F A;  2EMA A;  2YSP A;  1X3C A;  2BB8 A;  2YU8 A;  2EPU A;  2WBU A;  3M99 B;  3EPK A;  1KJK A;  2EE8 A;  4R2Q A;  2YU5 A;  1X5W A;  2LT7 A;  2EOO A; 
#chains in the Genus database with same CATH topology
 2EMW A;  4L8N A;  2UXD E;  1N32 E;  2YTF A;  3VHT B;  2NUG A;  2EPL X;  4LF8 E;  1FJG E;  4LTY A;  2EM3 A;  3VK6 A;  2JOX A;  5LLQ A;  4RHB B;  2L3J A;  3ADL A;  2GLI A;  3OML A;  2EQ3 A;  1EH8 A;  2UXC E;  4WYQ B;  4F9C B;  4O43 A;  2EM4 A;  2ENA A;  4NXN E;  2DMI A;  5BR8 E;  4X9J A;  5AE2 A;  2ODR C;  4M0V A;  2MC6 A;  1IBM E;  1F2I G;  2DLQ A;  1ZU1 A;  4X65 E;  2K7I A;  2L3C A;  2JYA A;  2B7T A;  4R2S A;  2HJJ A;  4TUI A;  1A1H A;  2DLK A;  2YTE A;  5AE1 A;  1P47 A;  1N36 E;  2EN1 A;  2L2M A;  2EML A;  2CT1 A;  3ADI A;  5ADZ A;  2YTI A;  4R2P A;  2FV4 B;  2B7V A;  4WFT A;  5KL2 A;  2EM0 A;  2JPA A;  1T4N A;  2DRP A;  4ZYE A;  3KZZ A;  2EP3 A;  4IS1 C;  1STU A;  2EQ1 A;  2B9D A;  1TF3 A;  2N3G A;  1N3G A;  1NCS A;  4F9B B;  2JXP A;  2JP9 A;  3T1Y E;  2WZO A;  2I9I A;  3L00 A;  4BC7 A;  4DR2 E;  3THO B;  2EMZ A;  3LLH A;  2ODR D;  2R1F A;  1N34 E;  3VYY A;  4WSG A;  2HC5 A;  2LJH A;  3HTX A;  3C4T A;  2D9H A;  2CTD A;  2EOQ A;  5A6K A;  2ZM6 E;  5KL6 A;  3FIG A;  4DR6 E;  1GZ6 A;  2JOB A;  1YYO A;  2EPZ A;  2EOF A;  2EPA A;  5LL6 R;  4WX9 A;  1G2D C;  4B3R E;  4F6M A;  2LRS A;  2JVA A;  3JAM C;  2EPX A;  4GKJ E;  5IWA E;  4ZYH A;  1T38 A;  3QG5 C;  4JI5 E;  1N33 E;  2HGH A;  2EN6 A;  4HTG A;  2EN2 A;  4NXM E;  2EMA A;  2DSY A;  2JY9 A;  3C6K A;  4ZYG A;  2VF1 A;  2BB8 A;  4HEI A;  4B3M E;  4O5G A;  4DV3 E;  3MSW A;  2YU5 A;  2LT7 A;  2YWQ A;  4X8W A;  2EOO A;  1HNZ E;  2YPN A;  3ZOQ B;  2LTR A;  4BS9 A;  1YYK A;  3OTO E;  1ZR9 A;  4X66 E;  3EPH A;  2YTG A;  2UXB E;  1ZAA C;  1YUJ A;  5A6J A;  3C4B A;  3J7A G;  4DV1 E;  1WHQ A;  2L8T A;  5AAS A;  3T1H E;  4DR7 E;  1X48 A;  2M7Q A;  3MHH C;  2MC5 A;  1EH6 A;  1HR0 E;  4O24 A;  2BBG A;  3HXL A;  4F9A B;  1SFE A;  2EJ4 A;  4AQY E;  4GEQ B;  3ECR A;  3IWC A;  2B3T B;  4DKK A;  2NA2 A;  3AUZ A;  2EOX A;  1JK1 A;  1A1I A;  4MLQ A;  2YTQ A;  2YTO A;  1YSA C;  1LLM C;  2YZT A;  2A25 A;  2EPM X;  2EN7 A;  3BGH A;  4LFC E;  2GHF A;  2V86 A;  1FKA E;  1YUI A;  4DUY E;  2EM7 A;  3BID A;  2ENC A;  1T4L B;  2EM2 A;  1YYW A;  1XNQ E;  4JI3 E;  4IJD A;  2RSI A;  2UU9 E;  1A1J A;  4DR5 E;  3KZY A;  2HHH E;  2EMK A;  2DMY A;  2L2K B;  4K0K E;  4WXC A;  2WBT A;  4DMI A;  2PRT A;  1DI2 A;  4WXD A;  1T39 A;  2EMG A;  2YTJ A;  5FLX C;  4F2J C;  1WJP A;  2K4V A;  5TSE A;  2UUC E;  2V83 A;  2VQF E;  4B3S E;  2EOI A;  4JI8 E;  3EPJ A;  1RQ0 A;  2I13 A;  1KYQ A;  3HQ1 A;  2JR1 A;  2EQ0 A;  2MKD A;  1UIL A;  3ADG A;  2KON A;  2LTS A;  4J8Z A;  2NUE A;  4M9V C;  2EL6 A;  1Z1B A;  3BBG A;  4TUG A;  4BHB A;  1DQ3 A;  1MEY C;  1AAY A;  2ELY A;  4R2E A;  2EN3 A;  1IQO A;  2YRH A;  1YFH A;  2FGG A;  2GPI A;  4R03 A;  2RSM A;  3JU0 A;  2YU8 A;  3EPK A;  2RQL A;  4LF7 E;  2FTX B;  2YT4 A;  4OOG C;  2LV2 A;  2V89 A;  2EOY A;  2EPK X;  2MKN A;  4P7D A;  5AC4 A;  1YZ9 A;  2EWL A;  1BB8 A;  1QNT A;  2EN4 A;  4B3T E;  2YTN A;  3BF2 A;  5KL5 A;  2EMF A;  4F54 A;  4DR3 E;  1TF6 A;  3UK3 C;  2LUQ A;  4R2A A;  4DR4 E;  2N3H A;  3P1X A;  2EMH A;  5A2Q C;  5LMN E;  2LO3 A;  2ADR A;  1AH5 A;  2EOM A;  5F3W A;  1WRJ A;  2M1S A;  4R2D A;  2EMX A;  2YTD A;  4KHP E;  3F6G A;  1A1G A;  1IMU A;  4DV4 E;  4MLV A;  1PJS A;  1J26 A;  2KOU A;  1XMO E;  5AE3 A;  2EM5 A;  2MDG A;  2EOJ A;  5IV8 B;  4YHH E;  2EPO A;  2EL5 A;  2EMI A;  3MHS C;  2EOZ A;  4BHC A;  2EM6 A;  2EPP A;  1BBG A;  4NHR A;  2L92 A;  1PJT A;  4BBY A;  1PKP A;  1I94 E;  4R2R A;  4LF6 E;  1NEI A;  1EKZ A;  1JK2 A;  4ZYD A;  2LVH A;  2WBS A;  2V85 A;  4O4K A;  2EPC A;  4BC9 A;  3VYX A;  2H36 X;  4JI6 E;  2F4V E;  3THN A;  4LFB E;  4YY3 E;  2EPN A;  5A6B D;  5A6A A;  2DIX A;  4I8O A;  4OX9 E;  5A69 A;  5IXM B;  4M30 A;  1HNW E;  1UHZ A;  3TQM A;  4DV7 E;  2L33 A;  2EN8 A;  2NAB A;  1ZBT A;  4Q28 A;  2WCC 3;  5T6J A;  2LJU A;  3J81 C;  2V87 A;  5IT9 C;  2YRK A;  3EPL A;  2RS7 A;  3K6Q A;  4L5N C;  3RMP A;  2J7J A;  4NZV A;  1X6F A;  3H09 A;  4X64 E;  4LF5 E;  1A1F A;  4RH8 A;  2YSP A;  3LML A;  1XNR E;  2LBS B;  3HPZ A;  5A6B A;  2V8Q B;  4LF9 E;  3AV0 A;  4Q35 B;  3M99 B;  4BCA A;  1PDA A;  2WBU A;  1KJK A;  4R2Q A;  1X5W A;  4R8O A;  2MDR A;  3HPS A;  4DV2 E;  1GTK A;  4P78 A;  1XMQ E;  4JYA E;  2VE7 C;  2L6M A;  1G2F C;  2F8B A;  2N8X A;  2UUA E;  4DR1 E;  2RPC A;  2RS6 A;  2VQE E;  1X6H A;  2ENH A;  2L2N A;  2E72 A;  4JI1 E;  2CPN A;  1TN9 A;  5CFF E;  3ADJ A;  3J80 C;  1MGT A;  4KWY A;  2EM8 A;  5KL7 A;  2LE2 A;  4F6N A;  1IQS A;  3F6H A;  4JI2 E;  2JWO A;  2EZ6 A;  3DJW A;  4DV0 E;  1SR9 A;  2YSO A;  1X47 A;  3JTZ A;  2RTX A;  1J5E E;  4WSP A;  2E5L E;  4JI4 E;  2EOH A;  2EL4 A;  1T4O A;  3EQ1 A;  2YRM A;  1X49 A;  1QU6 A;  4WPY A;  4X62 E;  4M2Z A;  1PJQ A;  4DV6 E;  4FK5 C;  1IBK E;  2Q8U A;  4N4R B;  3J7Y p;  4JI0 E;  5DNY A;  4DUZ E;  2YTP A;  1ZBQ A;  2EMY A;  2M9A A;  1DGC A;  5AC5 A;  2EMB A;  1A1L A;  2EOS A;  1X6E A;  2LCE A;  1YPN A;  1RMD A;  2M4I A;  4LU9 A;  4GKK E;  4R2C A;  5KL3 A;  2UUB E;  2E1M A;  2V88 A;  1B69 A;  1WXR A;  1UBD C;  2EPR A;  4BMJ A;  1RC7 A;  2DGC A;  4GZN C;  1WHN A;  2EOE A;  5LMU E;  2LMZ A;  1A1K A;  3IWB A;  1HNX E;  1UN6 B;  1GQE A;  4JV5 E;  2EM9 A;  5KL4 A;  1IBL E;  2EMC A;  2ELZ A;  2G7H A;  3KWR A;  4LFA E;  1O0W A;  2VRD A;  2EOR A;  1BBO A;  2KHX A;  4JI7 E;  2CSH A;  1EH7 A;  3IWD A;  4DV5 E;  2R76 A;  4LF4 E;  1X3C A;  1L4S A;  2EPU A;  3C6M A;  2DB2 A;  2IHR 1;  2EE8 A;  2LUP B;  3DF6 A;  2NUF A;  4KZS A; 
#chains in the Genus database with same CATH homology
 2EMW A;  1ZR9 A;  3EPH A;  2YTG A;  2LV2 A;  2EOY A;  1ZAA C;  2YTF A;  3VHT B;  1YUJ A;  2MKN A;  1G2F C;  1BB8 A;  2EM3 A;  2RPC A;  2EN4 A;  1X6H A;  2GLI A;  2YTN A;  2ENH A;  5KL5 A;  2E72 A;  2EMF A;  2EQ3 A;  1TF6 A;  3UK3 C;  1TN9 A;  3MHH C;  4R2A A;  2EM4 A;  2ENA A;  2EMH A;  2EM8 A;  5KL7 A;  2DMI A;  4X9J A;  4F6N A;  2LO3 A;  2ADR A;  2EOM A;  2YSO A;  2EJ4 A;  1F2I G;  2DLQ A;  4R2D A;  1ZU1 A;  2EMX A;  2YTD A;  2EOX A;  2EOH A;  2EL4 A;  2YRM A;  4R2S A;  1A1G A;  1A1H A;  1JK1 A;  1A1I A;  2DLK A;  2YTQ A;  2YTO A;  2YTE A;  1P47 A;  1YSA C;  2EM5 A;  2MDG A;  2EN1 A;  2EOJ A;  2EML A;  4FK5 C;  1LLM C;  2A25 A;  2CT1 A;  2EN7 A;  2EL5 A;  2GHF A;  2YTI A;  4R2P A;  2EMI A;  3MHS C;  1YUI A;  2EOZ A;  2EM7 A;  5KL2 A;  2EM0 A;  2EM6 A;  2EPP A;  2JPA A;  2DRP A;  2ENC A;  2YTP A;  2EM2 A;  2EP3 A;  4IJD A;  4IS1 C;  2RSI A;  1A1J A;  2EMK A;  2EQ1 A;  2EMY A;  4R2R A;  1TF3 A;  1JK2 A;  1NCS A;  2M9A A;  1DGC A;  2LVH A;  2WBS A;  2JP9 A;  2EMB A;  1A1L A;  2EOS A;  2EPC A;  2WBT A;  1X6E A;  2PRT A;  2EMZ A;  2LCE A;  2EMG A;  2YTJ A;  2R1F A;  4F2J C;  1WJP A;  1RMD A;  4R2C A;  5KL3 A;  4WSG A;  2EOI A;  3EPJ A;  2D9H A;  2CTD A;  2EOQ A;  1B69 A;  1UBD C;  2I13 A;  2EPR A;  2DGC A;  4GZN C;  2NAB A;  2EN8 A;  2WCC 3;  5KL6 A;  2EOE A;  2EQ0 A;  1A1K A;  2MKD A;  2EPZ A;  2EOF A;  2EPA A;  1UN6 B;  1G2D C;  2EM9 A;  2YRK A;  4F6M A;  5KL4 A;  4M9V C;  2EL6 A;  3EPL A;  1Z1B A;  2EPX A;  2EMC A;  2ELZ A;  1MEY C;  1AAY A;  2HGH A;  2VRD A;  2EOR A;  1BBO A;  2EN6 A;  2J7J A;  2ELY A;  1X6F A;  2EN2 A;  2EN3 A;  4R2E A;  2CSH A;  2YRH A;  1A1F A;  2EMA A;  2YSP A;  1X3C A;  2BB8 A;  2YU8 A;  2EPU A;  2WBU A;  3M99 B;  3EPK A;  1KJK A;  2EE8 A;  4R2Q A;  2YU5 A;  1X5W A;  2LT7 A;  2EOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...