5KL5A

Wilms tumor protein (wt1) znf2-4 q369h in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Wilms tumor protein
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl5A00
2EMHA 2EOSA 2EPAA 2A25A 2EL6A 2EM9A 5KL7A 2EM5A 2WCC3 2YTOA 2EMFA 2EN4A 1RMDA 2RSIA 4M9VC 1F2IG 2YTFA 1TF6A 3UK3C 1X6HA 1YUIA 4R2AA 2GHFA 2DGCA 2YTJA 2EQ3A 4R2RA 4FK5C 3EPLA 2E72A 4IJDA 4R2EA 2EMKA 4R2QA 2YRMA 2YTPA 2EMGA 1JK1A 2BB8A 2YRHA 1A1HA 2EM4A 2EM3A 2YRKA 1P47A 1AAYA 2LCEA 2LVHA 2ELZA 2WBTA 4R2SA 2JPAA 1TN9A 1ZU1A 1A1JA 4GZNC 2DLQA 2EPCA 2DMIA 1B69A 1X6EA 4X9JA 2EOIA 2EN3A 1A1IA 2EMCA 2ENAA 1MEYC 1YUJA 2YTEA 2WBUA 2DLKA 1A1GA 2EMBA 5KL3A 2EM7A 2EN7A 2MDGA 4WSGA 2EQ0A 2EMWA 2EPZA 2EPXA 2EN6A 1G2DC 1ZAAC 2EMZA 3EPJA 4F6MA 2HGHA 2EPRA 4F2JC 1ZR9A 2CTDA 2EMYA 5KL4A 1LLMC 2YTDA 2LT7A 3EPKA 2EOJA 2MKNA 2ADRA 3MHSC 2ELYA 2EOFA 2EL4A 2JP9A 1A1FA 2GLIA 2YU5A 2EMAA 2EOHA 1BB8A 2NABA 2R1FA 1A1LA 2J7JA 2EM0A 2EMXA 1Z1BA 2EN1A 1G2FC 1DGCA 2LO3A 1A1KA 2EE8A 2EOMA 2EM2A 2D9HA 1WJPA 4R2DA 2EL5A 2RPCA 2EOYA 1X3CA 2EM6A 2EQ1A 2EOZA 3EPHA 2VRDA 4R2CA 2EOOA 1TF3A 2PRTA 1UN6B 2YTNA 2YTIA 4F6NA 2DRPA 2EM8A 2CSHA 5KL5A 2MKDA 2CT1A 4R2PA 2ENHA 2EMLA 2YSPA 4IS1C 2I13A 2EP3A 2ENCA 1JK2A 2EPPA 2EN8A 2YTQA 3VHTB 1X5WA 2YTGA 1YSAC 1BBOA 5KL2A 2EMIA 2YU8A 3MHHC 2EOXA 3M99B 2EOEA 2LV2A 1UBDC 1KJKA 2EPUA 1X6FA 2EJ4A 2EN2A 2EOQA 5KL6A 1NCSA 2M9AA 2YSOA 2EORA 2WBSA
chains in the Genus database with same CATH superfamily
2A25A 2JR1A 4DV7E 2DMYA 1PKPA 1T39A 1WHNA 1RMDA 2EN4A 4M9VC 3QG5C 1SFEA 1X6HA 4M30A 1EH6A 4R2AA 5A6AA 1IBME 1DQ3A 4FK5C 3EPLA 4WXDA 3HTXA 2E72A 3KZYA 4X8WA 4JI5E 4O24A 5A6JA 2YRHA 1XMOE 1A1HA 2F8BA 2YRKA 2KONA 2ELZA 2V87A 1TN9A 4Q35B 1DI2A 1A1JA 2RS7A 4OOGC 1IMUA 2DMIA 3VK6A 4O4KA 4OX9E 5IWAE 1MEYC 5IXMB 1PJTA 4L5NC 2EM7A 2EMWA 2VE7C 2MDRA 2EPZA 2JYAA 3JAMC 1HR0E 2NUGA 4B3ME 2EMZA 2EPRA 3J7AG 4JI8E 4BBYA 2RSMA 2LTRA 2LT7A 2EOFA 2DB2A 2CPNA 5LMNE 2EOHA 2NABA 2J7JA 2EM0A 2R76A 5AE3A 3BGHA 4LF9E 1A1KA 2EE8A 1SR9A 1J5EE 1WJPA 5A2QC 4R2DA 5AASA 2UUBE 1FJGE 2EOYA 4M2ZA 2ODRC 1X3CA 1XNQE 1ZBTA 1TF3A 2YTNA 2YTIA 2DRPA 4WYQB 2CSHA 3BIDA 2IHR1 4YY3E 4WX9A 3J80C 2EMLA 2YSPA 2I13A 1PJSA 2EP3A 2L2KB 4N4RB 4LF5E 4WFTA 4B3SE 2E1MA 5LL6R 2LJUA 4LF4E 1RQ0A 2EOXA 4NXME 2L3JA 3L00A 2I9IA 2L8TA 1UBDC 2LBSB 2EN2A 2EPUA 2EJ4A 2EPOA 3THNA 2JOBA 2EMHA 2EOSA 2L6MA 2EM9A 5KL7A 4BC9A 2RSIA 3JTZA 4BC7A 4KHPE 2M7QA 2YTFA 1GZ6A 5ADZA 2JY9A 1IBLE 2DGCA 1EH7A 3IWCA 1X47A 4LTYA 4P78A 4HEIA 2JOXA 3J7Yp 3ADIA 4JI0E 2EZ6A 2YTPA 4X64E 3VYXA 2EM4A 1FKAE 1AAYA 3ADLA 1O0WA 3T1HE 1ZU1A 2EWLA 4GZNC 2EPCA 1QU6A 1KYQA 4ZYHA 2UXDE 2EOIA 2UUAE 5AE2A 4X66E 1X49A 2YTEA 1X48A 4O5GA 1A1GA 5KL3A 3F6GA 3IWDA 4WSGA 5AE1A 2EPXA 4DR7E 2EN6A 1ZAAC 3EPJA 2VQEE 2CTDA 3ECRA 4BCAA 1LLMC 4JYAE 4YHHE 5TSEA 3FIGA 3EPKA 2ADRA 3MHSC 2V86A 2ELYA 5AC5A 4X65E 3KZZA 4ZYDA 5LLQA 2JP9A 4BMJA 1A1FA 4LF6E 2EMAA 4JV5E 2R1FA 5CFFE 2G7HA 3HPSA 4JI6E 4HTGA 1AH5A 3IWBA 2EM2A 2EPLX 2D9HA 3AV0A 2L33A 2UUCE 3MSWA 2N8XA 2EL5A 4BHCA 4ZYEA 1NEIA 2V8QB 2GPIA 2JVAA 2EOZA 4TUIA 3THOB 1YFHA 4F6NA 5KL5A 2MKDA 4R2PA 3EQ1A 2ENHA 1XMQE 4AQYE 4DMIA 3DJWA 2EN8A 2V83A 4I8OA 3VHTB 1T4NA 1YSAC 1BBOA 3C6MA 2LJHA 3DF6A 2RQLA 1IQSA 5IV8B 2WZOA 3M99B 2DSYA 3TQMA 1MGTA 5BR8E 2B7VA 2HJJA 1KJKA 3VYYA 5KL6A 2NA2A 2UXBE 2YSOA 2EORA 5A69A 2WBSA 4DR1E 2EL6A 2V85A 3F6HA 2EM5A 1L4SA 3RMPA 1F2IG 4BHBA 1YUIA 2GHFA 1EH8A 2YTJA 4R2RA 4DR4E 2MC6A 4IJDA 2V88A 2N3HA 3ZOQB 4R2QA 2YRMA 2BB8A 4DV5E 2EM3A 1P47A 2LCEA 2FGGA 2WBTA 3HXLA 4R2SA 5LMUE 4JI7E 2DLQA 2HHHE 2RTXA 4DV4E 4R03A 1GQEA 1B69A 2K4VA 1YUJA 1A1IA 2B9DA 2EMCA 2JXPA 2WBUA 2DLKA 4DR5E 2MC5A 2M4IA 4F54A 1G2DC 2LUQA 4JI3E 4F6MA 2HGHA 4F2JC 3ADJA 1ZR9A 3BF2A 2EMYA 4WXCA 2ZM6E 5T6JA 4DV3E 3T1YE 1BBGA 1PDAA 4NZVA 1YYOA 2GLIA 1N36E 4L8NA 1BB8A 2L2MA 4LFCE 2EMXA 3C6KA 1Z1BA 4DV2E 1DGCA 4R8OA 2EOMA 4WSPA 4O43A 2RPCA 2HC5A 4LF8E 2E5LE 2EQ1A 3HQ1A 4NHRA 2VRDA 4R2CA 3ADGA 2VQFE 2EOOA 5FLXC 4DV0E 2K7IA 1HNXE 4WPYA 2CT1A 1YZ9A 3H09A 4DUZE 4IS1C 2ENCA 4LF7E 2EPPA 5AC4A 5IT9C 2B3TB 4DV6E 2YTQA 1X5WA 4LFAE 4GEQB 5DNYA 3C4TA 2FV4B 2EPMX 2YU8A 1RC7A 3BBGA 2EOEA 2F4VE 3LMLA 3HPZA 1YPNA 2LUPB 5F3WA 2EOQA 1HNZE 1WRJA 3KWRA 2M9AA 4TUGA 2EPAA 1I94E 2YT4A 4MLQA 2YPNA 1XNRE 3AUZA 2WCC3 2YTOA 2EMFA 1IBKE 4BS9A 2L3CA 4DKKA 4Q28A 3UK3C 1TF6A 5A6KA 1J26A 2EQ3A 1N3GA 4B3RE 4LU9A 2RS6A 4R2EA 2EMKA 4K0KE 1GTKA 2EMGA 4RH8A 1ZBQA 4RHBB 1JK1A 4KWYA 4JI1E 4P7DA 2UXCE 3J81C 1UHZA 2YWQA 2LVHA 4NXNE 2JPAA 2YZTA 1N32E 1PJQA 2JWOA 1IQOA 4DR6E 1X6EA 4X9JA 2EN3A 2LE2A 2ENAA 2EMBA 1YYKA 1EKZA 2EN7A 2N3GA 2MDGA 2EQ0A 5A6BA 4GKJE 4MLVA 1UILA 2VF1A 2M1SA 4JI2E 5KL4A 2FTXB 2YTDA 3C4BA 2B7TA 2EOJA 2MKNA 2BBGA 4B3TE 2EL4A 4DR2E 3K6QA 4ZYGA 2H36X 4KZSA 2YU5A 2UU9E 2Q8UA 2NUFA 1A1LA 1T4LB 4GKKE 1N34E 2EN1A 4LFBE 1N33E 1G2FC 2LTSA 2LO3A 1T38A 1WXRA 2EM6A 1STUA 4DV1E 3EPHA 3OTOE 4JI4E 4F9AB 2EPKX 2PRTA 1UN6B 2LRSA 2L2NA 2EM8A 3OMLA 2DIXA 4F9CB 3JU0A 2LMZA 4J8ZA 5A6BD 1JK2A 4X62E 2KOUA 1T4OA 4M0VA 1YYWA 2YTGA 2NUEA 5KL2A 2EPNA 2ODRD 1WHQA 2EMIA 3LLHA 3MHHC 3P1XA 4DR3E 4DUYE 2V89A 2LV2A 1QNTA 1X6FA 2L92A 2KHXA 4F9BB 1HNWE 1NCSA
chains in the Genus database with same CATH topology
2EMHA 2EOSA 2EPAA 2A25A 2EL6A 2EM9A 5KL7A 2EM5A 2WCC3 2YTOA 2EMFA 2EN4A 1RMDA 2RSIA 4M9VC 1F2IG 2YTFA 1TF6A 3UK3C 1X6HA 1YUIA 4R2AA 2GHFA 2DGCA 2YTJA 2EQ3A 4R2RA 4FK5C 3EPLA 2E72A 4IJDA 4R2EA 2EMKA 4R2QA 2YRMA 2YTPA 2EMGA 1JK1A 2BB8A 2YRHA 1A1HA 2EM4A 2EM3A 2YRKA 1P47A 1AAYA 2LCEA 2LVHA 2ELZA 2WBTA 4R2SA 2JPAA 1TN9A 1ZU1A 1A1JA 4GZNC 2DLQA 2EPCA 2DMIA 1B69A 1X6EA 4X9JA 2EOIA 2EN3A 1A1IA 2EMCA 2ENAA 1MEYC 1YUJA 2YTEA 2WBUA 2DLKA 1A1GA 2EMBA 5KL3A 2EM7A 2EN7A 2MDGA 4WSGA 2EQ0A 2EMWA 2EPZA 2EPXA 2EN6A 1G2DC 1ZAAC 2EMZA 3EPJA 4F6MA 2HGHA 2EPRA 4F2JC 1ZR9A 2CTDA 2EMYA 5KL4A 1LLMC 2YTDA 2LT7A 3EPKA 2EOJA 2MKNA 2ADRA 3MHSC 2ELYA 2EOFA 2EL4A 2JP9A 1A1FA 2GLIA 2YU5A 2EMAA 2EOHA 1BB8A 2NABA 2R1FA 1A1LA 2J7JA 2EM0A 2EMXA 1Z1BA 2EN1A 1G2FC 1DGCA 2LO3A 1A1KA 2EE8A 2EOMA 2EM2A 2D9HA 1WJPA 4R2DA 2EL5A 2RPCA 2EOYA 1X3CA 2EM6A 2EQ1A 2EOZA 3EPHA 2VRDA 4R2CA 2EOOA 1TF3A 2PRTA 1UN6B 2YTNA 2YTIA 4F6NA 2DRPA 2EM8A 2CSHA 5KL5A 2MKDA 2CT1A 4R2PA 2ENHA 2EMLA 2YSPA 4IS1C 2I13A 2EP3A 2ENCA 1JK2A 2EPPA 2EN8A 2YTQA 3VHTB 1X5WA 2YTGA 1YSAC 1BBOA 5KL2A 2EMIA 2YU8A 3MHHC 2EOXA 3M99B 2EOEA 2LV2A 1UBDC 1KJKA 2EPUA 1X6FA 2EJ4A 2EN2A 2EOQA 5KL6A 1NCSA 2M9AA 2YSOA 2EORA 2WBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMH A;  2EOS A;  2EPA A;  2A25 A;  2EL6 A;  2EM9 A;  5KL7 A;  2EM5 A;  2WCC 3;  2YTO A;  2EMF A;  2EN4 A;  1RMD A;  2RSI A;  4M9V C;  1F2I G;  2YTF A;  1TF6 A;  3UK3 C;  1X6H A;  1YUI A;  4R2A A;  2GHF A;  2DGC A;  2YTJ A;  2EQ3 A;  4R2R A;  4FK5 C;  3EPL A;  2E72 A;  4IJD A;  4R2E A;  2EMK A;  4R2Q A;  2YRM A;  2YTP A;  2EMG A;  1JK1 A;  2BB8 A;  2YRH A;  1A1H A;  2EM4 A;  2EM3 A;  2YRK A;  1P47 A;  1AAY A;  2LCE A;  2LVH A;  2ELZ A;  2WBT A;  4R2S A;  2JPA A;  1TN9 A;  1ZU1 A;  1A1J A;  4GZN C;  2DLQ A;  2EPC A;  2DMI A;  1B69 A;  1X6E A;  4X9J A;  2EOI A;  2EN3 A;  1A1I A;  2EMC A;  2ENA A;  1MEY C;  1YUJ A;  2YTE A;  2WBU A;  2DLK A;  1A1G A;  2EMB A;  5KL3 A;  2EM7 A;  2EN7 A;  2MDG A;  4WSG A;  2EQ0 A;  2EMW A;  2EPZ A;  2EPX A;  2EN6 A;  1G2D C;  1ZAA C;  2EMZ A;  3EPJ A;  4F6M A;  2HGH A;  2EPR A;  4F2J C;  1ZR9 A;  2CTD A;  2EMY A;  5KL4 A;  1LLM C;  2YTD A;  2LT7 A;  3EPK A;  2EOJ A;  2MKN A;  2ADR A;  3MHS C;  2ELY A;  2EOF A;  2EL4 A;  2JP9 A;  1A1F A;  2GLI A;  2YU5 A;  2EMA A;  2EOH A;  1BB8 A;  2NAB A;  2R1F A;  1A1L A;  2J7J A;  2EM0 A;  2EMX A;  1Z1B A;  2EN1 A;  1G2F C;  1DGC A;  2LO3 A;  1A1K A;  2EE8 A;  2EOM A;  2EM2 A;  2D9H A;  1WJP A;  4R2D A;  2EL5 A;  2RPC A;  2EOY A;  1X3C A;  2EM6 A;  2EQ1 A;  2EOZ A;  3EPH A;  2VRD A;  4R2C A;  2EOO A;  1TF3 A;  2PRT A;  1UN6 B;  2YTN A;  2YTI A;  4F6N A;  2DRP A;  2EM8 A;  2CSH A;  5KL5 A;  2MKD A;  2CT1 A;  4R2P A;  2ENH A;  2EML A;  2YSP A;  4IS1 C;  2I13 A;  2EP3 A;  2ENC A;  1JK2 A;  2EPP A;  2EN8 A;  2YTQ A;  3VHT B;  1X5W A;  2YTG A;  1YSA C;  1BBO A;  5KL2 A;  2EMI A;  2YU8 A;  3MHH C;  2EOX A;  3M99 B;  2EOE A;  2LV2 A;  1UBD C;  1KJK A;  2EPU A;  1X6F A;  2EJ4 A;  2EN2 A;  2EOQ A;  5KL6 A;  1NCS A;  2M9A A;  2YSO A;  2EOR A;  2WBS A; 
#chains in the Genus database with same CATH topology
 2A25 A;  2JR1 A;  4DV7 E;  2DMY A;  1PKP A;  1T39 A;  1WHN A;  1RMD A;  2EN4 A;  4M9V C;  3QG5 C;  1SFE A;  1X6H A;  4M30 A;  1EH6 A;  4R2A A;  5A6A A;  1IBM E;  1DQ3 A;  4FK5 C;  3EPL A;  4WXD A;  3HTX A;  2E72 A;  3KZY A;  4X8W A;  4JI5 E;  4O24 A;  5A6J A;  2YRH A;  1XMO E;  1A1H A;  2F8B A;  2YRK A;  2KON A;  2ELZ A;  2V87 A;  1TN9 A;  4Q35 B;  1DI2 A;  1A1J A;  2RS7 A;  4OOG C;  1IMU A;  2DMI A;  3VK6 A;  4O4K A;  4OX9 E;  5IWA E;  1MEY C;  5IXM B;  1PJT A;  4L5N C;  2EM7 A;  2EMW A;  2VE7 C;  2MDR A;  2EPZ A;  2JYA A;  3JAM C;  1HR0 E;  2NUG A;  4B3M E;  2EMZ A;  2EPR A;  3J7A G;  4JI8 E;  4BBY A;  2RSM A;  2LTR A;  2LT7 A;  2EOF A;  2DB2 A;  2CPN A;  5LMN E;  2EOH A;  2NAB A;  2J7J A;  2EM0 A;  2R76 A;  5AE3 A;  3BGH A;  4LF9 E;  1A1K A;  2EE8 A;  1SR9 A;  1J5E E;  1WJP A;  5A2Q C;  4R2D A;  5AAS A;  2UUB E;  1FJG E;  2EOY A;  4M2Z A;  2ODR C;  1X3C A;  1XNQ E;  1ZBT A;  1TF3 A;  2YTN A;  2YTI A;  2DRP A;  4WYQ B;  2CSH A;  3BID A;  2IHR 1;  4YY3 E;  4WX9 A;  3J80 C;  2EML A;  2YSP A;  2I13 A;  1PJS A;  2EP3 A;  2L2K B;  4N4R B;  4LF5 E;  4WFT A;  4B3S E;  2E1M A;  5LL6 R;  2LJU A;  4LF4 E;  1RQ0 A;  2EOX A;  4NXM E;  2L3J A;  3L00 A;  2I9I A;  2L8T A;  1UBD C;  2LBS B;  2EN2 A;  2EPU A;  2EJ4 A;  2EPO A;  3THN A;  2JOB A;  2EMH A;  2EOS A;  2L6M A;  2EM9 A;  5KL7 A;  4BC9 A;  2RSI A;  3JTZ A;  4BC7 A;  4KHP E;  2M7Q A;  2YTF A;  1GZ6 A;  5ADZ A;  2JY9 A;  1IBL E;  2DGC A;  1EH7 A;  3IWC A;  1X47 A;  4LTY A;  4P78 A;  4HEI A;  2JOX A;  3J7Y p;  3ADI A;  4JI0 E;  2EZ6 A;  2YTP A;  4X64 E;  3VYX A;  2EM4 A;  1FKA E;  1AAY A;  3ADL A;  1O0W A;  3T1H E;  1ZU1 A;  2EWL A;  4GZN C;  2EPC A;  1QU6 A;  1KYQ A;  4ZYH A;  2UXD E;  2EOI A;  2UUA E;  5AE2 A;  4X66 E;  1X49 A;  2YTE A;  1X48 A;  4O5G A;  1A1G A;  5KL3 A;  3F6G A;  3IWD A;  4WSG A;  5AE1 A;  2EPX A;  4DR7 E;  2EN6 A;  1ZAA C;  3EPJ A;  2VQE E;  2CTD A;  3ECR A;  4BCA A;  1LLM C;  4JYA E;  4YHH E;  5TSE A;  3FIG A;  3EPK A;  2ADR A;  3MHS C;  2V86 A;  2ELY A;  5AC5 A;  4X65 E;  3KZZ A;  4ZYD A;  5LLQ A;  2JP9 A;  4BMJ A;  1A1F A;  4LF6 E;  2EMA A;  4JV5 E;  2R1F A;  5CFF E;  2G7H A;  3HPS A;  4JI6 E;  4HTG A;  1AH5 A;  3IWB A;  2EM2 A;  2EPL X;  2D9H A;  3AV0 A;  2L33 A;  2UUC E;  3MSW A;  2N8X A;  2EL5 A;  4BHC A;  4ZYE A;  1NEI A;  2V8Q B;  2GPI A;  2JVA A;  2EOZ A;  4TUI A;  3THO B;  1YFH A;  4F6N A;  5KL5 A;  2MKD A;  4R2P A;  3EQ1 A;  2ENH A;  1XMQ E;  4AQY E;  4DMI A;  3DJW A;  2EN8 A;  2V83 A;  4I8O A;  3VHT B;  1T4N A;  1YSA C;  1BBO A;  3C6M A;  2LJH A;  3DF6 A;  2RQL A;  1IQS A;  5IV8 B;  2WZO A;  3M99 B;  2DSY A;  3TQM A;  1MGT A;  5BR8 E;  2B7V A;  2HJJ A;  1KJK A;  3VYY A;  5KL6 A;  2NA2 A;  2UXB E;  2YSO A;  2EOR A;  5A69 A;  2WBS A;  4DR1 E;  2EL6 A;  2V85 A;  3F6H A;  2EM5 A;  1L4S A;  3RMP A;  1F2I G;  4BHB A;  1YUI A;  2GHF A;  1EH8 A;  2YTJ A;  4R2R A;  4DR4 E;  2MC6 A;  4IJD A;  2V88 A;  2N3H A;  3ZOQ B;  4R2Q A;  2YRM A;  2BB8 A;  4DV5 E;  2EM3 A;  1P47 A;  2LCE A;  2FGG A;  2WBT A;  3HXL A;  4R2S A;  5LMU E;  4JI7 E;  2DLQ A;  2HHH E;  2RTX A;  4DV4 E;  4R03 A;  1GQE A;  1B69 A;  2K4V A;  1YUJ A;  1A1I A;  2B9D A;  2EMC A;  2JXP A;  2WBU A;  2DLK A;  4DR5 E;  2MC5 A;  2M4I A;  4F54 A;  1G2D C;  2LUQ A;  4JI3 E;  4F6M A;  2HGH A;  4F2J C;  3ADJ A;  1ZR9 A;  3BF2 A;  2EMY A;  4WXC A;  2ZM6 E;  5T6J A;  4DV3 E;  3T1Y E;  1BBG A;  1PDA A;  4NZV A;  1YYO A;  2GLI A;  1N36 E;  4L8N A;  1BB8 A;  2L2M A;  4LFC E;  2EMX A;  3C6K A;  1Z1B A;  4DV2 E;  1DGC A;  4R8O A;  2EOM A;  4WSP A;  4O43 A;  2RPC A;  2HC5 A;  4LF8 E;  2E5L E;  2EQ1 A;  3HQ1 A;  4NHR A;  2VRD A;  4R2C A;  3ADG A;  2VQF E;  2EOO A;  5FLX C;  4DV0 E;  2K7I A;  1HNX E;  4WPY A;  2CT1 A;  1YZ9 A;  3H09 A;  4DUZ E;  4IS1 C;  2ENC A;  4LF7 E;  2EPP A;  5AC4 A;  5IT9 C;  2B3T B;  4DV6 E;  2YTQ A;  1X5W A;  4LFA E;  4GEQ B;  5DNY A;  3C4T A;  2FV4 B;  2EPM X;  2YU8 A;  1RC7 A;  3BBG A;  2EOE A;  2F4V E;  3LML A;  3HPZ A;  1YPN A;  2LUP B;  5F3W A;  2EOQ A;  1HNZ E;  1WRJ A;  3KWR A;  2M9A A;  4TUG A;  2EPA A;  1I94 E;  2YT4 A;  4MLQ A;  2YPN A;  1XNR E;  3AUZ A;  2WCC 3;  2YTO A;  2EMF A;  1IBK E;  4BS9 A;  2L3C A;  4DKK A;  4Q28 A;  3UK3 C;  1TF6 A;  5A6K A;  1J26 A;  2EQ3 A;  1N3G A;  4B3R E;  4LU9 A;  2RS6 A;  4R2E A;  2EMK A;  4K0K E;  1GTK A;  2EMG A;  4RH8 A;  1ZBQ A;  4RHB B;  1JK1 A;  4KWY A;  4JI1 E;  4P7D A;  2UXC E;  3J81 C;  1UHZ A;  2YWQ A;  2LVH A;  4NXN E;  2JPA A;  2YZT A;  1N32 E;  1PJQ A;  2JWO A;  1IQO A;  4DR6 E;  1X6E A;  4X9J A;  2EN3 A;  2LE2 A;  2ENA A;  2EMB A;  1YYK A;  1EKZ A;  2EN7 A;  2N3G A;  2MDG A;  2EQ0 A;  5A6B A;  4GKJ E;  4MLV A;  1UIL A;  2VF1 A;  2M1S A;  4JI2 E;  5KL4 A;  2FTX B;  2YTD A;  3C4B A;  2B7T A;  2EOJ A;  2MKN A;  2BBG A;  4B3T E;  2EL4 A;  4DR2 E;  3K6Q A;  4ZYG A;  2H36 X;  4KZS A;  2YU5 A;  2UU9 E;  2Q8U A;  2NUF A;  1A1L A;  1T4L B;  4GKK E;  1N34 E;  2EN1 A;  4LFB E;  1N33 E;  1G2F C;  2LTS A;  2LO3 A;  1T38 A;  1WXR A;  2EM6 A;  1STU A;  4DV1 E;  3EPH A;  3OTO E;  4JI4 E;  4F9A B;  2EPK X;  2PRT A;  1UN6 B;  2LRS A;  2L2N A;  2EM8 A;  3OML A;  2DIX A;  4F9C B;  3JU0 A;  2LMZ A;  4J8Z A;  5A6B D;  1JK2 A;  4X62 E;  2KOU A;  1T4O A;  4M0V A;  1YYW A;  2YTG A;  2NUE A;  5KL2 A;  2EPN A;  2ODR D;  1WHQ A;  2EMI A;  3LLH A;  3MHH C;  3P1X A;  4DR3 E;  4DUY E;  2V89 A;  2LV2 A;  1QNT A;  1X6F A;  2L92 A;  2KHX A;  4F9B B;  1HNW E;  1NCS A; 
#chains in the Genus database with same CATH homology
 2EMH A;  2EOS A;  2EPA A;  2A25 A;  2EL6 A;  2EM9 A;  5KL7 A;  2EM5 A;  2WCC 3;  2YTO A;  2EMF A;  2EN4 A;  1RMD A;  2RSI A;  4M9V C;  1F2I G;  2YTF A;  1TF6 A;  3UK3 C;  1X6H A;  1YUI A;  4R2A A;  2GHF A;  2DGC A;  2YTJ A;  2EQ3 A;  4R2R A;  4FK5 C;  3EPL A;  2E72 A;  4IJD A;  4R2E A;  2EMK A;  4R2Q A;  2YRM A;  2YTP A;  2EMG A;  1JK1 A;  2BB8 A;  2YRH A;  1A1H A;  2EM4 A;  2EM3 A;  2YRK A;  1P47 A;  1AAY A;  2LCE A;  2LVH A;  2ELZ A;  2WBT A;  4R2S A;  2JPA A;  1TN9 A;  1ZU1 A;  1A1J A;  4GZN C;  2DLQ A;  2EPC A;  2DMI A;  1B69 A;  1X6E A;  4X9J A;  2EOI A;  2EN3 A;  1A1I A;  2EMC A;  2ENA A;  1MEY C;  1YUJ A;  2YTE A;  2WBU A;  2DLK A;  1A1G A;  2EMB A;  5KL3 A;  2EM7 A;  2EN7 A;  2MDG A;  4WSG A;  2EQ0 A;  2EMW A;  2EPZ A;  2EPX A;  2EN6 A;  1G2D C;  1ZAA C;  2EMZ A;  3EPJ A;  4F6M A;  2HGH A;  2EPR A;  4F2J C;  1ZR9 A;  2CTD A;  2EMY A;  5KL4 A;  1LLM C;  2YTD A;  2LT7 A;  3EPK A;  2EOJ A;  2MKN A;  2ADR A;  3MHS C;  2ELY A;  2EOF A;  2EL4 A;  2JP9 A;  1A1F A;  2GLI A;  2YU5 A;  2EMA A;  2EOH A;  1BB8 A;  2NAB A;  2R1F A;  1A1L A;  2J7J A;  2EM0 A;  2EMX A;  1Z1B A;  2EN1 A;  1G2F C;  1DGC A;  2LO3 A;  1A1K A;  2EE8 A;  2EOM A;  2EM2 A;  2D9H A;  1WJP A;  4R2D A;  2EL5 A;  2RPC A;  2EOY A;  1X3C A;  2EM6 A;  2EQ1 A;  2EOZ A;  3EPH A;  2VRD A;  4R2C A;  2EOO A;  1TF3 A;  2PRT A;  1UN6 B;  2YTN A;  2YTI A;  4F6N A;  2DRP A;  2EM8 A;  2CSH A;  5KL5 A;  2MKD A;  2CT1 A;  4R2P A;  2ENH A;  2EML A;  2YSP A;  4IS1 C;  2I13 A;  2EP3 A;  2ENC A;  1JK2 A;  2EPP A;  2EN8 A;  2YTQ A;  3VHT B;  1X5W A;  2YTG A;  1YSA C;  1BBO A;  5KL2 A;  2EMI A;  2YU8 A;  3MHH C;  2EOX A;  3M99 B;  2EOE A;  2LV2 A;  1UBD C;  1KJK A;  2EPU A;  1X6F A;  2EJ4 A;  2EN2 A;  2EOQ A;  5KL6 A;  1NCS A;  2M9A A;  2YSO A;  2EOR A;  2WBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...