5KL5A

Wilms tumor protein (wt1) znf2-4 q369h in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl5A00
2EOYA 1X6EA 2EN1A 5KL2A 2HGHA 2EN3A 4R2PA 2EOJA 1NCSA 2EM9A 2EMZA 1YUJA 2EM6A 1P47A 4GZNC 2EE8A 2YTNA 2J7JA 5KL5A 2EMGA 2YTIA 1A1GA 2CTDA 2R1FA 1TN9A 4F2JC 2RSIA 2A25A 2EOFA 2LV2A 2CT1A 3MHHC 2EM8A 2EMBA 1UN6B 2JP9A 2I13A 2EMAA 3M99B 2EPXA 2EMXA 2NABA 1A1KA 2MKDA 1A1IA 2DRPA 5KL6A 2EN2A 2CSHA 2EORA 2MDGA 3EPLA 2YSOA 2EQ3A 1YSAC 2LVHA 4FK5C 2JPAA 2ENHA 2EMHA 4M9VC 4F6NA 2YTQA 2GLIA 1ZAAC 2GHFA 1X6HA 2EMFA 2BB8A 5KL3A 2EOHA 2EJ4A 2EPUA 4R2QA 1JK1A 1BBOA 2ADRA 4R2CA 2EPPA 2PRTA 2EPRA 1X5WA 2EPAA 2EL6A 2YRKA 2LT7A 2EL4A 1ZR9A 2WCC3 2DLKA 5KL4A 4WSGA 1AAYA 2YU5A 2EOZA 2WBSA 2YTOA 2EMIA 1BB8A 4R2EA 1RMDA 1Z1BA 1TF6A 2M9AA 2E72A 1WJPA 2EN6A 4X9JA 2EM4A 2EOOA 2EN4A 2EOMA 2RPCA 2YTPA 4R2SA 4R2RA 2YTEA 2YRHA 5KL7A 1X3CA 2EMCA 1ZU1A 2EM0A 2YTJA 2EMYA 1TF3A 2D9HA 4R2DA 2EM5A 2EMLA 4R2AA 1A1HA 3UK3C 2EMWA 2EN8A 3EPHA 2EPZA 2ELZA 2EOSA 2EOXA 1A1LA 2ELYA 2EP3A 2LO3A 1X6FA 2ENCA 4F6MA 2DGCA 2EM2A 2WBTA 2WBUA 1UBDC 4IS1C 3VHTB 2EN7A 2YTDA 1B69A 2VRDA 2YTGA 1G2DC 3EPJA 2YSPA 2YTFA 2DMIA 2MKNA 2EM7A 3MHSC 1JK2A 1MEYC 1DGCA 2DLQA 2ENAA 4IJDA 1YUIA 2EQ0A 2YU8A 2YRMA 3EPKA 1F2IG 1A1FA 2EOIA 1KJKA 2EL5A 2EM3A 2EOQA 2EQ1A 2LCEA 1G2FC 2EOEA 1LLMC 1A1JA 2EMKA 2EPCA
chains in the Genus database with same CATH superfamily
2EOYA 5LL6R 4JI7E 1T38A 4JI3E 2EMZA 1N36E 2UUCE 2HJJA 2YTIA 1PKPA 2LE2A 3VYYA 2CPNA 2JY9A 2RSIA 3JTZA 2YWQA 3HQ1A 2CT1A 1EH8A 2EM8A 2V88A 1UN6B 2I13A 2RTXA 2M4IA 4BBYA 2V89A 2MKDA 2DRPA 5KL6A 2EORA 5TSEA 2MDGA 3J81C 2LVHA 4DKKA 2F4VE 4F6NA 4LF6E 4DUYE 1PDAA 2NUGA 4LTYA 4WXCA 2EMFA 4JYAE 2BB8A 2FGGA 4KZSA 2L92A 2WZOA 2K4VA 2NUFA 2JVAA 4LF5E 1ZR9A 2DLKA 5KL4A 4X62E 2N8XA 2JXPA 3HPSA 4NXNE 1O0WA 1EH7A 1J5EE 2E1MA 2YTEA 4P7DA 3THOB 5LMUE 1GZ6A 1IBKE 2EMCA 2MC6A 2ODRD 3JAMC 4AQYE 4NXME 1T39A 2EMWA 2EN8A 1EKZA 3J7Yp 2L33A 4ZYEA 2EOXA 4I8OA 3VK6A 3C6MA 1X49A 2DGCA 4DV2E 5A6JA 2WBUA 4O5GA 3ADLA 2EN7A 4DR5E 1PJSA 2V86A 4DR2E 2YTFA 1HNZE 1DQ3A 2DMIA 3DF6A 1DGCA 3ADIA 3LMLA 4B3RE 4DV6E 4IJDA 4DR1E 2YU8A 3EPKA 2JOBA 2EM3A 2N3GA 3F6HA 4LF4E 1LLMC 1GTKA 2EPCA 1P47A 2EN1A 4O4KA 5KL2A 2EN3A 2UXCE 1N34E 2EOJA 3BBGA 1NCSA 1J26A 2EM9A 4X66E 2EM6A 2UUBE 2YTNA 1IMUA 3K6QA 5KL5A 3P1XA 4LFBE 2K7IA 3ADJA 4F2JC 4X64E 5A6KA 2LV2A 2EPKX 2HC5A 1UHZA 2EMBA 4LF9E 2MC5A 3QG5C 2DB2A 3M99B 2EPXA 4DUZE 2V87A 1A1IA 4DV3E 1NEIA 1WRJA 2L2NA 4WYQB 2YSOA 2EQ3A 2GPIA 4FK5C 2ENHA 2DSYA 2GHFA 4BHBA 4TUIA 5KL3A 2EJ4A 2EPUA 2L3CA 4BHCA 3LLHA 1BBGA 1I94E 2NA2A 4BS9A 1IBLE 2VQFE 2EPPA 5A2QC 2EPAA 5F3WA 2EL6A 1KYQA 1IQOA 2B7TA 2WCC3 4DR4E 4WSGA 2YU5A 2EOZA 3KZYA 1BB8A 4BCAA 1RMDA 2E72A 4DR7E 4X9JA 2B7VA 2EOOA 4HEIA 1HR0E 1YZ9A 4JI6E 2RPCA 2YTPA 1N33E 3AV0A 4R2RA 3AUZA 2YRHA 3ZOQB 5KL7A 1X3CA 2YTJA 2EMYA 5FLXC 4F54A 2F8BA 2LMZA 2EM5A 4R03A 3EQ1A 4JI2E 1ZBQA 2ELZA 2EOSA 2UXDE 1X6FA 2ENCA 1STUA 2JWOA 2YZTA 4OX9E 1B69A 4JV5E 2VRDA 2YTGA 4RHBB 1MGTA 5A69A 4L8NA 1X48A 3KZZA 2EPLX 2VE7C 4DV7E 4JI4E 3MHSC 1JK2A 1XNRE 2DLQA 2UXBE 1T4OA 2EQ0A 4B3ME 1F2IG 1XNQE 4P78A 4DR3E 2EOIA 3BF2A 1KJKA 3TQMA 1L4SA 2BBGA 4TUGA 1HNWE 3H09A 4R8OA 2DIXA 5A6BA 2EOEA 2EMKA 1X6EA 3JU0A 5AE3A 2HGHA 2NUEA 1PJTA 4HTGA 1YPNA 4RH8A 4GZNC 1SR9A 2EE8A 4KHPE 2J7JA 1YFHA 1TN9A 5CFFE 2A25A 2EOFA 3T1YE 2KONA 3MHHC 2JP9A 2JYAA 4BC7A 2EMAA 1IBME 1A1KA 2NABA 1EH6A 2EN2A 2CSHA 4MLQA 2N3HA 3EPLA 2YT4A 4LFCE 4JI8E 2JPAA 2EMHA 4M9VC 2YTQA 2GLIA 1ZAAC 5T6JA 1WHNA 3DJWA 4WXDA 2EOHA 4WFTA 4B3SE 1JK1A 2LJHA 2ADRA 1T4NA 4R2CA 2JR1A 2PRTA 2LBSB 4X8WA 4B3TE 2EPRA 2LT7A 2ZM6E 5AE1A 1AAYA 1AH5A 4KWYA 2YTOA 1SFEA 2EMIA 2EWLA 4R2EA 2UUAE 1YYWA 2M9AA 4ZYGA 1N3GA 2LUPB 2UU9E 2KHXA 2EM4A 1PJQA 3MSWA 2YPNA 3BGHA 3L00A 1ZU1A 2EM0A 2L6MA 1TF3A 1A1HA 4R2DA 4R2AA 3C4BA 1QU6A 2EZ6A 5A6AA 3EPHA 1UILA 2EPZA 4DMIA 5BR8E 2EPNA 2EP3A 4F6MA 2EM2A 1UBDC 3T1HE 3VHTB 3BIDA 4OOGC 2VQEE 2RS7A 4J8ZA 3C4TA 1ZBTA 5DNYA 4GKKE 3OMLA 3EPJA 2YSPA 4Q28A 2VF1A 4WPYA 4LU9A 3ECRA 2MKNA 2EM7A 4M30A 5IXMB 1MEYC 2LTRA 2JOXA 2Q8UA 2YRMA 4JI1E 4WSPA 1A1FA 4LF8E 4DV1E 3HXLA 4LFAE 4GKJE 2EQ1A 2LCEA 1A1JA 2RQLA 1WHQA 4N4RB 3J7AG 4R2PA 1XMOE 4O24A 4F9CB 3OTOE 1YUJA 1WXRA 4GEQB 1X47A 4MLVA 3ADGA 5IV8B 4BC9A 2EPOA 2EMGA 1A1GA 2CTDA 2R1FA 4L5NC 1YYKA 3J80C 4F9AB 1GQEA 3IWDA 5AC5A 2RS6A 4K0KE 2EMXA 2L8TA 2DMYA 2LRSA 2V8QB 2KOUA 4ZYDA 2I9IA 5LMNE 3HTXA 1YSAC 3VYXA 4DV4E 4ZYHA 3RMPA 1X6HA 2G7HA 1DI2A 2R76A 2L3JA 3C6KA 4R2QA 1BBOA 2LTSA 4WX9A 4YHHE 5IT9C 2HHHE 1X5WA 2YRKA 2ODRC 2EL4A 1RC7A 2B3TB 2WBSA 2B9DA 2LJUA 4F9BB 1TF6A 1Z1BA 2LUQA 4X65E 1WJPA 3IWCA 2EN6A 4DV0E 2EN4A 2EOMA 4R2SA 4M0VA 1IQSA 1T4LB 2FV4B 3FIGA 2D9HA 2EMLA 3UK3C 5AE2A 4DV5E 2IHR1 1FJGE 4LF7E 4JI0E 4BMJA 1A1LA 2ELYA 4YY3E 2LO3A 5A6BD 2RSMA 2H36X 2WBTA 1FKAE 4Q35B 5AC4A 4IS1C 2YTDA 2FTXB 2MDRA 2M1SA 5ADZA 5AASA 4JI5E 3HPZA 1G2DC 2E5LE 2M7QA 4DR6E 5LLQA 1QNTA 1XMQE 2L2MA 1HNXE 2EPMX 1N32E 1RQ0A 2ENAA 2L2KB 2V83A 4NZVA 1YUIA 3THNA 4O43A 2V85A 3IWBA 4M2ZA 2EL5A 1YYOA 2EOQA 1G2FC 4NHRA 3F6GA 3KWRA 5IWAE
chains in the Genus database with same CATH topology
2EOYA 1X6EA 2EN1A 5KL2A 2HGHA 2EN3A 4R2PA 2EOJA 1NCSA 2EM9A 2EMZA 1YUJA 2EM6A 1P47A 4GZNC 2EE8A 2YTNA 2J7JA 5KL5A 2EMGA 2YTIA 1A1GA 2CTDA 2R1FA 1TN9A 4F2JC 2RSIA 2A25A 2EOFA 2LV2A 2CT1A 3MHHC 2EM8A 2EMBA 1UN6B 2JP9A 2I13A 2EMAA 3M99B 2EPXA 2EMXA 2NABA 1A1KA 2MKDA 1A1IA 2DRPA 5KL6A 2EN2A 2CSHA 2EORA 2MDGA 3EPLA 2YSOA 2EQ3A 1YSAC 2LVHA 4FK5C 2JPAA 2ENHA 2EMHA 4M9VC 4F6NA 2YTQA 2GLIA 1ZAAC 2GHFA 1X6HA 2EMFA 2BB8A 5KL3A 2EOHA 2EJ4A 2EPUA 4R2QA 1JK1A 1BBOA 2ADRA 4R2CA 2EPPA 2PRTA 2EPRA 1X5WA 2EPAA 2EL6A 2YRKA 2LT7A 2EL4A 1ZR9A 2WCC3 2DLKA 5KL4A 4WSGA 1AAYA 2YU5A 2EOZA 2WBSA 2YTOA 2EMIA 1BB8A 4R2EA 1RMDA 1Z1BA 1TF6A 2M9AA 2E72A 1WJPA 2EN6A 4X9JA 2EM4A 2EOOA 2EN4A 2EOMA 2RPCA 2YTPA 4R2SA 4R2RA 2YTEA 2YRHA 5KL7A 1X3CA 2EMCA 1ZU1A 2EM0A 2YTJA 2EMYA 1TF3A 2D9HA 4R2DA 2EM5A 2EMLA 4R2AA 1A1HA 3UK3C 2EMWA 2EN8A 3EPHA 2EPZA 2ELZA 2EOSA 2EOXA 1A1LA 2ELYA 2EP3A 2LO3A 1X6FA 2ENCA 4F6MA 2DGCA 2EM2A 2WBTA 2WBUA 1UBDC 4IS1C 3VHTB 2EN7A 2YTDA 1B69A 2VRDA 2YTGA 1G2DC 3EPJA 2YSPA 2YTFA 2DMIA 2MKNA 2EM7A 3MHSC 1JK2A 1MEYC 1DGCA 2DLQA 2ENAA 4IJDA 1YUIA 2EQ0A 2YU8A 2YRMA 3EPKA 1F2IG 1A1FA 2EOIA 1KJKA 2EL5A 2EM3A 2EOQA 2EQ1A 2LCEA 1G2FC 2EOEA 1LLMC 1A1JA 2EMKA 2EPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOY A;  1X6E A;  2EN1 A;  5KL2 A;  2HGH A;  2EN3 A;  4R2P A;  2EOJ A;  1NCS A;  2EM9 A;  2EMZ A;  1YUJ A;  2EM6 A;  1P47 A;  4GZN C;  2EE8 A;  2YTN A;  2J7J A;  5KL5 A;  2EMG A;  2YTI A;  1A1G A;  2CTD A;  2R1F A;  1TN9 A;  4F2J C;  2RSI A;  2A25 A;  2EOF A;  2LV2 A;  2CT1 A;  3MHH C;  2EM8 A;  2EMB A;  1UN6 B;  2JP9 A;  2I13 A;  2EMA A;  3M99 B;  2EPX A;  2EMX A;  2NAB A;  1A1K A;  2MKD A;  1A1I A;  2DRP A;  5KL6 A;  2EN2 A;  2CSH A;  2EOR A;  2MDG A;  3EPL A;  2YSO A;  2EQ3 A;  1YSA C;  2LVH A;  4FK5 C;  2JPA A;  2ENH A;  2EMH A;  4M9V C;  4F6N A;  2YTQ A;  2GLI A;  1ZAA C;  2GHF A;  1X6H A;  2EMF A;  2BB8 A;  5KL3 A;  2EOH A;  2EJ4 A;  2EPU A;  4R2Q A;  1JK1 A;  1BBO A;  2ADR A;  4R2C A;  2EPP A;  2PRT A;  2EPR A;  1X5W A;  2EPA A;  2EL6 A;  2YRK A;  2LT7 A;  2EL4 A;  1ZR9 A;  2WCC 3;  2DLK A;  5KL4 A;  4WSG A;  1AAY A;  2YU5 A;  2EOZ A;  2WBS A;  2YTO A;  2EMI A;  1BB8 A;  4R2E A;  1RMD A;  1Z1B A;  1TF6 A;  2M9A A;  2E72 A;  1WJP A;  2EN6 A;  4X9J A;  2EM4 A;  2EOO A;  2EN4 A;  2EOM A;  2RPC A;  2YTP A;  4R2S A;  4R2R A;  2YTE A;  2YRH A;  5KL7 A;  1X3C A;  2EMC A;  1ZU1 A;  2EM0 A;  2YTJ A;  2EMY A;  1TF3 A;  2D9H A;  4R2D A;  2EM5 A;  2EML A;  4R2A A;  1A1H A;  3UK3 C;  2EMW A;  2EN8 A;  3EPH A;  2EPZ A;  2ELZ A;  2EOS A;  2EOX A;  1A1L A;  2ELY A;  2EP3 A;  2LO3 A;  1X6F A;  2ENC A;  4F6M A;  2DGC A;  2EM2 A;  2WBT A;  2WBU A;  1UBD C;  4IS1 C;  3VHT B;  2EN7 A;  2YTD A;  1B69 A;  2VRD A;  2YTG A;  1G2D C;  3EPJ A;  2YSP A;  2YTF A;  2DMI A;  2MKN A;  2EM7 A;  3MHS C;  1JK2 A;  1MEY C;  1DGC A;  2DLQ A;  2ENA A;  4IJD A;  1YUI A;  2EQ0 A;  2YU8 A;  2YRM A;  3EPK A;  1F2I G;  1A1F A;  2EOI A;  1KJK A;  2EL5 A;  2EM3 A;  2EOQ A;  2EQ1 A;  2LCE A;  1G2F C;  2EOE A;  1LLM C;  1A1J A;  2EMK A;  2EPC A; 
#chains in the Genus database with same CATH topology
 2EOY A;  5LL6 R;  4JI7 E;  1T38 A;  4JI3 E;  2EMZ A;  1N36 E;  2UUC E;  2HJJ A;  2YTI A;  1PKP A;  2LE2 A;  3VYY A;  2CPN A;  2JY9 A;  2RSI A;  3JTZ A;  2YWQ A;  3HQ1 A;  2CT1 A;  1EH8 A;  2EM8 A;  2V88 A;  1UN6 B;  2I13 A;  2RTX A;  2M4I A;  4BBY A;  2V89 A;  2MKD A;  2DRP A;  5KL6 A;  2EOR A;  5TSE A;  2MDG A;  3J81 C;  2LVH A;  4DKK A;  2F4V E;  4F6N A;  4LF6 E;  4DUY E;  1PDA A;  2NUG A;  4LTY A;  4WXC A;  2EMF A;  4JYA E;  2BB8 A;  2FGG A;  4KZS A;  2L92 A;  2WZO A;  2K4V A;  2NUF A;  2JVA A;  4LF5 E;  1ZR9 A;  2DLK A;  5KL4 A;  4X62 E;  2N8X A;  2JXP A;  3HPS A;  4NXN E;  1O0W A;  1EH7 A;  1J5E E;  2E1M A;  2YTE A;  4P7D A;  3THO B;  5LMU E;  1GZ6 A;  1IBK E;  2EMC A;  2MC6 A;  2ODR D;  3JAM C;  4AQY E;  4NXM E;  1T39 A;  2EMW A;  2EN8 A;  1EKZ A;  3J7Y p;  2L33 A;  4ZYE A;  2EOX A;  4I8O A;  3VK6 A;  3C6M A;  1X49 A;  2DGC A;  4DV2 E;  5A6J A;  2WBU A;  4O5G A;  3ADL A;  2EN7 A;  4DR5 E;  1PJS A;  2V86 A;  4DR2 E;  2YTF A;  1HNZ E;  1DQ3 A;  2DMI A;  3DF6 A;  1DGC A;  3ADI A;  3LML A;  4B3R E;  4DV6 E;  4IJD A;  4DR1 E;  2YU8 A;  3EPK A;  2JOB A;  2EM3 A;  2N3G A;  3F6H A;  4LF4 E;  1LLM C;  1GTK A;  2EPC A;  1P47 A;  2EN1 A;  4O4K A;  5KL2 A;  2EN3 A;  2UXC E;  1N34 E;  2EOJ A;  3BBG A;  1NCS A;  1J26 A;  2EM9 A;  4X66 E;  2EM6 A;  2UUB E;  2YTN A;  1IMU A;  3K6Q A;  5KL5 A;  3P1X A;  4LFB E;  2K7I A;  3ADJ A;  4F2J C;  4X64 E;  5A6K A;  2LV2 A;  2EPK X;  2HC5 A;  1UHZ A;  2EMB A;  4LF9 E;  2MC5 A;  3QG5 C;  2DB2 A;  3M99 B;  2EPX A;  4DUZ E;  2V87 A;  1A1I A;  4DV3 E;  1NEI A;  1WRJ A;  2L2N A;  4WYQ B;  2YSO A;  2EQ3 A;  2GPI A;  4FK5 C;  2ENH A;  2DSY A;  2GHF A;  4BHB A;  4TUI A;  5KL3 A;  2EJ4 A;  2EPU A;  2L3C A;  4BHC A;  3LLH A;  1BBG A;  1I94 E;  2NA2 A;  4BS9 A;  1IBL E;  2VQF E;  2EPP A;  5A2Q C;  2EPA A;  5F3W A;  2EL6 A;  1KYQ A;  1IQO A;  2B7T A;  2WCC 3;  4DR4 E;  4WSG A;  2YU5 A;  2EOZ A;  3KZY A;  1BB8 A;  4BCA A;  1RMD A;  2E72 A;  4DR7 E;  4X9J A;  2B7V A;  2EOO A;  4HEI A;  1HR0 E;  1YZ9 A;  4JI6 E;  2RPC A;  2YTP A;  1N33 E;  3AV0 A;  4R2R A;  3AUZ A;  2YRH A;  3ZOQ B;  5KL7 A;  1X3C A;  2YTJ A;  2EMY A;  5FLX C;  4F54 A;  2F8B A;  2LMZ A;  2EM5 A;  4R03 A;  3EQ1 A;  4JI2 E;  1ZBQ A;  2ELZ A;  2EOS A;  2UXD E;  1X6F A;  2ENC A;  1STU A;  2JWO A;  2YZT A;  4OX9 E;  1B69 A;  4JV5 E;  2VRD A;  2YTG A;  4RHB B;  1MGT A;  5A69 A;  4L8N A;  1X48 A;  3KZZ A;  2EPL X;  2VE7 C;  4DV7 E;  4JI4 E;  3MHS C;  1JK2 A;  1XNR E;  2DLQ A;  2UXB E;  1T4O A;  2EQ0 A;  4B3M E;  1F2I G;  1XNQ E;  4P78 A;  4DR3 E;  2EOI A;  3BF2 A;  1KJK A;  3TQM A;  1L4S A;  2BBG A;  4TUG A;  1HNW E;  3H09 A;  4R8O A;  2DIX A;  5A6B A;  2EOE A;  2EMK A;  1X6E A;  3JU0 A;  5AE3 A;  2HGH A;  2NUE A;  1PJT A;  4HTG A;  1YPN A;  4RH8 A;  4GZN C;  1SR9 A;  2EE8 A;  4KHP E;  2J7J A;  1YFH A;  1TN9 A;  5CFF E;  2A25 A;  2EOF A;  3T1Y E;  2KON A;  3MHH C;  2JP9 A;  2JYA A;  4BC7 A;  2EMA A;  1IBM E;  1A1K A;  2NAB A;  1EH6 A;  2EN2 A;  2CSH A;  4MLQ A;  2N3H A;  3EPL A;  2YT4 A;  4LFC E;  4JI8 E;  2JPA A;  2EMH A;  4M9V C;  2YTQ A;  2GLI A;  1ZAA C;  5T6J A;  1WHN A;  3DJW A;  4WXD A;  2EOH A;  4WFT A;  4B3S E;  1JK1 A;  2LJH A;  2ADR A;  1T4N A;  4R2C A;  2JR1 A;  2PRT A;  2LBS B;  4X8W A;  4B3T E;  2EPR A;  2LT7 A;  2ZM6 E;  5AE1 A;  1AAY A;  1AH5 A;  4KWY A;  2YTO A;  1SFE A;  2EMI A;  2EWL A;  4R2E A;  2UUA E;  1YYW A;  2M9A A;  4ZYG A;  1N3G A;  2LUP B;  2UU9 E;  2KHX A;  2EM4 A;  1PJQ A;  3MSW A;  2YPN A;  3BGH A;  3L00 A;  1ZU1 A;  2EM0 A;  2L6M A;  1TF3 A;  1A1H A;  4R2D A;  4R2A A;  3C4B A;  1QU6 A;  2EZ6 A;  5A6A A;  3EPH A;  1UIL A;  2EPZ A;  4DMI A;  5BR8 E;  2EPN A;  2EP3 A;  4F6M A;  2EM2 A;  1UBD C;  3T1H E;  3VHT B;  3BID A;  4OOG C;  2VQE E;  2RS7 A;  4J8Z A;  3C4T A;  1ZBT A;  5DNY A;  4GKK E;  3OML A;  3EPJ A;  2YSP A;  4Q28 A;  2VF1 A;  4WPY A;  4LU9 A;  3ECR A;  2MKN A;  2EM7 A;  4M30 A;  5IXM B;  1MEY C;  2LTR A;  2JOX A;  2Q8U A;  2YRM A;  4JI1 E;  4WSP A;  1A1F A;  4LF8 E;  4DV1 E;  3HXL A;  4LFA E;  4GKJ E;  2EQ1 A;  2LCE A;  1A1J A;  2RQL A;  1WHQ A;  4N4R B;  3J7A G;  4R2P A;  1XMO E;  4O24 A;  4F9C B;  3OTO E;  1YUJ A;  1WXR A;  4GEQ B;  1X47 A;  4MLV A;  3ADG A;  5IV8 B;  4BC9 A;  2EPO A;  2EMG A;  1A1G A;  2CTD A;  2R1F A;  4L5N C;  1YYK A;  3J80 C;  4F9A B;  1GQE A;  3IWD A;  5AC5 A;  2RS6 A;  4K0K E;  2EMX A;  2L8T A;  2DMY A;  2LRS A;  2V8Q B;  2KOU A;  4ZYD A;  2I9I A;  5LMN E;  3HTX A;  1YSA C;  3VYX A;  4DV4 E;  4ZYH A;  3RMP A;  1X6H A;  2G7H A;  1DI2 A;  2R76 A;  2L3J A;  3C6K A;  4R2Q A;  1BBO A;  2LTS A;  4WX9 A;  4YHH E;  5IT9 C;  2HHH E;  1X5W A;  2YRK A;  2ODR C;  2EL4 A;  1RC7 A;  2B3T B;  2WBS A;  2B9D A;  2LJU A;  4F9B B;  1TF6 A;  1Z1B A;  2LUQ A;  4X65 E;  1WJP A;  3IWC A;  2EN6 A;  4DV0 E;  2EN4 A;  2EOM A;  4R2S A;  4M0V A;  1IQS A;  1T4L B;  2FV4 B;  3FIG A;  2D9H A;  2EML A;  3UK3 C;  5AE2 A;  4DV5 E;  2IHR 1;  1FJG E;  4LF7 E;  4JI0 E;  4BMJ A;  1A1L A;  2ELY A;  4YY3 E;  2LO3 A;  5A6B D;  2RSM A;  2H36 X;  2WBT A;  1FKA E;  4Q35 B;  5AC4 A;  4IS1 C;  2YTD A;  2FTX B;  2MDR A;  2M1S A;  5ADZ A;  5AAS A;  4JI5 E;  3HPZ A;  1G2D C;  2E5L E;  2M7Q A;  4DR6 E;  5LLQ A;  1QNT A;  1XMQ E;  2L2M A;  1HNX E;  2EPM X;  1N32 E;  1RQ0 A;  2ENA A;  2L2K B;  2V83 A;  4NZV A;  1YUI A;  3THN A;  4O43 A;  2V85 A;  3IWB A;  4M2Z A;  2EL5 A;  1YYO A;  2EOQ A;  1G2F C;  4NHR A;  3F6G A;  3KWR A;  5IWA E; 
#chains in the Genus database with same CATH homology
 2EOY A;  1X6E A;  2EN1 A;  5KL2 A;  2HGH A;  2EN3 A;  4R2P A;  2EOJ A;  1NCS A;  2EM9 A;  2EMZ A;  1YUJ A;  2EM6 A;  1P47 A;  4GZN C;  2EE8 A;  2YTN A;  2J7J A;  5KL5 A;  2EMG A;  2YTI A;  1A1G A;  2CTD A;  2R1F A;  1TN9 A;  4F2J C;  2RSI A;  2A25 A;  2EOF A;  2LV2 A;  2CT1 A;  3MHH C;  2EM8 A;  2EMB A;  1UN6 B;  2JP9 A;  2I13 A;  2EMA A;  3M99 B;  2EPX A;  2EMX A;  2NAB A;  1A1K A;  2MKD A;  1A1I A;  2DRP A;  5KL6 A;  2EN2 A;  2CSH A;  2EOR A;  2MDG A;  3EPL A;  2YSO A;  2EQ3 A;  1YSA C;  2LVH A;  4FK5 C;  2JPA A;  2ENH A;  2EMH A;  4M9V C;  4F6N A;  2YTQ A;  2GLI A;  1ZAA C;  2GHF A;  1X6H A;  2EMF A;  2BB8 A;  5KL3 A;  2EOH A;  2EJ4 A;  2EPU A;  4R2Q A;  1JK1 A;  1BBO A;  2ADR A;  4R2C A;  2EPP A;  2PRT A;  2EPR A;  1X5W A;  2EPA A;  2EL6 A;  2YRK A;  2LT7 A;  2EL4 A;  1ZR9 A;  2WCC 3;  2DLK A;  5KL4 A;  4WSG A;  1AAY A;  2YU5 A;  2EOZ A;  2WBS A;  2YTO A;  2EMI A;  1BB8 A;  4R2E A;  1RMD A;  1Z1B A;  1TF6 A;  2M9A A;  2E72 A;  1WJP A;  2EN6 A;  4X9J A;  2EM4 A;  2EOO A;  2EN4 A;  2EOM A;  2RPC A;  2YTP A;  4R2S A;  4R2R A;  2YTE A;  2YRH A;  5KL7 A;  1X3C A;  2EMC A;  1ZU1 A;  2EM0 A;  2YTJ A;  2EMY A;  1TF3 A;  2D9H A;  4R2D A;  2EM5 A;  2EML A;  4R2A A;  1A1H A;  3UK3 C;  2EMW A;  2EN8 A;  3EPH A;  2EPZ A;  2ELZ A;  2EOS A;  2EOX A;  1A1L A;  2ELY A;  2EP3 A;  2LO3 A;  1X6F A;  2ENC A;  4F6M A;  2DGC A;  2EM2 A;  2WBT A;  2WBU A;  1UBD C;  4IS1 C;  3VHT B;  2EN7 A;  2YTD A;  1B69 A;  2VRD A;  2YTG A;  1G2D C;  3EPJ A;  2YSP A;  2YTF A;  2DMI A;  2MKN A;  2EM7 A;  3MHS C;  1JK2 A;  1MEY C;  1DGC A;  2DLQ A;  2ENA A;  4IJD A;  1YUI A;  2EQ0 A;  2YU8 A;  2YRM A;  3EPK A;  1F2I G;  1A1F A;  2EOI A;  1KJK A;  2EL5 A;  2EM3 A;  2EOQ A;  2EQ1 A;  2LCE A;  1G2F C;  2EOE A;  1LLM C;  1A1J A;  2EMK A;  2EPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...