5KL5A

Wilms tumor protein (wt1) znf2-4 q369h in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl5A00
4X9JA 3MHSC 1TF6A 2EM5A 1X6FA 2YTDA 1JK1A 2GLIA 1A1KA 1LLMC 1G2DC 2YTPA 2EMWA 2YTOA 1A1LA 2EE8A 2EM6A 2D9HA 2MKNA 2GHFA 2EOJA 1A1JA 1UBDC 2EPCA 1UN6B 2YTFA 2YRHA 2ENHA 2EM2A 2EJ4A 2EN4A 1A1IA 2EMZA 1KJKA 2EN3A 2WCC3 2EMKA 2EOMA 1A1GA 4R2DA 2EL4A 1G2FC 2EPUA 1A1FA 2EMIA 2LV2A 3MHHC 2EMLA 2EOQA 2EN7A 2EM3A 2EM8A 2CSHA 2YTQA 2ENAA 3EPHA 2EN8A 2PRTA 2EOXA 2EQ1A 2EQ0A 1BBOA 1X5WA 1RMDA 1P47A 2EPRA 2ELZA 2E72A 2EOYA 5KL3A 2HGHA 2EN6A 2EPZA 2ADRA 1B69A 2EOZA 2EQ3A 2EPAA 2EM9A 1DGCA 2WBTA 4R2RA 1ZAAC 2EMGA 1BB8A 1Z1BA 2ELYA 2MKDA 4WSGA 2EM4A 2R1FA 1TN9A 2LO3A 2DRPA 2CTDA 2DLKA 1AAYA 2ENCA 2YTEA 2EMBA 1MEYC 1TF3A 2YRKA 2EMXA 2YTIA 2DGCA 2EM0A 2EN1A 2EOHA 1X6EA 2LCEA 2YU8A 2BB8A 1F2IG 2JP9A 4R2SA 2EOFA 2WBSA 2A25A 2EP3A 1YSAC 3EPKA 4IS1C 3M99B 1YUJA 2EOEA 1X3CA 5KL6A 2EN2A 2EL5A 2EMCA 2MDGA 1ZR9A 4F6NA 2YSPA 2EOOA 2WBUA 2EOSA 2VRDA 4R2QA 3EPJA 4FK5C 2EPXA 2YU5A 1WJPA 2YTGA 4IJDA 3UK3C 2NABA 1ZU1A 2RSIA 2EM7A 1YUIA 2J7JA 2DMIA 2EORA 2EMYA 2CT1A 5KL5A 1NCSA 3VHTB 3EPLA 2M9AA 2YSOA 4R2AA 2EMHA 2YTJA 5KL2A 4F2JC 1JK2A 4F6MA 4R2PA 1A1HA 2JPAA 4M9VC 4R2EA 2LT7A 2I13A 1X6HA 2EMFA 2EMAA 2EPPA 2YTNA 2RPCA 2YRMA 2EOIA 5KL7A 2EL6A 4GZNC 2DLQA 4R2CA 2LVHA 5KL4A
chains in the Genus database with same CATH superfamily
1YYKA 2UUCE 2EM5A 2KOUA 2YTDA 4BC7A 2GLIA 2DMYA 2YTPA 2YTOA 2D9HA 4X62E 1ZBTA 1UBDC 5A6BD 2HJJA 2EJ4A 2EN4A 2EN3A 1RC7A 4R2DA 2F4VE 2EL4A 2EPUA 1A1FA 3QG5C 1BBGA 3JTZA 3KWRA 1J5EE 1N32E 4B3SE 1X47A 2EM3A 2I9IA 3VK6A 4B3RE 3ZOQB 1EH8A 4BC9A 2EPNA 4DR1E 2G7HA 1P47A 2ELZA 2E72A 2EOYA 4GKJE 4WSPA 4WFTA 2EN6A 5IV8B 1IBME 2ADRA 1XNQE 1B69A 3K6QA 4LF6E 2EOZA 1YYWA 4DV6E 1IBKE 2GPIA 2HC5A 2MDRA 2V85A 4R2RA 2LUPB 2EMGA 3KZZA 1XMQE 3THOB 1Z1BA 2LMZA 1N36E 4LF9E 2K4VA 2RTXA 3JU0A 3T1YE 2E1MA 2DLKA 1KYQA 5A6JA 2VQEE 1TF3A 2YRKA 4AQYE 4BCAA 1UHZA 4JYAE 2FV4B 4B3TE 2EN1A 3KZYA 2EZ6A 1SFEA 2RSMA 2EOFA 2UU9E 2ODRC 3EPKA 5IT9C 4IS1C 3M99B 2EPKX 4YY3E 2EL5A 2MDGA 3HXLA 2YSPA 4BHCA 2EOOA 2M4IA 2ODRD 3VYYA 4HTGA 5AE1A 2YU5A 4DV5E 1AH5A 2K7IA 5A6KA 2NUEA 3ADLA 3F6GA 2CT1A 2M9AA 2YSOA 5AASA 2EMHA 2YTJA 4F2JC 1JK2A 4F6MA 2JOBA 4R2EA 2LT7A 4X8WA 1PDAA 2DIXA 3BGHA 1X6HA 3L00A 2EMFA 1NEIA 5AC5A 1T39A 4JV5E 2VQFE 3OMLA 4DV3E 2YRMA 2EL6A 4JI3E 2LVHA 2NA2A 3C4TA 2L6MA 4M0VA 2JR1A 3MHSC 2UUAE 2RS7A 5AE2A 2NUGA 3ADJA 4B3ME 1LLMC 1PKPA 2DSYA 2LE2A 2L2MA 2EE8A 4Q28A 4O43A 4JI7E 1A1JA 5T6JA 1UN6B 2ENHA 2N3HA 1A1IA 2WCC3 3JAMC 3C6KA 1A1GA 1G2FC 4ZYHA 4DR4E 1EH7A 4Q35B 1HR0E 3MHHC 4YHHE 2EOQA 2EN7A 1GTKA 3F6HA 2EN8A 2N8XA 2EOXA 2EQ1A 1YYOA 1O0WA 4DV2E 1EKZA 4WXDA 2EPRA 4X66E 5LL6R 3H09A 3OTOE 4JI6E 2EPZA 1I94E 2EM9A 1WXRA 2V89A 5A69A 1BB8A 2ELYA 2L8TA 5ADZA 2MKDA 4WSGA 2R1FA 4NXNE 1GQEA 4WYQB 2JOXA 4JI4E 2CTDA 2YWQA 2YTEA 2LTSA 3AUZA 3IWCA 2EM0A 1GZ6A 1DQ3A 2EOHA 4O24A 2LCEA 1F2IG 4R2SA 2JVAA 2WBSA 4NXME 2A25A 4BMJA 1YSAC 2YT4A 2FGGA 5KL6A 3BIDA 4F6NA 2H36X 5A6AA 4DV1E 4DUZE 2EWLA 2VRDA 2L33A 4R2QA 4FK5C 1MGTA 3EQ1A 2YTGA 3UK3C 1N34E 2NABA 3VYXA 4DMIA 2VE7C 5KL5A 3HPZA 4GKKE 4R2AA 3ADIA 5DNYA 4R2PA 2L92A 2M7QA 1T4LB 4M9VC 3FIGA 5LLQA 4L5NC 3ECRA 1WHNA 4DR5E 2EPPA 3J80C 4DV0E 1WHQA 2RPCA 1PJQA 2EOIA 4GZNC 5F3WA 3C4BA 4DKKA 4JI2E 3HTXA 1T4NA 1TF6A 2B9DA 4LF8E 2L3CA 4DR6E 1X6FA 4O4KA 4M30A 1A1KA 1A1LA 4KZSA 4DR2E 2GHFA 2EOJA 2EPCA 2YTFA 1YPNA 4O5GA 4M2ZA 5AC4A 2EPOA 2EOMA 4BHBA 3DJWA 2NUFA 2LV2A 2EMLA 4X64E 2EM8A 2YTQA 4JI5E 1XNRE 3EPHA 2PRTA 3LMLA 2V88A 5FLXC 1X5WA 1RMDA 5KL3A 2UXBE 1T38A 1FKAE 4WX9A 4DV4E 2EQ3A 2L2KB 4ZYGA 2KHXA 2WBTA 3BBGA 4MLVA 1ZAAC 3T1HE 1IQSA 4LFAE 2EM4A 2WZOA 2YPNA 1TN9A 3TQMA 3P1XA 4ZYDA 2LJHA 2DRPA 2R76A 1MEYC 1IMUA 2EMXA 2YTIA 4L8NA 1FJGE 4LU9A 2LJUA 4WPYA 2JWOA 1SR9A 1X6EA 2MC5A 4LF7E 1X48A 3ADGA 2VF1A 2EOEA 1X3CA 2EN2A 2HHHE 2IHR1 2JYAA 4F9BB 2WBUA 1ZBQA 3IWBA 4N4RB 3C6MA 2EPXA 2N3GA 1WJPA 4IJDA 2E5LE 4WXCA 1RQ0A 2JY9A 1ZU1A 2EM7A 1L4SA 2Q8UA 3HQ1A 4P78A 4LF5E 2EMYA 3EPLA 4JI1E 4DUYE 1IQOA 2UXDE 2JPAA 4OOGC 2EPLX 1J26A 3MSWA 1T4OA 5A2QC 2YTNA 3LLHA 4LFBE 3BF2A 4DR3E 4F9CB 1HNWE 4ZYEA 2B7VA 2LTRA 4J8ZA 2DLQA 4R2CA 1IBLE 3J7Yp 1STUA 2RS6A 2CPNA 4X9JA 1YFHA 4RHBB 1EH6A 1JK1A 1YZ9A 1G2DC 5CFFE 2EMWA 2KONA 1HNXE 2EM6A 2MKNA 1QU6A 1WRJA 4R8OA 2V87A 4DR7E 2YRHA 2EM2A 4LF4E 2EPMX 2EMZA 1KJKA 2EMKA 4BBYA 5LMUE 2EMIA 4F9AB 2B7TA 1X49A 4X65E 2CSHA 2L3JA 2ENAA 2BBGA 1N33E 3RMPA 4NZVA 2EQ0A 1BBOA 2LUQA 2HGHA 4F54A 4K0KE 4LFCE 2EPAA 2DB2A 5A6BA 1DGCA 2V83A 3J7AG 2FTXB 4DV7E 2LO3A 4P7DA 1AAYA 2ENCA 1N3GA 4TUGA 2EMBA 5IWAE 4TUIA 4HEIA 2L2NA 1PJSA 2DGCA 2YU8A 2BB8A 4NHRA 2JP9A 2F8BA 4OX9E 2V8QB 3J81C 1HNZE 2EP3A 2V86A 1YUJA 4KHPE 2EMCA 4MLQA 5TSEA 5BR8E 1ZR9A 5IXMB 1DI2A 2EOSA 3AV0A 1QNTA 3EPJA 3IWDA 4I8OA 2RSIA 2M1SA 4BS9A 4KWYA 2B3TB 1YUIA 2J7JA 2DMIA 2UXCE 2EORA 2JXPA 2ZM6E 2YZTA 1NCSA 3VHTB 4LTYA 4JI8E 5AE3A 5KL2A 2RQLA 2MC6A 4RH8A 1A1HA 3HPSA 4GEQB 5LMNE 2I13A 3THNA 1XMOE 2EMAA 3DF6A 2LBSB 5KL7A 4JI0E 1PJTA 4R03A 2UUBE 1UILA 2LRSA 5KL4A
chains in the Genus database with same CATH topology
4X9JA 3MHSC 1TF6A 2EM5A 1X6FA 2YTDA 1JK1A 2GLIA 1A1KA 1LLMC 1G2DC 2YTPA 2EMWA 2YTOA 1A1LA 2EE8A 2EM6A 2D9HA 2MKNA 2GHFA 2EOJA 1A1JA 1UBDC 2EPCA 1UN6B 2YTFA 2YRHA 2ENHA 2EM2A 2EJ4A 2EN4A 1A1IA 2EMZA 1KJKA 2EN3A 2WCC3 2EMKA 2EOMA 1A1GA 4R2DA 2EL4A 1G2FC 2EPUA 1A1FA 2EMIA 2LV2A 3MHHC 2EMLA 2EOQA 2EN7A 2EM3A 2EM8A 2CSHA 2YTQA 2ENAA 3EPHA 2EN8A 2PRTA 2EOXA 2EQ1A 2EQ0A 1BBOA 1X5WA 1RMDA 1P47A 2EPRA 2ELZA 2E72A 2EOYA 5KL3A 2HGHA 2EN6A 2EPZA 2ADRA 1B69A 2EOZA 2EQ3A 2EPAA 2EM9A 1DGCA 2WBTA 4R2RA 1ZAAC 2EMGA 1BB8A 1Z1BA 2ELYA 2MKDA 4WSGA 2EM4A 2R1FA 1TN9A 2LO3A 2DRPA 2CTDA 2DLKA 1AAYA 2ENCA 2YTEA 2EMBA 1MEYC 1TF3A 2YRKA 2EMXA 2YTIA 2DGCA 2EM0A 2EN1A 2EOHA 1X6EA 2LCEA 2YU8A 2BB8A 1F2IG 2JP9A 4R2SA 2EOFA 2WBSA 2A25A 2EP3A 1YSAC 3EPKA 4IS1C 3M99B 1YUJA 2EOEA 1X3CA 5KL6A 2EN2A 2EL5A 2EMCA 2MDGA 1ZR9A 4F6NA 2YSPA 2EOOA 2WBUA 2EOSA 2VRDA 4R2QA 3EPJA 4FK5C 2EPXA 2YU5A 1WJPA 2YTGA 4IJDA 3UK3C 2NABA 1ZU1A 2RSIA 2EM7A 1YUIA 2J7JA 2DMIA 2EORA 2EMYA 2CT1A 5KL5A 1NCSA 3VHTB 3EPLA 2M9AA 2YSOA 4R2AA 2EMHA 2YTJA 5KL2A 4F2JC 1JK2A 4F6MA 4R2PA 1A1HA 2JPAA 4M9VC 4R2EA 2LT7A 2I13A 1X6HA 2EMFA 2EMAA 2EPPA 2YTNA 2RPCA 2YRMA 2EOIA 5KL7A 2EL6A 4GZNC 2DLQA 4R2CA 2LVHA 5KL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X9J A;  3MHS C;  1TF6 A;  2EM5 A;  1X6F A;  2YTD A;  1JK1 A;  2GLI A;  1A1K A;  1LLM C;  1G2D C;  2YTP A;  2EMW A;  2YTO A;  1A1L A;  2EE8 A;  2EM6 A;  2D9H A;  2MKN A;  2GHF A;  2EOJ A;  1A1J A;  1UBD C;  2EPC A;  1UN6 B;  2YTF A;  2YRH A;  2ENH A;  2EM2 A;  2EJ4 A;  2EN4 A;  1A1I A;  2EMZ A;  1KJK A;  2EN3 A;  2WCC 3;  2EMK A;  2EOM A;  1A1G A;  4R2D A;  2EL4 A;  1G2F C;  2EPU A;  1A1F A;  2EMI A;  2LV2 A;  3MHH C;  2EML A;  2EOQ A;  2EN7 A;  2EM3 A;  2EM8 A;  2CSH A;  2YTQ A;  2ENA A;  3EPH A;  2EN8 A;  2PRT A;  2EOX A;  2EQ1 A;  2EQ0 A;  1BBO A;  1X5W A;  1RMD A;  1P47 A;  2EPR A;  2ELZ A;  2E72 A;  2EOY A;  5KL3 A;  2HGH A;  2EN6 A;  2EPZ A;  2ADR A;  1B69 A;  2EOZ A;  2EQ3 A;  2EPA A;  2EM9 A;  1DGC A;  2WBT A;  4R2R A;  1ZAA C;  2EMG A;  1BB8 A;  1Z1B A;  2ELY A;  2MKD A;  4WSG A;  2EM4 A;  2R1F A;  1TN9 A;  2LO3 A;  2DRP A;  2CTD A;  2DLK A;  1AAY A;  2ENC A;  2YTE A;  2EMB A;  1MEY C;  1TF3 A;  2YRK A;  2EMX A;  2YTI A;  2DGC A;  2EM0 A;  2EN1 A;  2EOH A;  1X6E A;  2LCE A;  2YU8 A;  2BB8 A;  1F2I G;  2JP9 A;  4R2S A;  2EOF A;  2WBS A;  2A25 A;  2EP3 A;  1YSA C;  3EPK A;  4IS1 C;  3M99 B;  1YUJ A;  2EOE A;  1X3C A;  5KL6 A;  2EN2 A;  2EL5 A;  2EMC A;  2MDG A;  1ZR9 A;  4F6N A;  2YSP A;  2EOO A;  2WBU A;  2EOS A;  2VRD A;  4R2Q A;  3EPJ A;  4FK5 C;  2EPX A;  2YU5 A;  1WJP A;  2YTG A;  4IJD A;  3UK3 C;  2NAB A;  1ZU1 A;  2RSI A;  2EM7 A;  1YUI A;  2J7J A;  2DMI A;  2EOR A;  2EMY A;  2CT1 A;  5KL5 A;  1NCS A;  3VHT B;  3EPL A;  2M9A A;  2YSO A;  4R2A A;  2EMH A;  2YTJ A;  5KL2 A;  4F2J C;  1JK2 A;  4F6M A;  4R2P A;  1A1H A;  2JPA A;  4M9V C;  4R2E A;  2LT7 A;  2I13 A;  1X6H A;  2EMF A;  2EMA A;  2EPP A;  2YTN A;  2RPC A;  2YRM A;  2EOI A;  5KL7 A;  2EL6 A;  4GZN C;  2DLQ A;  4R2C A;  2LVH A;  5KL4 A; 
#chains in the Genus database with same CATH topology
 1YYK A;  2UUC E;  2EM5 A;  2KOU A;  2YTD A;  4BC7 A;  2GLI A;  2DMY A;  2YTP A;  2YTO A;  2D9H A;  4X62 E;  1ZBT A;  1UBD C;  5A6B D;  2HJJ A;  2EJ4 A;  2EN4 A;  2EN3 A;  1RC7 A;  4R2D A;  2F4V E;  2EL4 A;  2EPU A;  1A1F A;  3QG5 C;  1BBG A;  3JTZ A;  3KWR A;  1J5E E;  1N32 E;  4B3S E;  1X47 A;  2EM3 A;  2I9I A;  3VK6 A;  4B3R E;  3ZOQ B;  1EH8 A;  4BC9 A;  2EPN A;  4DR1 E;  2G7H A;  1P47 A;  2ELZ A;  2E72 A;  2EOY A;  4GKJ E;  4WSP A;  4WFT A;  2EN6 A;  5IV8 B;  1IBM E;  2ADR A;  1XNQ E;  1B69 A;  3K6Q A;  4LF6 E;  2EOZ A;  1YYW A;  4DV6 E;  1IBK E;  2GPI A;  2HC5 A;  2MDR A;  2V85 A;  4R2R A;  2LUP B;  2EMG A;  3KZZ A;  1XMQ E;  3THO B;  1Z1B A;  2LMZ A;  1N36 E;  4LF9 E;  2K4V A;  2RTX A;  3JU0 A;  3T1Y E;  2E1M A;  2DLK A;  1KYQ A;  5A6J A;  2VQE E;  1TF3 A;  2YRK A;  4AQY E;  4BCA A;  1UHZ A;  4JYA E;  2FV4 B;  4B3T E;  2EN1 A;  3KZY A;  2EZ6 A;  1SFE A;  2RSM A;  2EOF A;  2UU9 E;  2ODR C;  3EPK A;  5IT9 C;  4IS1 C;  3M99 B;  2EPK X;  4YY3 E;  2EL5 A;  2MDG A;  3HXL A;  2YSP A;  4BHC A;  2EOO A;  2M4I A;  2ODR D;  3VYY A;  4HTG A;  5AE1 A;  2YU5 A;  4DV5 E;  1AH5 A;  2K7I A;  5A6K A;  2NUE A;  3ADL A;  3F6G A;  2CT1 A;  2M9A A;  2YSO A;  5AAS A;  2EMH A;  2YTJ A;  4F2J C;  1JK2 A;  4F6M A;  2JOB A;  4R2E A;  2LT7 A;  4X8W A;  1PDA A;  2DIX A;  3BGH A;  1X6H A;  3L00 A;  2EMF A;  1NEI A;  5AC5 A;  1T39 A;  4JV5 E;  2VQF E;  3OML A;  4DV3 E;  2YRM A;  2EL6 A;  4JI3 E;  2LVH A;  2NA2 A;  3C4T A;  2L6M A;  4M0V A;  2JR1 A;  3MHS C;  2UUA E;  2RS7 A;  5AE2 A;  2NUG A;  3ADJ A;  4B3M E;  1LLM C;  1PKP A;  2DSY A;  2LE2 A;  2L2M A;  2EE8 A;  4Q28 A;  4O43 A;  4JI7 E;  1A1J A;  5T6J A;  1UN6 B;  2ENH A;  2N3H A;  1A1I A;  2WCC 3;  3JAM C;  3C6K A;  1A1G A;  1G2F C;  4ZYH A;  4DR4 E;  1EH7 A;  4Q35 B;  1HR0 E;  3MHH C;  4YHH E;  2EOQ A;  2EN7 A;  1GTK A;  3F6H A;  2EN8 A;  2N8X A;  2EOX A;  2EQ1 A;  1YYO A;  1O0W A;  4DV2 E;  1EKZ A;  4WXD A;  2EPR A;  4X66 E;  5LL6 R;  3H09 A;  3OTO E;  4JI6 E;  2EPZ A;  1I94 E;  2EM9 A;  1WXR A;  2V89 A;  5A69 A;  1BB8 A;  2ELY A;  2L8T A;  5ADZ A;  2MKD A;  4WSG A;  2R1F A;  4NXN E;  1GQE A;  4WYQ B;  2JOX A;  4JI4 E;  2CTD A;  2YWQ A;  2YTE A;  2LTS A;  3AUZ A;  3IWC A;  2EM0 A;  1GZ6 A;  1DQ3 A;  2EOH A;  4O24 A;  2LCE A;  1F2I G;  4R2S A;  2JVA A;  2WBS A;  4NXM E;  2A25 A;  4BMJ A;  1YSA C;  2YT4 A;  2FGG A;  5KL6 A;  3BID A;  4F6N A;  2H36 X;  5A6A A;  4DV1 E;  4DUZ E;  2EWL A;  2VRD A;  2L33 A;  4R2Q A;  4FK5 C;  1MGT A;  3EQ1 A;  2YTG A;  3UK3 C;  1N34 E;  2NAB A;  3VYX A;  4DMI A;  2VE7 C;  5KL5 A;  3HPZ A;  4GKK E;  4R2A A;  3ADI A;  5DNY A;  4R2P A;  2L92 A;  2M7Q A;  1T4L B;  4M9V C;  3FIG A;  5LLQ A;  4L5N C;  3ECR A;  1WHN A;  4DR5 E;  2EPP A;  3J80 C;  4DV0 E;  1WHQ A;  2RPC A;  1PJQ A;  2EOI A;  4GZN C;  5F3W A;  3C4B A;  4DKK A;  4JI2 E;  3HTX A;  1T4N A;  1TF6 A;  2B9D A;  4LF8 E;  2L3C A;  4DR6 E;  1X6F A;  4O4K A;  4M30 A;  1A1K A;  1A1L A;  4KZS A;  4DR2 E;  2GHF A;  2EOJ A;  2EPC A;  2YTF A;  1YPN A;  4O5G A;  4M2Z A;  5AC4 A;  2EPO A;  2EOM A;  4BHB A;  3DJW A;  2NUF A;  2LV2 A;  2EML A;  4X64 E;  2EM8 A;  2YTQ A;  4JI5 E;  1XNR E;  3EPH A;  2PRT A;  3LML A;  2V88 A;  5FLX C;  1X5W A;  1RMD A;  5KL3 A;  2UXB E;  1T38 A;  1FKA E;  4WX9 A;  4DV4 E;  2EQ3 A;  2L2K B;  4ZYG A;  2KHX A;  2WBT A;  3BBG A;  4MLV A;  1ZAA C;  3T1H E;  1IQS A;  4LFA E;  2EM4 A;  2WZO A;  2YPN A;  1TN9 A;  3TQM A;  3P1X A;  4ZYD A;  2LJH A;  2DRP A;  2R76 A;  1MEY C;  1IMU A;  2EMX A;  2YTI A;  4L8N A;  1FJG E;  4LU9 A;  2LJU A;  4WPY A;  2JWO A;  1SR9 A;  1X6E A;  2MC5 A;  4LF7 E;  1X48 A;  3ADG A;  2VF1 A;  2EOE A;  1X3C A;  2EN2 A;  2HHH E;  2IHR 1;  2JYA A;  4F9B B;  2WBU A;  1ZBQ A;  3IWB A;  4N4R B;  3C6M A;  2EPX A;  2N3G A;  1WJP A;  4IJD A;  2E5L E;  4WXC A;  1RQ0 A;  2JY9 A;  1ZU1 A;  2EM7 A;  1L4S A;  2Q8U A;  3HQ1 A;  4P78 A;  4LF5 E;  2EMY A;  3EPL A;  4JI1 E;  4DUY E;  1IQO A;  2UXD E;  2JPA A;  4OOG C;  2EPL X;  1J26 A;  3MSW A;  1T4O A;  5A2Q C;  2YTN A;  3LLH A;  4LFB E;  3BF2 A;  4DR3 E;  4F9C B;  1HNW E;  4ZYE A;  2B7V A;  2LTR A;  4J8Z A;  2DLQ A;  4R2C A;  1IBL E;  3J7Y p;  1STU A;  2RS6 A;  2CPN A;  4X9J A;  1YFH A;  4RHB B;  1EH6 A;  1JK1 A;  1YZ9 A;  1G2D C;  5CFF E;  2EMW A;  2KON A;  1HNX E;  2EM6 A;  2MKN A;  1QU6 A;  1WRJ A;  4R8O A;  2V87 A;  4DR7 E;  2YRH A;  2EM2 A;  4LF4 E;  2EPM X;  2EMZ A;  1KJK A;  2EMK A;  4BBY A;  5LMU E;  2EMI A;  4F9A B;  2B7T A;  1X49 A;  4X65 E;  2CSH A;  2L3J A;  2ENA A;  2BBG A;  1N33 E;  3RMP A;  4NZV A;  2EQ0 A;  1BBO A;  2LUQ A;  2HGH A;  4F54 A;  4K0K E;  4LFC E;  2EPA A;  2DB2 A;  5A6B A;  1DGC A;  2V83 A;  3J7A G;  2FTX B;  4DV7 E;  2LO3 A;  4P7D A;  1AAY A;  2ENC A;  1N3G A;  4TUG A;  2EMB A;  5IWA E;  4TUI A;  4HEI A;  2L2N A;  1PJS A;  2DGC A;  2YU8 A;  2BB8 A;  4NHR A;  2JP9 A;  2F8B A;  4OX9 E;  2V8Q B;  3J81 C;  1HNZ E;  2EP3 A;  2V86 A;  1YUJ A;  4KHP E;  2EMC A;  4MLQ A;  5TSE A;  5BR8 E;  1ZR9 A;  5IXM B;  1DI2 A;  2EOS A;  3AV0 A;  1QNT A;  3EPJ A;  3IWD A;  4I8O A;  2RSI A;  2M1S A;  4BS9 A;  4KWY A;  2B3T B;  1YUI A;  2J7J A;  2DMI A;  2UXC E;  2EOR A;  2JXP A;  2ZM6 E;  2YZT A;  1NCS A;  3VHT B;  4LTY A;  4JI8 E;  5AE3 A;  5KL2 A;  2RQL A;  2MC6 A;  4RH8 A;  1A1H A;  3HPS A;  4GEQ B;  5LMN E;  2I13 A;  3THN A;  1XMO E;  2EMA A;  3DF6 A;  2LBS B;  5KL7 A;  4JI0 E;  1PJT A;  4R03 A;  2UUB E;  1UIL A;  2LRS A;  5KL4 A; 
#chains in the Genus database with same CATH homology
 4X9J A;  3MHS C;  1TF6 A;  2EM5 A;  1X6F A;  2YTD A;  1JK1 A;  2GLI A;  1A1K A;  1LLM C;  1G2D C;  2YTP A;  2EMW A;  2YTO A;  1A1L A;  2EE8 A;  2EM6 A;  2D9H A;  2MKN A;  2GHF A;  2EOJ A;  1A1J A;  1UBD C;  2EPC A;  1UN6 B;  2YTF A;  2YRH A;  2ENH A;  2EM2 A;  2EJ4 A;  2EN4 A;  1A1I A;  2EMZ A;  1KJK A;  2EN3 A;  2WCC 3;  2EMK A;  2EOM A;  1A1G A;  4R2D A;  2EL4 A;  1G2F C;  2EPU A;  1A1F A;  2EMI A;  2LV2 A;  3MHH C;  2EML A;  2EOQ A;  2EN7 A;  2EM3 A;  2EM8 A;  2CSH A;  2YTQ A;  2ENA A;  3EPH A;  2EN8 A;  2PRT A;  2EOX A;  2EQ1 A;  2EQ0 A;  1BBO A;  1X5W A;  1RMD A;  1P47 A;  2EPR A;  2ELZ A;  2E72 A;  2EOY A;  5KL3 A;  2HGH A;  2EN6 A;  2EPZ A;  2ADR A;  1B69 A;  2EOZ A;  2EQ3 A;  2EPA A;  2EM9 A;  1DGC A;  2WBT A;  4R2R A;  1ZAA C;  2EMG A;  1BB8 A;  1Z1B A;  2ELY A;  2MKD A;  4WSG A;  2EM4 A;  2R1F A;  1TN9 A;  2LO3 A;  2DRP A;  2CTD A;  2DLK A;  1AAY A;  2ENC A;  2YTE A;  2EMB A;  1MEY C;  1TF3 A;  2YRK A;  2EMX A;  2YTI A;  2DGC A;  2EM0 A;  2EN1 A;  2EOH A;  1X6E A;  2LCE A;  2YU8 A;  2BB8 A;  1F2I G;  2JP9 A;  4R2S A;  2EOF A;  2WBS A;  2A25 A;  2EP3 A;  1YSA C;  3EPK A;  4IS1 C;  3M99 B;  1YUJ A;  2EOE A;  1X3C A;  5KL6 A;  2EN2 A;  2EL5 A;  2EMC A;  2MDG A;  1ZR9 A;  4F6N A;  2YSP A;  2EOO A;  2WBU A;  2EOS A;  2VRD A;  4R2Q A;  3EPJ A;  4FK5 C;  2EPX A;  2YU5 A;  1WJP A;  2YTG A;  4IJD A;  3UK3 C;  2NAB A;  1ZU1 A;  2RSI A;  2EM7 A;  1YUI A;  2J7J A;  2DMI A;  2EOR A;  2EMY A;  2CT1 A;  5KL5 A;  1NCS A;  3VHT B;  3EPL A;  2M9A A;  2YSO A;  4R2A A;  2EMH A;  2YTJ A;  5KL2 A;  4F2J C;  1JK2 A;  4F6M A;  4R2P A;  1A1H A;  2JPA A;  4M9V C;  4R2E A;  2LT7 A;  2I13 A;  1X6H A;  2EMF A;  2EMA A;  2EPP A;  2YTN A;  2RPC A;  2YRM A;  2EOI A;  5KL7 A;  2EL6 A;  4GZN C;  2DLQ A;  4R2C A;  2LVH A;  5KL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...