5KL5A

Wilms tumor protein (wt1) znf2-4 q369h in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl5A00
3EPLA 2WBSA 2ENAA 2EPUA 2EN7A 2EP3A 1TF3A 2ADRA 2EOZA 2D9HA 4F2JC 2EMBA 2RSIA 3EPKA 2HGHA 2EM5A 2EN1A 2EJ4A 1G2DC 1WJPA 1ZR9A 2LV2A 2YSPA 1NCSA 2EQ3A 2YTOA 2EOOA 2GHFA 2M9AA 4R2EA 3EPJA 2EM2A 2EOFA 1X6HA 1BBOA 2EOMA 2A25A 2EM3A 2EOHA 2EN4A 3MHSC 2JP9A 2EOEA 2MKDA 2EQ1A 2EMGA 2LVHA 2YRMA 1A1JA 2LCEA 2WBTA 2EPXA 4FK5C 2CSHA 5KL5A 4R2CA 2WCC3 5KL7A 1MEYC 1KJKA 2EE8A 2LT7A 2YTNA 2EM7A 3VHTB 2LO3A 2YRHA 2EL6A 1ZU1A 2DRPA 2GLIA 2EOIA 2YTDA 1TN9A 2DLQA 2YSOA 3M99B 2EM0A 1LLMC 2EMLA 2MDGA 4R2RA 2EOXA 1AAYA 2DLKA 2YU8A 4F6NA 2DGCA 2YRKA 2CT1A 3MHHC 1RMDA 2EN8A 2YTEA 1F2IG 4R2QA 1X5WA 2EM6A 2YU5A 2E72A 4IJDA 5KL3A 5KL4A 1TF6A 4X9JA 5KL6A 4R2AA 1JK2A 1YUJA 1X6FA 2JPAA 1A1GA 2ELZA 2EPAA 2EQ0A 4WSGA 2WBUA 3EPHA 2EOQA 2ELYA 2EMIA 2YTJA 1A1KA 5KL2A 4R2PA 2EMCA 1JK1A 2VRDA 2R1FA 2EMKA 2ENCA 2ENHA 4IS1C 2EMYA 2EMXA 2EL4A 2EMAA 2EMWA 2RPCA 1P47A 1G2FC 1YUIA 2YTPA 1YSAC 4M9VC 4R2DA 1X6EA 1A1FA 2EM9A 2EN6A 1UBDC 2EMFA 2EN2A 2EPPA 1B69A 2EMHA 1A1IA 2BB8A 1A1LA 1X3CA 2CTDA 2EM8A 2YTFA 4GZNC 1A1HA 2EOYA 1DGCA 2DMIA 2EOSA 4R2SA 1UN6B 1BB8A 2YTGA 2YTQA 2EPRA 2EMZA 2EPCA 2EORA 2YTIA 2MKNA 4F6MA 2I13A 2EPZA 2EOJA 1ZAAC 2NABA 2EL5A 3UK3C 1Z1BA 2PRTA 2EN3A 2EM4A 2J7JA
chains in the Genus database with same CATH superfamily
1BBGA 4ZYHA 3IWCA 3HXLA 4JI6E 1T38A 2L2KB 2EP3A 2D9HA 4F2JC 2B9DA 4DR3E 4JI4E 2VQEE 1FKAE 2JOBA 4NHRA 2YSPA 1NCSA 2YTOA 2EOOA 2NUFA 4LFAE 2IHR1 4JI1E 2N3GA 1BBOA 2EM3A 2KHXA 4OOGC 4B3TE 2L33A 2EQ1A 2ZM6E 1T4LB 2V83A 4KZSA 2WBTA 2L3CA 2CSHA 2KONA 1MEYC 5KL7A 5IXMB 5AC5A 2EM7A 4X65E 2MC6A 1GQEA 2EL6A 1TN9A 4P7DA 1WHQA 4O24A 2RQLA 4F6NA 2JXPA 1F2IG 2EN8A 2YTEA 5A6BA 2EWLA 4R2QA 4IJDA 2K7IA 1JK2A 2UU9E 1YUJA 3ADLA 4JV5E 1DQ3A 2EQ0A 2UXBE 4WSGA 2LUQA 4BBYA 1PJQA 2ELYA 4LF7E 3C4BA 5KL2A 2DMYA 4ZYEA 1JK1A 2B7VA 2KOUA 4BHBA 1EH6A 2MC5A 2ENCA 2ENHA 3J7Yp 4DV2E 2EMXA 5T6JA 2EL4A 2EMAA 1KYQA 1YUIA 2L2MA 2UXDE 4X64E 4M9VC 2EM9A 2EN6A 4Q28A 2WZOA 4F54A 2FTXB 5CFFE 1PDAA 4DKKA 2VF1A 4MLVA 1X47A 3ADGA 4GKKE 1T4OA 2N3HA 2YZTA 2EM8A 2EPKX 2LE2A 4DMIA 3OMLA 3ZOQB 2YTQA 1HR0E 2V88A 4M30A 2EORA 2V89A 2V8QB 4P78A 3HPZA 3OTOE 2VQFE 4K0KE 4GEQB 2EPZA 1X48A 1ZAAC 4LFCE 2NABA 2EN3A 4BC7A 3EPLA 1ZBTA 3T1HE 1X49A 3J81C 4DUYE 4JI3E 3EPKA 2HGHA 3KZYA 3QG5C 4DV1E 2LV2A 2GHFA 5DNYA 1HNWE 1AH5A 2JY9A 1N34E 5IV8B 1RQ0A 2NUEA 3J7AG 4LTYA 2EOFA 4WXCA 4AQYE 3VYYA 2EOHA 2JP9A 1XMQE 4JI2E 2MKDA 2EMGA 2LVHA 4LF6E 4WSPA 4F9BB 3BBGA 2EPOA 4JI8E 3HTXA 1J5EE 5TSEA 2WCC3 3DF6A 4JI7E 2LT7A 2E5LE 3VK6A 4DV0E 2LO3A 3THNA 2NUGA 5AC4A 3JTZA 1XMOE 1ZBQA 2EM0A 4WXDA 1LLMC 2EMLA 5AE3A 2N8XA 2DLKA 2L92A 4YY3E 2YU5A 5KL4A 5AE1A 1X6FA 2ELZA 4JYAE 2WBUA 3LMLA 2EOQA 1XNQE 3MSWA 2LTSA 2R76A 2EMIA 1YYWA 1A1KA 5FLXC 5A6KA 3VYXA 3C6MA 1EH8A 2V85A 3K6QA 4M0VA 3L00A 2EMWA 3DJWA 1G2FC 2B7TA 4J8ZA 3T1YE 1O0WA 1B69A 2DIXA 2BB8A 5LMNE 1IQSA 1HNZE 2F8BA 2CTDA 2YTFA 2V87A 2UUAE 4WX9A 1DGCA 2DMIA 2YTGA 5A2QC 2EZ6A 2JWOA 4F9CB 5AE2A 3C6KA 4TUIA 4JI0E 2EPLX 3JU0A 4M2ZA 4OX9E 4DV6E 2EL5A 3UK3C 4BMJA 2PRTA 2VE7C 2ODRD 2WBSA 2EPUA 1TF3A 4DV5E 2ADRA 2EMBA 5BR8E 2EN1A 1PKPA 2M7QA 1G2DC 1WJPA 4O5GA 2H36X 1IBKE 1ZR9A 4B3RE 4R2EA 2I9IA 3AUZA 2RSMA 2E1MA 3AV0A 4I8OA 1X6HA 4NXNE 2EOMA 1STUA 3H09A 3MHSC 1NEIA 3HPSA 4YHHE 2MDRA 2DB2A 2YRMA 1UHZA 4LF5E 2EPXA 4FK5C 4R2CA 1KJKA 3IWBA 1N3GA 4X66E 3KZZA 2GLIA 2EOIA 1YYKA 1EH7A 4N4RB 2YTDA 2DLQA 1YFHA 3ADJA 2MDGA 1SFEA 4DV7E 1T39A 2YRKA 2CT1A 3MHHC 1RMDA 2ODRC 3BF2A 1X5WA 2EM6A 5KL3A 1TF6A 4X9JA 2CPNA 5KL6A 4R2AA 1A1GA 1QNTA 1GZ6A 2HJJA 1YZ9A 3EQ1A 3EPHA 1IBLE 1IMUA 4L5NC 4KHPE 2UUBE 4HEIA 3BIDA 5AASA 4NZVA 1WXRA 2RTXA 2EMCA 3RMPA 2VRDA 2R1FA 3JAMC 5IT9C 4IS1C 2F4VE 2EMYA 4BC9A 2RS7A 1P47A 3J80C 2L2NA 4R2DA 1X6EA 1A1FA 1HNXE 2EN2A 2EPPA 2EMHA 2M1SA 2JOXA 2FGGA 2LTRA 2LRSA 3F6GA 2B3TB 4Q35B 1X3CA 4GZNC 2HHHE 2EOSA 4LFBE 4R2SA 1BB8A 4O4KA 4F9AB 1XNRE 2EPRA 2EMZA 2EPCA 3P1XA 4GKJE 2YTIA 2YWQA 2MKNA 4DR4E 2JR1A 4O43A 1YYOA 2YPNA 4RH8A 4BCAA 1Z1BA 1IBME 5LMUE 2EM4A 2J7JA 2LMZA 2EPNA 2ENAA 2EN7A 2EOZA 3HQ1A 2M4IA 2RSIA 2EM5A 2EJ4A 4DUZE 2LJHA 1I94E 5A6JA 2EQ3A 3ADIA 2M9AA 3EPJA 1N36E 4DR6E 4DR7E 3THOB 3C4TA 4B3SE 4B3ME 2EM2A 2G7HA 1IQOA 2A25A 2EN4A 2EOEA 4L8NA 4R03A 4DR2E 1L4SA 1A1JA 2LCEA 4ZYDA 3KWRA 4X62E 1J26A 2LUPB 4NXME 1PJTA 5KL5A 2Q8UA 1EKZA 4TUGA 2EE8A 2NA2A 2YTNA 5A69A 3VHTB 5IWAE 4DR1E 2YT4A 2LJUA 5ADZA 1SR9A 2YRHA 4WYQB 2DRPA 1ZU1A 2HC5A 2L8TA 3FIGA 4KWYA 2YSOA 3M99B 4X8WA 4MLQA 5F3WA 2V86A 4R2RA 4R8OA 2EOXA 1AAYA 2YU8A 2DGCA 4BHCA 4JI5E 1N32E 3ECRA 2E72A 2JPAA 2EPAA 2BBGA 4DV3E 2YTJA 2K4VA 2GPIA 4R2PA 1YPNA 2EMKA 5LL6R 4BS9A 5LLQA 4LF4E 1RC7A 3LLHA 2RPCA 1GTKA 4WPYA 2L3JA 4DR5E 2YTPA 1YSAC 2JYAA 2RS6A 1UBDC 2EMFA 5A6BD 1A1IA 4RHBB 3IWDA 4WFTA 4DV4E 1WHNA 1N33E 1DI2A 1A1LA 1QU6A 1T4NA 1A1HA 1PJSA 2DSYA 2EOYA 1UN6B 4LF9E 2FV4B 4HTGA 4LU9A 2LBSB 4ZYGA 2UUCE 3BGHA 1MGTA 1UILA 2L6MA 4F6MA 2I13A 2EOJA 2JVAA 2UXCE 1FJGE 4LF8E 3F6HA 3TQMA 1WRJA 5A6AA 2EPMX
chains in the Genus database with same CATH topology
3EPLA 2WBSA 2ENAA 2EPUA 2EN7A 2EP3A 1TF3A 2ADRA 2EOZA 2D9HA 4F2JC 2EMBA 2RSIA 3EPKA 2HGHA 2EM5A 2EN1A 2EJ4A 1G2DC 1WJPA 1ZR9A 2LV2A 2YSPA 1NCSA 2EQ3A 2YTOA 2EOOA 2GHFA 2M9AA 4R2EA 3EPJA 2EM2A 2EOFA 1X6HA 1BBOA 2EOMA 2A25A 2EM3A 2EOHA 2EN4A 3MHSC 2JP9A 2EOEA 2MKDA 2EQ1A 2EMGA 2LVHA 2YRMA 1A1JA 2LCEA 2WBTA 2EPXA 4FK5C 2CSHA 5KL5A 4R2CA 2WCC3 5KL7A 1MEYC 1KJKA 2EE8A 2LT7A 2YTNA 2EM7A 3VHTB 2LO3A 2YRHA 2EL6A 1ZU1A 2DRPA 2GLIA 2EOIA 2YTDA 1TN9A 2DLQA 2YSOA 3M99B 2EM0A 1LLMC 2EMLA 2MDGA 4R2RA 2EOXA 1AAYA 2DLKA 2YU8A 4F6NA 2DGCA 2YRKA 2CT1A 3MHHC 1RMDA 2EN8A 2YTEA 1F2IG 4R2QA 1X5WA 2EM6A 2YU5A 2E72A 4IJDA 5KL3A 5KL4A 1TF6A 4X9JA 5KL6A 4R2AA 1JK2A 1YUJA 1X6FA 2JPAA 1A1GA 2ELZA 2EPAA 2EQ0A 4WSGA 2WBUA 3EPHA 2EOQA 2ELYA 2EMIA 2YTJA 1A1KA 5KL2A 4R2PA 2EMCA 1JK1A 2VRDA 2R1FA 2EMKA 2ENCA 2ENHA 4IS1C 2EMYA 2EMXA 2EL4A 2EMAA 2EMWA 2RPCA 1P47A 1G2FC 1YUIA 2YTPA 1YSAC 4M9VC 4R2DA 1X6EA 1A1FA 2EM9A 2EN6A 1UBDC 2EMFA 2EN2A 2EPPA 1B69A 2EMHA 1A1IA 2BB8A 1A1LA 1X3CA 2CTDA 2EM8A 2YTFA 4GZNC 1A1HA 2EOYA 1DGCA 2DMIA 2EOSA 4R2SA 1UN6B 1BB8A 2YTGA 2YTQA 2EPRA 2EMZA 2EPCA 2EORA 2YTIA 2MKNA 4F6MA 2I13A 2EPZA 2EOJA 1ZAAC 2NABA 2EL5A 3UK3C 1Z1BA 2PRTA 2EN3A 2EM4A 2J7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPL A;  2WBS A;  2ENA A;  2EPU A;  2EN7 A;  2EP3 A;  1TF3 A;  2ADR A;  2EOZ A;  2D9H A;  4F2J C;  2EMB A;  2RSI A;  3EPK A;  2HGH A;  2EM5 A;  2EN1 A;  2EJ4 A;  1G2D C;  1WJP A;  1ZR9 A;  2LV2 A;  2YSP A;  1NCS A;  2EQ3 A;  2YTO A;  2EOO A;  2GHF A;  2M9A A;  4R2E A;  3EPJ A;  2EM2 A;  2EOF A;  1X6H A;  1BBO A;  2EOM A;  2A25 A;  2EM3 A;  2EOH A;  2EN4 A;  3MHS C;  2JP9 A;  2EOE A;  2MKD A;  2EQ1 A;  2EMG A;  2LVH A;  2YRM A;  1A1J A;  2LCE A;  2WBT A;  2EPX A;  4FK5 C;  2CSH A;  5KL5 A;  4R2C A;  2WCC 3;  5KL7 A;  1MEY C;  1KJK A;  2EE8 A;  2LT7 A;  2YTN A;  2EM7 A;  3VHT B;  2LO3 A;  2YRH A;  2EL6 A;  1ZU1 A;  2DRP A;  2GLI A;  2EOI A;  2YTD A;  1TN9 A;  2DLQ A;  2YSO A;  3M99 B;  2EM0 A;  1LLM C;  2EML A;  2MDG A;  4R2R A;  2EOX A;  1AAY A;  2DLK A;  2YU8 A;  4F6N A;  2DGC A;  2YRK A;  2CT1 A;  3MHH C;  1RMD A;  2EN8 A;  2YTE A;  1F2I G;  4R2Q A;  1X5W A;  2EM6 A;  2YU5 A;  2E72 A;  4IJD A;  5KL3 A;  5KL4 A;  1TF6 A;  4X9J A;  5KL6 A;  4R2A A;  1JK2 A;  1YUJ A;  1X6F A;  2JPA A;  1A1G A;  2ELZ A;  2EPA A;  2EQ0 A;  4WSG A;  2WBU A;  3EPH A;  2EOQ A;  2ELY A;  2EMI A;  2YTJ A;  1A1K A;  5KL2 A;  4R2P A;  2EMC A;  1JK1 A;  2VRD A;  2R1F A;  2EMK A;  2ENC A;  2ENH A;  4IS1 C;  2EMY A;  2EMX A;  2EL4 A;  2EMA A;  2EMW A;  2RPC A;  1P47 A;  1G2F C;  1YUI A;  2YTP A;  1YSA C;  4M9V C;  4R2D A;  1X6E A;  1A1F A;  2EM9 A;  2EN6 A;  1UBD C;  2EMF A;  2EN2 A;  2EPP A;  1B69 A;  2EMH A;  1A1I A;  2BB8 A;  1A1L A;  1X3C A;  2CTD A;  2EM8 A;  2YTF A;  4GZN C;  1A1H A;  2EOY A;  1DGC A;  2DMI A;  2EOS A;  4R2S A;  1UN6 B;  1BB8 A;  2YTG A;  2YTQ A;  2EPR A;  2EMZ A;  2EPC A;  2EOR A;  2YTI A;  2MKN A;  4F6M A;  2I13 A;  2EPZ A;  2EOJ A;  1ZAA C;  2NAB A;  2EL5 A;  3UK3 C;  1Z1B A;  2PRT A;  2EN3 A;  2EM4 A;  2J7J A; 
#chains in the Genus database with same CATH topology
 1BBG A;  4ZYH A;  3IWC A;  3HXL A;  4JI6 E;  1T38 A;  2L2K B;  2EP3 A;  2D9H A;  4F2J C;  2B9D A;  4DR3 E;  4JI4 E;  2VQE E;  1FKA E;  2JOB A;  4NHR A;  2YSP A;  1NCS A;  2YTO A;  2EOO A;  2NUF A;  4LFA E;  2IHR 1;  4JI1 E;  2N3G A;  1BBO A;  2EM3 A;  2KHX A;  4OOG C;  4B3T E;  2L33 A;  2EQ1 A;  2ZM6 E;  1T4L B;  2V83 A;  4KZS A;  2WBT A;  2L3C A;  2CSH A;  2KON A;  1MEY C;  5KL7 A;  5IXM B;  5AC5 A;  2EM7 A;  4X65 E;  2MC6 A;  1GQE A;  2EL6 A;  1TN9 A;  4P7D A;  1WHQ A;  4O24 A;  2RQL A;  4F6N A;  2JXP A;  1F2I G;  2EN8 A;  2YTE A;  5A6B A;  2EWL A;  4R2Q A;  4IJD A;  2K7I A;  1JK2 A;  2UU9 E;  1YUJ A;  3ADL A;  4JV5 E;  1DQ3 A;  2EQ0 A;  2UXB E;  4WSG A;  2LUQ A;  4BBY A;  1PJQ A;  2ELY A;  4LF7 E;  3C4B A;  5KL2 A;  2DMY A;  4ZYE A;  1JK1 A;  2B7V A;  2KOU A;  4BHB A;  1EH6 A;  2MC5 A;  2ENC A;  2ENH A;  3J7Y p;  4DV2 E;  2EMX A;  5T6J A;  2EL4 A;  2EMA A;  1KYQ A;  1YUI A;  2L2M A;  2UXD E;  4X64 E;  4M9V C;  2EM9 A;  2EN6 A;  4Q28 A;  2WZO A;  4F54 A;  2FTX B;  5CFF E;  1PDA A;  4DKK A;  2VF1 A;  4MLV A;  1X47 A;  3ADG A;  4GKK E;  1T4O A;  2N3H A;  2YZT A;  2EM8 A;  2EPK X;  2LE2 A;  4DMI A;  3OML A;  3ZOQ B;  2YTQ A;  1HR0 E;  2V88 A;  4M30 A;  2EOR A;  2V89 A;  2V8Q B;  4P78 A;  3HPZ A;  3OTO E;  2VQF E;  4K0K E;  4GEQ B;  2EPZ A;  1X48 A;  1ZAA C;  4LFC E;  2NAB A;  2EN3 A;  4BC7 A;  3EPL A;  1ZBT A;  3T1H E;  1X49 A;  3J81 C;  4DUY E;  4JI3 E;  3EPK A;  2HGH A;  3KZY A;  3QG5 C;  4DV1 E;  2LV2 A;  2GHF A;  5DNY A;  1HNW E;  1AH5 A;  2JY9 A;  1N34 E;  5IV8 B;  1RQ0 A;  2NUE A;  3J7A G;  4LTY A;  2EOF A;  4WXC A;  4AQY E;  3VYY A;  2EOH A;  2JP9 A;  1XMQ E;  4JI2 E;  2MKD A;  2EMG A;  2LVH A;  4LF6 E;  4WSP A;  4F9B B;  3BBG A;  2EPO A;  4JI8 E;  3HTX A;  1J5E E;  5TSE A;  2WCC 3;  3DF6 A;  4JI7 E;  2LT7 A;  2E5L E;  3VK6 A;  4DV0 E;  2LO3 A;  3THN A;  2NUG A;  5AC4 A;  3JTZ A;  1XMO E;  1ZBQ A;  2EM0 A;  4WXD A;  1LLM C;  2EML A;  5AE3 A;  2N8X A;  2DLK A;  2L92 A;  4YY3 E;  2YU5 A;  5KL4 A;  5AE1 A;  1X6F A;  2ELZ A;  4JYA E;  2WBU A;  3LML A;  2EOQ A;  1XNQ E;  3MSW A;  2LTS A;  2R76 A;  2EMI A;  1YYW A;  1A1K A;  5FLX C;  5A6K A;  3VYX A;  3C6M A;  1EH8 A;  2V85 A;  3K6Q A;  4M0V A;  3L00 A;  2EMW A;  3DJW A;  1G2F C;  2B7T A;  4J8Z A;  3T1Y E;  1O0W A;  1B69 A;  2DIX A;  2BB8 A;  5LMN E;  1IQS A;  1HNZ E;  2F8B A;  2CTD A;  2YTF A;  2V87 A;  2UUA E;  4WX9 A;  1DGC A;  2DMI A;  2YTG A;  5A2Q C;  2EZ6 A;  2JWO A;  4F9C B;  5AE2 A;  3C6K A;  4TUI A;  4JI0 E;  2EPL X;  3JU0 A;  4M2Z A;  4OX9 E;  4DV6 E;  2EL5 A;  3UK3 C;  4BMJ A;  2PRT A;  2VE7 C;  2ODR D;  2WBS A;  2EPU A;  1TF3 A;  4DV5 E;  2ADR A;  2EMB A;  5BR8 E;  2EN1 A;  1PKP A;  2M7Q A;  1G2D C;  1WJP A;  4O5G A;  2H36 X;  1IBK E;  1ZR9 A;  4B3R E;  4R2E A;  2I9I A;  3AUZ A;  2RSM A;  2E1M A;  3AV0 A;  4I8O A;  1X6H A;  4NXN E;  2EOM A;  1STU A;  3H09 A;  3MHS C;  1NEI A;  3HPS A;  4YHH E;  2MDR A;  2DB2 A;  2YRM A;  1UHZ A;  4LF5 E;  2EPX A;  4FK5 C;  4R2C A;  1KJK A;  3IWB A;  1N3G A;  4X66 E;  3KZZ A;  2GLI A;  2EOI A;  1YYK A;  1EH7 A;  4N4R B;  2YTD A;  2DLQ A;  1YFH A;  3ADJ A;  2MDG A;  1SFE A;  4DV7 E;  1T39 A;  2YRK A;  2CT1 A;  3MHH C;  1RMD A;  2ODR C;  3BF2 A;  1X5W A;  2EM6 A;  5KL3 A;  1TF6 A;  4X9J A;  2CPN A;  5KL6 A;  4R2A A;  1A1G A;  1QNT A;  1GZ6 A;  2HJJ A;  1YZ9 A;  3EQ1 A;  3EPH A;  1IBL E;  1IMU A;  4L5N C;  4KHP E;  2UUB E;  4HEI A;  3BID A;  5AAS A;  4NZV A;  1WXR A;  2RTX A;  2EMC A;  3RMP A;  2VRD A;  2R1F A;  3JAM C;  5IT9 C;  4IS1 C;  2F4V E;  2EMY A;  4BC9 A;  2RS7 A;  1P47 A;  3J80 C;  2L2N A;  4R2D A;  1X6E A;  1A1F A;  1HNX E;  2EN2 A;  2EPP A;  2EMH A;  2M1S A;  2JOX A;  2FGG A;  2LTR A;  2LRS A;  3F6G A;  2B3T B;  4Q35 B;  1X3C A;  4GZN C;  2HHH E;  2EOS A;  4LFB E;  4R2S A;  1BB8 A;  4O4K A;  4F9A B;  1XNR E;  2EPR A;  2EMZ A;  2EPC A;  3P1X A;  4GKJ E;  2YTI A;  2YWQ A;  2MKN A;  4DR4 E;  2JR1 A;  4O43 A;  1YYO A;  2YPN A;  4RH8 A;  4BCA A;  1Z1B A;  1IBM E;  5LMU E;  2EM4 A;  2J7J A;  2LMZ A;  2EPN A;  2ENA A;  2EN7 A;  2EOZ A;  3HQ1 A;  2M4I A;  2RSI A;  2EM5 A;  2EJ4 A;  4DUZ E;  2LJH A;  1I94 E;  5A6J A;  2EQ3 A;  3ADI A;  2M9A A;  3EPJ A;  1N36 E;  4DR6 E;  4DR7 E;  3THO B;  3C4T A;  4B3S E;  4B3M E;  2EM2 A;  2G7H A;  1IQO A;  2A25 A;  2EN4 A;  2EOE A;  4L8N A;  4R03 A;  4DR2 E;  1L4S A;  1A1J A;  2LCE A;  4ZYD A;  3KWR A;  4X62 E;  1J26 A;  2LUP B;  4NXM E;  1PJT A;  5KL5 A;  2Q8U A;  1EKZ A;  4TUG A;  2EE8 A;  2NA2 A;  2YTN A;  5A69 A;  3VHT B;  5IWA E;  4DR1 E;  2YT4 A;  2LJU A;  5ADZ A;  1SR9 A;  2YRH A;  4WYQ B;  2DRP A;  1ZU1 A;  2HC5 A;  2L8T A;  3FIG A;  4KWY A;  2YSO A;  3M99 B;  4X8W A;  4MLQ A;  5F3W A;  2V86 A;  4R2R A;  4R8O A;  2EOX A;  1AAY A;  2YU8 A;  2DGC A;  4BHC A;  4JI5 E;  1N32 E;  3ECR A;  2E72 A;  2JPA A;  2EPA A;  2BBG A;  4DV3 E;  2YTJ A;  2K4V A;  2GPI A;  4R2P A;  1YPN A;  2EMK A;  5LL6 R;  4BS9 A;  5LLQ A;  4LF4 E;  1RC7 A;  3LLH A;  2RPC A;  1GTK A;  4WPY A;  2L3J A;  4DR5 E;  2YTP A;  1YSA C;  2JYA A;  2RS6 A;  1UBD C;  2EMF A;  5A6B D;  1A1I A;  4RHB B;  3IWD A;  4WFT A;  4DV4 E;  1WHN A;  1N33 E;  1DI2 A;  1A1L A;  1QU6 A;  1T4N A;  1A1H A;  1PJS A;  2DSY A;  2EOY A;  1UN6 B;  4LF9 E;  2FV4 B;  4HTG A;  4LU9 A;  2LBS B;  4ZYG A;  2UUC E;  3BGH A;  1MGT A;  1UIL A;  2L6M A;  4F6M A;  2I13 A;  2EOJ A;  2JVA A;  2UXC E;  1FJG E;  4LF8 E;  3F6H A;  3TQM A;  1WRJ A;  5A6A A;  2EPM X; 
#chains in the Genus database with same CATH homology
 3EPL A;  2WBS A;  2ENA A;  2EPU A;  2EN7 A;  2EP3 A;  1TF3 A;  2ADR A;  2EOZ A;  2D9H A;  4F2J C;  2EMB A;  2RSI A;  3EPK A;  2HGH A;  2EM5 A;  2EN1 A;  2EJ4 A;  1G2D C;  1WJP A;  1ZR9 A;  2LV2 A;  2YSP A;  1NCS A;  2EQ3 A;  2YTO A;  2EOO A;  2GHF A;  2M9A A;  4R2E A;  3EPJ A;  2EM2 A;  2EOF A;  1X6H A;  1BBO A;  2EOM A;  2A25 A;  2EM3 A;  2EOH A;  2EN4 A;  3MHS C;  2JP9 A;  2EOE A;  2MKD A;  2EQ1 A;  2EMG A;  2LVH A;  2YRM A;  1A1J A;  2LCE A;  2WBT A;  2EPX A;  4FK5 C;  2CSH A;  5KL5 A;  4R2C A;  2WCC 3;  5KL7 A;  1MEY C;  1KJK A;  2EE8 A;  2LT7 A;  2YTN A;  2EM7 A;  3VHT B;  2LO3 A;  2YRH A;  2EL6 A;  1ZU1 A;  2DRP A;  2GLI A;  2EOI A;  2YTD A;  1TN9 A;  2DLQ A;  2YSO A;  3M99 B;  2EM0 A;  1LLM C;  2EML A;  2MDG A;  4R2R A;  2EOX A;  1AAY A;  2DLK A;  2YU8 A;  4F6N A;  2DGC A;  2YRK A;  2CT1 A;  3MHH C;  1RMD A;  2EN8 A;  2YTE A;  1F2I G;  4R2Q A;  1X5W A;  2EM6 A;  2YU5 A;  2E72 A;  4IJD A;  5KL3 A;  5KL4 A;  1TF6 A;  4X9J A;  5KL6 A;  4R2A A;  1JK2 A;  1YUJ A;  1X6F A;  2JPA A;  1A1G A;  2ELZ A;  2EPA A;  2EQ0 A;  4WSG A;  2WBU A;  3EPH A;  2EOQ A;  2ELY A;  2EMI A;  2YTJ A;  1A1K A;  5KL2 A;  4R2P A;  2EMC A;  1JK1 A;  2VRD A;  2R1F A;  2EMK A;  2ENC A;  2ENH A;  4IS1 C;  2EMY A;  2EMX A;  2EL4 A;  2EMA A;  2EMW A;  2RPC A;  1P47 A;  1G2F C;  1YUI A;  2YTP A;  1YSA C;  4M9V C;  4R2D A;  1X6E A;  1A1F A;  2EM9 A;  2EN6 A;  1UBD C;  2EMF A;  2EN2 A;  2EPP A;  1B69 A;  2EMH A;  1A1I A;  2BB8 A;  1A1L A;  1X3C A;  2CTD A;  2EM8 A;  2YTF A;  4GZN C;  1A1H A;  2EOY A;  1DGC A;  2DMI A;  2EOS A;  4R2S A;  1UN6 B;  1BB8 A;  2YTG A;  2YTQ A;  2EPR A;  2EMZ A;  2EPC A;  2EOR A;  2YTI A;  2MKN A;  4F6M A;  2I13 A;  2EPZ A;  2EOJ A;  1ZAA C;  2NAB A;  2EL5 A;  3UK3 C;  1Z1B A;  2PRT A;  2EN3 A;  2EM4 A;  2J7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...