4ZYGA

Crystal structure of methylated sulfolobus solfataricus o6-methylguanine methyltransferase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
150
Chain Sequence
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 44
structure length 150
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zygA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zygA01
1GXPA 4EJUA 4HQEA 1LB2A 3HIFA 3ABTA 3QP6A 1WQ2A 2OBPA 1U5TC 2R7FA 2HDCA 5FLXK 1XDUA 4YIFA 5IT9K 1FLIA 4M6YA 3K69A 1PP7U 4G7OF 1XCBA 2QYOA 4LB5A 1FX7A 3I71A 3MZHA 4NB5A 4MHGA 2ESHA 2F2EA 2D2WA 3E5XA 1FC3A 3RTRA 3WGIA 1P2FA 2MD5A 2ZNZA 1F4KA 1XGSA 2VC0A 4LG0B 2EV0A 3DFGA 2XHKA 2PN6A 3LAPA 4RGRA 1PUEE 1XMKA 4ENKA 3MEXA 3JSOA 3VODA 3HTUA 1A04A 2XASA 1EH7A 1IXSB 5FD6A 2O3FA 4CGZA 1MGTA 2HTSA 3ISPA 3T8RA 1QQIA 2D1VA 1K79A 1KU2A 3IWFA 1JGSA 5DUKA 1FWZA 4UVCA 4EGYA 4HX8A 3V7CA 3CUQA 4BAYA 2P7VB 4WXCA 2DK5A 4HAMA 4LLLA 3FWEA 5FLXZ 5IT9Z 1HKQA 3RKYA 2IJLA 2VT3A 4FT8A 2MH2A 3L2CA 2JTVA 1LQ1A 3HSEA 1E2XA 5J6XA 2WTEA 3Q9SA 2Y75A 3LFKA 4IRGA 5DDGA 4XLPF 2J5PA 3RIRA 1O7LA 2K4BA 1F1ZA 3HRUA 3CTAA 1DUXC 3QP5A 2RGVA 1P4XA 1QBJA 1OYYA 5LHIA 1FZPB 4L18B 4I0AA 5E1WA 2M30A 3E97A 4OIOF 2HOEA 3L7WA 2GAUA 2GQQA 2TDXA 4H0EA 2CQKA 2IRFG 4MQVA 2XKPA 4HX4A 4KIGA 1I1GA 2KJCA 4HDUA 2V1DA 1W4MA 4LK1F 2LSOA 3RYPA 4XLNF 3E6DA 3DQVC 2YSRA 3GFJA 4KFCA 1SD6A 2FBHA 2K27A 4LB6B 3ZMVA 3C18A 4HF0A 3ZMUA 1IXRC 1UHWA 4A0YA 5K1YA 2P7CB 3SHFA 3KEQA 1P6RA 5DV5A 3E6BA 3BOQA 3L9FA 2NNNA 2MH9A 2O61A 3D0SA 1MDMB 1YW7A 1J9IA 4A6EA 2JPBA 3W6JB 2E1NA 2W57A 4A5NA 5JVTA 3FM3A 3WTYC 2XROA 3F72A 2PLYA 3F22A 1YO5C 2EJRA 4I02A 1W5SA 1FP2A 2Z9OA 2H09A 3ECHA 4GGGA 2ACJA 1ZG1A 1XSXA 4FX0A 3M8FA 3GWZA 3E3VA 2QVOA 1R36A 2ELHA 2W85A 1E17A 1ZAOA 5AIPA 1J75A 3ZMDA 3FMSA 3RPUA 4U7BA 1YIOA 3P9IA 4U88A 3IKTA 4AIJA 1S3JA 4I09A 4L9NA 4YFKF 2L4MA 4KNYA 3CUQC 1OR7A 4CYDA 2UXNA 1I6XA 5K5RA 3EQLF 2M87A 4WWCA 4ZYGA 3VEPA 3GF2A 3BY6A 5LHGA 5CVUA 2W25A 2WWYA 5FFXA 3K0LA 1TNSA 3SFZA 1RUOA 1BIAA 3IC7A 5HDNA 4OMYA 1QZZA 3E6MA 2GZWA 3DF8A 4DQ2A 3ECOA 1BJAA 3KP5A 1ULYA 4PGGA 3GZ6A 4CHUA 3HSFA 2RNJA 2W24A 3I53A 2V79A 1QO0D 4WCGA 2V6CA 1F5TA 1J2XA 1LJ9A 3EUHA 4HLYA 5ILUA 2KKOA 4M72A 5HVQC 1U5TA 1SFXA 3WGGA 2QBYB 3WTVC 2O6GE 3WTTC 2VE9A 1W7PA 1K6OA 1ODDA 4P9UA 5BOXA 4ENMA 5E8IA 2YU3A 4RB1A 5HS9A 2XKOA 3GFIA 2DO7A 2F5FA 1K78B 4P55A 3JAMK 4XSXF 1QPMA 4EVIA 1FT9A 3M8EA 3DEUA 1O3QA 1YTYA 1ZGAA 1USTA 4L9VA 5DD8A 3O3KA 1ZH5A 5F6FA 4G7ZF 2V1XA 2ZBKA 5H6RA 2YX4A 5ICFA 3WGHA 3K1NA 2BV6A 3B73A 4LLGF 1IF1A 4A6DA 3BP8A 1B9MA 1C0WA 4ON0A 2LKPA 3E5UA 4KDPA 1T0FA 1F9NA 1Z05A 3DP7A 1Z9CA 5D5VB 5FB2A 2X0LA 1R22A 2QQBA 2OQRA 4IHTA 1AWCA 2ETHA 2IP2A 3ZN0A 2D1HA 2ISZA 2VONA 3PQKA 4HQMA 1MKMA 4I7HA 1XSDA 4HYEA 1ZREA 2EA2A 2HKXA 3N97A 2XUBA 4YIIA 1R5HA 4CXFA 3M7GA 1ONVA 3MCZA 2LNBA 3V8JA 1JHHA 2P6SA 3KP3A 3O6BB 2Q8KA 4KMFA 2HYGD 4PDKA 4O5VA 1ZRCA 4RAYA 2FU4A 1KA8A 3CDHA 3BWGA 2G7UA 2FQ3A 2DAOA 1FBUA 1T2KA 1UCRA 3SQNA 1WI9A 2NYXA 1HW2A 4UNOA 2PMUA 4GXOA 2L3DA 4BXUA 1KYZA 4CO8A 1P4AA 1R1TA 2F5CA 4LFUA 5L3EA 2WC2A 3OOPA 2ZJ2A 3R6SA 1V3FA 3V7SA 2CSOA 3RJPA 3F8CA 2A3SA 1YFHA 1B6AA 1DPRA 3ZQ7A 2BBYA 1EH8A 4OOIA 2QQAA 4N9IA 3I59A 1G3YA 3KLOA 1XDSA 2XAGA 4IXAA 4L0ZB 2DPUA 3TGNA 4M6XA 2HQNA 4ESJA 1AOYA 3FMQA 5CLSA 3EDPA 2DFIA 2LF8A 3ERED 1R58A 2NAZA 5DEQA 1IN7A 3IWZA 2ZMEB 2IPQX 3IL2A 4UVBA 2HTJA 2XVCA 4MEYF 4M9SA 5AONA 4B09A 2P5LC 4I01A 2R7DA 1LEBA 5HDKA 5LGTA 3QU6A 3TO7A 2VE8A 1LDKB 4L9TA 1Q1HA 2D45A 1J59A 5KK1A 2OU2A 4U0YA 3EYYA 3FXUA 4CDGA 4WXHA 4G6QA 2LDUA 5AIQA 1U6GA 2CWEA 2PG4A 1R5GA 4RB2C 1FYMA 2DU9A 1CF7A 3IRRA 2FOKA 4RB3C 3VFZA 3GEZA 4M9XA 1ZRFA 5E8GA 1MJBA 5ICEA 1GXQA 4HA8A 2XGXA 3J80K 4RGUA 5CVIA 3BDDA 1XMAA 4E70A 5CVVA 3W6KB 1B4AA 2UXXA 1R1VA 5L3BA 5HLHA 4O3MA 5LEKA 2NS0A 3MQ0A 4KICA 5JFRA 4OINF 4LGWA 3I54A 5D5WB 5TRDA 4BQAA 1Z91A 3CUOA 3T5XA 1IN5A 3VOEA 4P5OA 3F21A 1BIBA 3F8MA 4KN4X 3KP6A 4KMUX 2FE3A 3WE2A 3BPVA 1XD7A 2DQRA 3FM5A 4K2EA 4OIRF 4OMZA 2RC4A 4A0ZA 3L00A 3KP7A 4LLNA 3V4GA 2IA0A 2KIMA 2KIUA 4ZZDA 3M9AA 2PBIA 2HQRA 2RKHA 3GUDA 3T8TA 1U78A 1KU7A 2XAHA 5D6FA 1FPQA 3J80Z 4Q5SF 1G3TA 3RPQA 1BI1A 1LNWA 2Z3YA 2YX7A 2EA4A 5FFZA 2CG4A 2ESNA 3JW4A 3KP4A 3OV8A 2JT1A 4MEXF 1UHMA 1B9NA 1BI2A 1R23A 3FZVA 3GFLA 1TBXA 4XRFA 4RS8A 3R0JA 3H3UA 2PFBA 1SMTA 1FSHA 3K1PA 1XSVA 4U0WA 5E1XA 1IAWA 3F8FA 3EETA 2V1UA 4HF1A 4UHTA 2DPDA 1TNTA 3QOPA 3HHHA 3K9TA 3T1BA 3J7AO 2QUFA 2ZKZA 1U8RA 1SMYF 3ZPLA 3NQOA 3JTGA 2HR3A 4G94A 1S29A 3HHGA 5ED4A 3ZMSA 1REPC 1IN4A 1ON2A 5HLGA 5JI6A 1R7JA 3KEOA 5EEGA 3SZTA 1ON1A 5EEHA 1LVAA 2VBYA 1MZBA 2EFOA 4I0BA 2EFNA 1TQIA 1OYWA 4IRIA 1ZLJA 2K7LA 3DPLC 5FGMA 2J5OA 1CGPA 3ML6A 1XGMA 5LHHA 2CYYA 3G3ZA 3RDIA 3GYHX 4MNUA 1SD7A 4JQFA 4ZYDA 1P92A 1U5TB 1KYWA 2QENA 1HSTA 3GVAA 1W7PB 1G4DA 5LRSA 2QWWA 2H94A 2BGCA 5L3DA 2P5KA 3KETA 4BHBA 3I58A 2M5WA 2VBZA 2MBFA 2A6HF 4M71A 4JBAA 3KFWX 1JXSA 2FNAA 4KYWA 1ZYRF 3LWFA 4OU0A 4HOBA 5H6QA 2UZKA 1HKSA 2KIFA 2FNPA 3I64A 1G3WA 3WTSC 5ILSA 4EV0A 3V7RA 2EWNA 3REOA 2H6CA 3IKVA 3E5QA 2Q2EA 5HOOA 1YYVA 4ENJA 3V8LA 2ZO4A 1KU3A 1Z7UA 3RI4A 4ZH4F 2KRFA 4HV6A 3ZMZA 5D8LB 2GA2A 3QU3A 2B0LA 1R00A 2MLGA 4Q4ZF 1O3TA 2DTRA 1KU9A 4WX9A 2O8XA 3JSPA 1JHFA 1T39A 1Y0UA 3WTUC 1QGPA 4U0VA 5D5XB 5ILVA 5ERIA 3U1DA 1MD0A 4RGXA 3V8KA 2FRHA 4RB0A 2E7XA 5H20A 3R0AA 1YW8A 4EM0B 1FY7A 1YS6A 2EFWA 4BHCA 4M73A 3F6OA 2PJPA 2L4AA 3G73A 3H92A 1Z6RA 5IT3A 2E1CA 3R60A 3CO6C 2EV6A 4ZYHA 4EJVA 3TKYA 1K7AA 2OZ6A 1USSA 2XAFA 3RYRA 1ZRDA 1FYKA 1BI3A 3H3ZA 1HW5A 3I59B 2Q0OA 2JSCA 3TOAA 4XSZF 3GLXA 2F5DA 3PFIA 4UXNA 1X3UA 3I4PA 2AS5F 1IN8A 1QZYA 1OMIA 4A5MA 5D4SA 4TV7A 1O57A 2RQPA 4RAZA 5D8KB 4AD9A 3HSRA 2P4WA 4EJOA 3FHZA 2ZCWA 3SXYA 1WWXA 2FEZA 3LAJA 3WTWC 4BYYA 3HTSB 4B8XA 2PMHA 4HLXA 5HLIA 1WKMA 2IA1A 3M1EA 3WU0A 1YS7A 2IT0A 2G9WA 6PAXA 2A5YB 4HW0A 4OIPF 2RN7A 3TO6A 4S04A 3WU1B 1FBQA 2VN2A 5DCMA 4UV8A 3KLNA 4AWXB 4XBFA 5K5QA 4ZYEA 4R79A 4U7DA 4L9JA 1B59A 2ZNYA 3R61A 1CF7B 1H9GA 5HS7A 2HGCA 5E17F 2G7HA 2M1BA 2UWMA 3GX4X 3VB2A 1LDJA 4PZJA 2DLLA 5CVRA 4EM2A 2JPCA 1PP8F 3BJ6A 1RIOH 4N9HA 2VBWA 3LA7A 5BS6A 1U2WA 3QPHA 1YLFA 5L3CA 2C6YA 1KQ8A 2CW0F 4G9YA 3NRVA 4KN7X 2OZUA 4BH9A 4EJTA 3MWMA 1HSJA 2JRTA 5CJ9A 4EMSA 1S6LA 4CZZA 3P9CA 3WTXC 3C3WA 3S2WA 1YG2A 4G7HF 4GO1A 2L02A 5L3FA 2FBKA 3BROA 3KP2A 2ZMEA 3CUQB 3LQQA 5E20A 2EK5A 4HV5A 2YR2A 2FSWA 3RKWA 1J0RA 1YW9A 2W84A 2O0YA 2DBBA 4KIFA 4KT5C 1D8KA 2STWA 1R1UA 2M45A 1T6SA 4L5IA 2M8EA 2DQLA 3HRMA 2DI3A 2IW5A 5JHUA 4AIKA 3O2PE 1TW2A 2AXLA 1D5VA 4GYGA 2NNYA 4CICA 4WXDA 1YQAA 1HXDA 1FNNA 3DPTA 2BE5F 3RKXA 1ZG3A 3C1DA 1HKTA 4AVPA 2V9VA 4KA4A 3MFKA 2GWRA 4LD5A 3GZ5A 1FP1D 3BJAA 4EGZA 4AIHA 1Z6TA 3TO9A 2ISYA 1TQPA 2Z33A 3CO7C 3LA2A 5J8FA 1W5TA 2STTA 3AAFA 2LF7A 3ROUA 2YPRA 4LK0F 4LG0A 2VOPA 5A2QK 4FX4A 2A6EF 2OAZA 4UV9A 2RVCA 2DT5A 4JK1X 4IHSA 1ZLKA 1SFEA 4EQQA 3DV8A 4NHJA 2K4JA 1BI0A 2IVMA 1OPCA 4Y13A 3WG9A 2XAQA 2BEOA 3BPXA 5LGNA 5LRRA 3CJNA 2HYFA 1J7KA 4O6JA 2P5VA 1MJAA 3F3XA 3KCCA 3Q9VA 1KGSA 4RGSA 4MGRA 4QLCU 2FMLA 3FXQA 5J8CA 4NQWA 2XV4S 4R1HA 2GA1A 1ZGJA 5FD5A 2HEOA 1D8JA 4ETSA 2FA5A 3BZ6A 3HRSA 5LGUA 1HW1A 5ICGA 3P9KA 1I5ZA 4MQ9F 1EH6A 1QNTA 2HKOA 2P8TA 3HOTA 5DCFA 1G6NA 1SAXA 1S8NA 1W7PD 3NEUA 2K86A 3F8NA 4HX7A 5TJJA 1L0OC 2QZ8A 2Y48A 4WK8F 5A2QZ 3E6CC 1BBYA 2QM3A 3MAJA 1S7OA 2EFQA 2VODA 4GYIA 3HRTA 5E18F 2GIVA 1LEAA 1VTNC 1WSUA 1IW7F 1UFMA 2F5EA 4IRHA 2PQ8A 1J5YA 3J81K 2HFHA 4ASNA 4Q48A 4A12A 4ESBA 5LLQA 4G6DA 1T98A 4PCQA 3HOSA 1TLHB 3F8BA 4HBLA 5HS8A 3MZYA 3DXJF 2RV8A 3ELKA 3LSTA 4N0BA 2RDPA 5L3GA 3B02A 4Q47A 1OKRA 1XCVA 5DUIA 1H0MA 1I27A 4MTEA 3TQNA 1O7FA 2A69F 3Q5FA 3HUGA 4IPAA 5F64A 1RI7A 5LEJA 4WF2A 1SD4A 4OIQF 1XGOA 4DNCA 1H9TA 2P6TA 3EYIA 3KZYA 3FXRA 1MDMA 3U9GA 3F6VA 2CFXA 1S7AA 1NHAA 2H6BA 1SD5A 2VT2A 2ZFWA 2PEXA 5HDGA 1U3EM 3J81Z 4Y17A 5CVJA 3ZN1A 4R8HA 5BPDA 3KE2A 1BOAA 1GVJA 2MLKA 2DK8A 3HYIA 2CGPA 3WE3A 4HF2A 2VOOA 4A2UA 3FF5A 1BC7C 2X4HA 2QQ9A 2XRNA 4KIBA 4M9ZA 2OA4A 3BJOA 5CYVA 4BHPA 1FSEA 2JZYA 2NRAC 1HBXG 4IJAA 1IUYA 3QRFF 2XAJA 3WTZA 3GO5A 3K1MA 4KUMA 3TDZC 1KQ9A 2FBIA 2OQGA 2EV5A 3C7JA 1RZ4A 2HS5A 2COMA 2EB7A 2KJBA 3GW2A 2CO5A 3IHUA 3WODF 1PDNC 3ABUA 2VXZA 2Y0MA 1GHCA 5DYMA 5LBQA 4HZFA 4P9FA 1ZN2A 1OYIA 4QWQA 1RUNA 1ZG5A 2ADUA 3TDUC 3LQRA 3F23A 4EJWA 3R4KA 3ULQB 3QAHA 4HDVA 4M74A 1IXCA 4PGHA 1TQMA 1ZHFA 4LMYA 2WV0A 5E1ZB 3ZP5A 1P4WA 1MJ9A 4ESFA 4F7ZA 4UUVA 3T0YA 2ZXJA 2PI0A 1SFUA 1D3YA 2HZTA 5FO5A 2BYVE 2FF4A 2QBYA 2FMYA 2A61A 1EV7A 2FXAA 1V4RA 1O3RA 1I1SA 4IF4A 2IA2A 3JTHA 3GXOA 4YFNF 1DPUA 1XGNA 4P96A 1HQCA 3DKWA 3P7NA 1IRGA 3I5UA 1K78A 2Z99A 4LJZF 2MA3A 5D6EA 3KZZA 1T38A 4A0XA 1TW3A 4MTDA 2L54A 5K5OA 5D4RA 3LA3A 5JR3A 4BNCA 4L0YB 2R3SA 5BQTA 4EM1A 2OD5A 4D0PA 4YG2F 1KQ0A 2GXBA 4ZZLA 1LDDA 1TTYA 2L01A 1B1BA 1L3LA 1G3SA 1IN6A 1UB9A 2GXGA 5DCMB 3JAMZ 5BPIA 2H27A 2QLZA 4FHTA 3PQJA 1FYLA 4GCVA 4I2OA 5KVRA 1Z1DA 3ZMTA 1DP7P 2HWVA 3QPTA 3IRQA 4G8XA 2K02A 1DDNA 5D5UB 1FBSA 5F1RA 1RNLA 3L09A 1O3SA 1IRFA 2EFPA 3SZPA 1IZ1A 2VBXA 3TOBA 3FMRA 1XN7A 4IVNA 2A07F 1WRJA 3K2ZA 5ICCA 4YFXF 3CLOA 1JE8A 2DW4A 4L5JA 2O03A 3D5LA 4Y15A 2MC3A 5DD4A 4ENNA 3FX3A 1BN5A 1BC8C 5BMZA 1FOKA 4I98B 2VC1A 2A68F 1XB4A 4S05A 3GFMA 3N4MA 1STZA 4UVAA 1BM9A 2E7WA 1ZARA 3I0TA 4Z2YA 3U2RA 2Z5UA 3COAC 2XIGA
chains in the Genus database with same CATH superfamily
5GAEJ 5A2QC 1GXPA 1WI3A 3HGGA 4HNVA 4EJUA 4HQEA 1LB2A 3HIFA 2VL8A 2Y9YA 3ABTA 3EUHC 2YTFA 2NXNB 3PM1A 2V87A 1N36E 2BVLA 3L2QA 5FROA 1VQ9I 3GTPJ 3QP6A 1WQ2A 5FKOA 2DSYA 2VRDA 2OBPA 1OJLA 2EPMX 1U5TC 2R7FA 1DQUA 2HDCA 5FLXK 1CQTA 1XDUA 2COBA 4YIFA 5IT9K 5M5YJ 1FLIA 2EMXA 1X1CA 4M6YA 3K69A 2Z1DA 1PP7U 2JK3A 2DOEA 1WJPA 1A6IA 2VQGA 1UBDC 4G7OF 1LFPA 2ELZA 2MC5A 1XCBA 3H9GA 4JX4A 1HDPA 2QYOA 4WYQB 1ZR4A 2X51A 4LB5A 1FX7A 1JI8A 2LVHA 4RLQA 3I71A 3MZHA 1TWCJ 4NB5A 4MHGA 1MBJA 2EN1A 1SVLA 4RDUA 2LYCA 2JR1A 2ESHA 2F2EA 4XLHA 2D2WA 5LMNE 4BDZA 4DKKA 3E5XA 2E71A 2EOQA 1U0JA 2HU9A 3JREA 1R4MB 1FC3A 3VSKA 4R2RA 3ZCOA 3RTRA 3WGIA 1P2FA 2BY0A 4TUGA 2MD5A 2NVYJ 2ZNZA 3H35A 2ID6A 2Y9ZA 1F4KA 1XGSA 1I6HJ 1VQMI 1K83J 3LNQA 3BF2A 2VC0A 2R5YA 1AHDP 4LG0B 2EV0A 1GZ6A 5A6JA 3DFGA 2XHKA 2PN6A 4N4RB 2YTOA 4C2TA 4A3DJ 4NZVA 4DV5E 5EEAA 3LAPA 2E72A 4RGRA 3OYMA 1PUEE 1XMKA 4CCJA 3OYNA 4ENKA 3MEXA 3JSOA 1GV5A 3VODA 3IV5A 3HTUA 1A04A 3ADIA 1ETYA 2XASA 2IS4A 2E34A 3KYDB 1A31A 1EH7A 1IXSB 5FD6A 4BY7J 3DPUA 2O3FA 4CGZA 1MGTA 1YYKA 3JRCA 2HTSA 5IP7J 4JI6E 3ISPA 3C4BA 1VI0A 2EMKA 1A1LA 3T8RA 1T0FC 3OYGA 2D5VA 2NS7A 1ZAAC 1E3OC 2JXPA 1XMQE 3S2HJ 1QQIA 2D1VA 1K79A 1KU2A 3IWFA 3CCVI 1JGSA 2ECCA 2EQ3A 4B48A 5DUKA 4DR4E 3S1QJ 1FWZA 4UVCA 3VSLA 1D1AA 4EGYA 4HX8A 3V7CA 2RREA 3CUQA 4EATA 4BAYA 2P7VB 4WXCA 4NQWB 2BHZA 2DK5A 1AKHB 4HAMA 1O0WA 1Y1VJ 3AG1H 4LLLA 2HI3A 3FWEA 5FLVA 5FLXZ 2Y0SN 5IT9Z 1HKQA 3J81C 3RKYA 1W0UA 4C30A 4KWYA 4L5EA 2IJLA 2VB6A 2VT3A 4FT8A 2EPZA 2EILH 2XSJC 3EPJA 2JPAA 2MH2A 4X6AJ 2DT7B 3L2CA 4HPQA 4BE0A 3KEYA 1HCRA 1B8IA 2CUEA 2JTVA 2EMZA 2K9NA 2A5WA 1LQ1A 3HSEA 3A01A 4CZCA 3BBGA 3HXLA 1E2XA 5J6XA 3CESA 3FXMA 5EJCA 4IX7A 2WTEA 4II3A 1YUIA 3Q9SA 1WZ2A 2PJRB 2Y75A 3LFKA 3E1SA 4IRGA 4OWRB 5DDGA 5KNLA 4Y7NJ 2J5PA 3RIRA 1O7LA 4XLPF 2E60A 2W48A 2K4BA 1F1ZA 3HRUA 3CTAA 4XMYA 4XK4A 1DUXC 2MYSA 3THNA 4NC7A 3QP5A 2RGVA 2UUCE 1P4XA 5AC4A 2DMTA 1QBJA 1OYYA 2Y30A 4RAGA 5LHIA 2KHXA 3S15J 2RSMA 2KQRA 1FZPB 4L18B 4I0AA 3OYDA 5E1WA 5GPAA 2LD5A 2EQ0A 2K9MA 2DA6A 1UG0A 2M30A 3HEFA 3E97A 1A1FA 2W1OA 5FRMA 1H89C 1ENHA 4OIOF 4II2A 2HOEA 4B3XA 3LMLA 3L7WA 5F04A 2GAUA 3MZ8A 1TL8A 2GQQA 2TDXA 4H0EA 2LJUA 2CQKA 2Q1ZB 4KZSA 1TT5B 2K9SA 3IH2A 2IRFG 1OISA 4MQVA 3HGYA 3M99B 2XKPA 1AAYA 2BY2A 4UY8I 1QHGA 1NG7A 4F52A 2YSOA 3AG2H 4CYCB 1QVTA 1YYWA 1B69A 1YOVB 3HPGA 2CTDA 4HX4A 4KIGA 1WXRA 1I1GA 3W3CA 1TWFJ 3IUOA 4J01A 2KJCA 2WB1N 2HDWA 2E1MC 2Z16A 3D1NI 4HDUA 2EOSA 5HNFA 5M3FJ 4A3EJ 2V1DA 1W4MA 4LK1F 3W6VA 4M30A 5A6AA 5B3SH 2LSOA 3RYPA 2WAFA 4XLNF 3I56I 5IP9J 3E6DA 3DQVC 1R5ID 3AG3H 2JA7J 2YSRA 1VQ6I 3VHTB 3K70D 3GFJA 3VK6A 4KFCA 1SD6A 2FBHA 2E2IJ 2K27A 4I76A 4LB6B 3ZMVA 2OC6A 1IV6A 3C18A 2WY7Q 4HF0A 3ZMUA 1IXRC 4D9JA 2GXAA 3CP8A 1UHWA 3RKQA 3S17J 2JA6J 3HZJA 4A0YA 5K1YA 2JJ7A 1PJQA 3HUGB 4QPOA 2ZSHB 2P7CB 3SHFA 3KEQA 2L7FP 1P6RA 4X1EA 3E6BA 5DV5A 3TP0A 1F2IG 3CC7I 2X6XA 4BQOA 2KZGA 1RKWA 3BOQA 1J09A 3ERMA 3L9FA 4WPYA 1ETWA 2NNNA 2MH9A 2F4IA 2O61A 3D0SA 4NHRA 4B4CA 3OYHA 3RSNA 3DKYA 1MDMB 3VYRB 2KDOA 2FQ4A 3OSGA 1YW7A 1J9IA 4A6EA 2JPBA 4Z6YA 3L2UA 1X5WA 3W6JB 4IKFA 4DIQA 2E1NA 2W57A 4A5NA 5JVTA 3FM3A 3WTYC 1ZKGA 2XROA 5AE2A 3F72A 2PLYA 3F22A 2M4IA 1YO5C 4CCOA 1VQNI 4FASD 2N8XA 2EJRA 4I02A 1W5SA 3FKIJ 5LL6R 2RTXA 2K3FA 1FP2A 4XOTA 2Z9OA 1Y1WJ 2H09A 4XRSA 2JUCA 3ECHA 2WADA 4GGGA 3KYCB 2JA2A 2OCCH 3RCOA 3SEQA 1ZG1A 2ACJA 1A35A 2JVAA 4FQGA 1MMGA 1XSXA 2EPCA 1SVOA 4FX0A 4F54A 5KHDA 3M8FA 2EN2A 2YT4A 3CJTB 1GDTA 5DTDA 3GWZA 2WAEA 3GTJJ 3G4SI 1JUMA 2L7KA 3LL7A 2XPWA 3E3VA 2QVOA 1R36A 2L3JA 2F4OB 4HSRA 4EEFG 3M1CA 2ELHA 2L9SA 9ANTA 1QVUA 4F93B 2BHYA 2EMBA 1GQEA 3JAMC 2W85A 1PUFA 1E17A 1ZAOA 5AIPA 3DU6A 3OIPA 1V55H 3FBIB 1J75A 3ZMDA 3FMSA 2XGEA 3RPUA 4U7BA 2HQAA 5EGOA 1YIOA 2KFDA 3P9IA 5E79C 4U88A 3PIPF 2AQEA 2H8RA 3IKTA 4DR3E 4AIJA 1S3JA 4I09A 4MIMA 4L9NA 1ZR9A 2EM3A 4YFKF 2V89A 2L4MA 4KNYA 3CUQC 1ZGWA 2K9QA 4PK4A 2DA7A 4AVZA 4KISA 2Q2EB 1OR7A 4HEIA 1IQOA 3PJRA 4CYDA 2UXNA 4E7IA 1HDDC 1I6XA 3M3YJ 2VXDA 1OCOH 5K5RA 3EQLF 5EG0A 2UXDE 2M87A 4WWCA 4ZYGA 3VEPA 3GF2A 4XR6A 3BY6A 5LHGA 5CVUA 3X2QH 2YTEA 3CMEI 3CC2I 3LMMA 2W25A 3OYKA 2WWYA 5FFXA 1YHQI 4DBQA 1HR0E 3K0LA 1TNSA 1AU7A 4OAZA 4BCAA 3S1RJ 2EMIA 4V2GA 3SFZA 1RUOA 1ETXA 3AL0B 1BIAA 5J1YA 3IC7A 2O9LA 5HDNA 2EMGA 1FIAA 1KJKA 4X65E 4OMYA 1QZZA 5FLMJ 1J26A 1X49A 3HOUJ 2M7BA 2VJ5A 4P1WA 3FK7A 4ABZA 1JK1A 3E6MA 2GZWA 3DF8A 1BR2A 4B3TE 4DQ2A 3ECOA 1BJAA 3KP5A 4DMIA 1ULYA 4PGGA 3GZ6A 4R2AA 2WBMA 4CHUA 3HSFA 2RNJA 2VQLA 2W24A 4E7HA 1Z0XA 3I53A 3KX2A 1X1AA 2V79A 1D1BA 1QO0D 2ME0A 2V6CA 4WCGA 2M34A 3CC4I 2V83A 1RC7A 1F5TA 4H4KC 1XG1A 2YRMA 1J2XA 1FJGE 1LJ9A 3EUHA 4XLCA 4HLYA 4DV0E 4XKVA 3S3NA 2EOJA 5ILUA 2KKOA 4M72A 2XB0X 5HVQC 1U5TA 1SFXA 4NXME 1BJZA 2ZC2A 3WGGA 2QBYB 3WTVC 2O6GE 3JU0A 3WTTC 2VE9A 2BW3B 1W7PA 4BBSJ 3FISA 4BXFA 1K6OA 1Z21A 1H8AC 1ODDA 3KZIC 1UG2A 4P9UA 1XMXA 2DIXA 4DYQA 5BOXA 2LFBA 5E8IA 4ENMA 1ITYA 2YU3A 4RB1A 1X3CA 5HS9A 1SVMA 3K7AJ 4C3JJ 2XKOA 3GFIA 2DO7A 2F5FA 3JRAA 2AQFA 1I50J 1K78B 2R7SA 1FEXA 4P55A 3JAMK 4XSXF 1QPMA 1N3GA 1T4OA 4EVIA 1FT9A 4QPQA 2X1EA 3M8EA 3DEUA 1O3QA 3S1NJ 1K6YA 1YTYA 1KZHA 1ZGAA 1LFUP 2V4JC 1A1HA 5CQGA 3K4MA 4JX5A 1USTA 5AE1A 4L9VA 4Y33A 3O3KA 5DD8A 3H5NA 2DN0A 5F1JA 1JJ6C 3QQAA 1ZH5A 5F6FA 3K4KA 3IP4B 4G7ZF 2V1XA 2ZBKA 1UZCA 5C44J 5H6RA 3A03A 2R4GA 2CU7A 3LSJA 4QSHA 2EPKX 2EBIA 1DU6A 2YX4A 5ICFA 2PMZA 3JRGA 5AE3A 3WGHA 2L0KA 1TN9A 2XB5A 3K1NA 3CMAI 3GTQJ 4FETA 1G2FC 1EF4A 2BV6A 2YU5A 3B73A 4LLGF 1IF1A 5J1UA 4A6DA 3BP8A 1RR7A 1ETVA 1B9MA 1C0WA 3BQYA 2LKPA 4ON0A 3BT9A 3E5UA 1E0EA 3HTXA 3H09A 4KDPA 4DUYE 3ZQLA 2JN6A 1T0FA 1F9NA 1Z05A 3DP7A 1Z9CA 5D5VB 1WJ5A 2BB8A 5B1AH 5FB2A 5HODA 2EPPA 2WY8Q 2X0LA 1R22A 2LMDA 1HF0A 4Q35B 2QQBA 2OQRA 3KYLA 4IHTA 1AWCA 2A25A 4IQJA 1HC8A 1A1IA 3GTMJ 3NARA 2ETHA 1U9NA 2LTPA 2IP2A 2R1FA 3ZN0A 2D1HA 2ZXIA 2ISZA 2VONA 3MHSC 3PQKA 3ABLH 4HQMA 1MKMA 4I7HA 1XSDA 5F3WA 5DNYA 3RZOJ 1A6QA 3I9V2 4HYEA 3OS2A 1LPQA 2X1CA 4DR7E 4A3IJ 1GT0C 3SDBA 1ZREA 2EA2A 2HKXA 2LG4A 3N97A 2XUBA 4C9YA 4YIIA 1R5HA 2DMNA 4CXFA 4GKJE 3M7GA 1ONVA 3MCZA 2KL4A 2QKLB 2LNBA 1MMDA 3V8JA 2NUFA 1JHHA 1QZEA 2P6SA 4DYRA 2UU9E 4R2QA 3KP3A 3O6BB 4PUSA 3VPRA 3CD6I 2Q8KA 2M4KA 4JI0E 2K5CA 2UXCE 4KMFA 1BR4A 2HYGD 2X1DA 1IQSA 4PDKA 2EMHA 5CFFE 1X2NA 5FLXC 4O5VA 1ZRCA 5IT9C 2JA5J 4RAYA 2FU4A 3ASNH 3OYEA 2EJ4A 2FTXB 1KA8A 4LIUA 3CDHA 4IHYA 2NOJB 3BWGA 2G7UA 2FQ3A 4A93J 2WV1A 4XQFA 2DAOA 2JWTA 2CT1A 1FBUA 1T2KA 1UCRA 3ZGKA 3SQNA 1WI9A 5GTHC 2I13A 4WFTA 1N32E 2NS8A 2LKXA 2EE8A 2NYXA 4DOZA 2MW8A 1HW2A 4UNOA 1X19A 2PMUA 1GV2A 1ETQA 2L3DA 4GXOA 1KYZA 1X2MA 4BXUA 1IDZA 3A4CA 2X48A 4JOMA 4CO8A 2YS9A 1P4AA 1R1TA 2F5CA 3ONQA 2HPMA 2NVTJ 3PO3J 2JWOA 1S9HA 4LFUA 5L3EA 2E1OA 2WC2A 3OOPA 4KT6A 2KONA 2VIXA 2ZJ2A 3R6SA 1R71A 1V3FA 3V7SA 1HNZE 2CSOA 3OOUA 3RJPA 3F8CA 2A3SA 4IOCF 2EMFA 1YFHA 1B6AA 1LE8B 3L2RA 2QGUA 4O24A 2W82A 1DPRA 1E3PA 4JI1E 4ZDPA 3ZQ7A 4PFOA 5FKLA 2BBYA 4NUBA 1EH8A 3M07A 2QKMB 4OOIA 1OR7C 3U1KA 2LUPB 2QQAA 4N9IA 1FMVA 3I59A 2DMQA 1GTKA 3VYUB 4XONA 4R8OA 1G3YA 5IYDJ 1WH5A 4TUIA 1JKRC 1I39A 3KLOA 1XDSA 1SAUA 2XAGA 3NWSA 4IXAA 1W36D 4L0ZB 2DPUA 3TGNA 2X6YA 2X85A 2LRSA 4M6XA 2HQNA 3FIGA 4ESJA 4M3FA 1AOYA 3DCFA 3FMQA 5CLSA 3LSKA 3EDPA 3GZNB 3TP3A 2DFIA 2EOIA 2LF8A 3ERED 1R58A 1SEUA 2E1MA 2NAZA 5DEQA 2JSPA 2Z2SB 1IN7A 2EL6A 2ZB9A 3IWZA 2BZTA 1VQKI 2ZMEB 1O4XA 1WJBA 2IPQX 1WHUA 1DU0A 2DYSH 3IL2A 2CQ7A 5IOZA 4UVBA 5J1RA 2YU9J 2DXIA 2B63J 2HTJA 2XVCA 2HXOA 2KRCA 4MEYF 4M9SA 5AONA 1IRXA 1P7JA 4B09A 5C4JJ 2P5LC 2N3HA 3BQZA 4X0GA 4A3KJ 4I01A 4G12A 1A1KA 5IV8B 2R7DA 2DFEA 5LFAA 1LEBA 5HDKA 5LGTA 2R5YB 5F0CA 3QU6A 3TO7A 2VE8A 1LDKB 2VASA 5EZHA 2EP3A 2MDRA 4L9TA 1Q1HA 3HPZA 2D45A 3ESWB 1J59A 5KK1A 4E7LA 2MSYA 2OU2A 2ID3A 5IPAA 4U0YA 5CQEA 4BJ6C 3EYYA 3FXUA 4CDGA 2R7WA 1VFCA 4WXHA 4G6QA 1ZBQA 2LDUA 5AIQA 2LH9A 1ETOA 2WAQN 2QA4I 1U6GA 2CWEA 1W5CC 2PG4A 1R5GA 2FUG2 2V88A 2DDAA 4RB2C 1FYMA 3TW6A 2DU9A 1CF7A 3IRRA 4BE1A 3G2BA 2FOKA 3CDLA 5EYRA 5HNHA 2K3PA 2VQEE 3BC8A 3CJRB 4C2UA 4RB3C 3G1OA 2L7MP 3VFZA 2JA8J 3GEZA 4C2MJ 4GKKE 4M9XA 3OTOE 1ZRFA 5E8GA 3BR3A 2KMUA 4F9BB 2M8GX 1MJBA 3B6CA 4LITA 5ICEA 3GTKJ 4XRSG 1GXQA 1JJ8C 4HA8A 3OWTA 3CCQI 2XGXA 4B3SE 2X6OA 4IJDA 3J80K 2YPNA 2NVUB 3OIOA 4YIRX 4RGUA 5CVIA 3BDDA 1PKPA 5KL3A 2W00A 5M5WJ 1XMAA 4DV2E 1EKZA 4E70A 5CVVA 1SFKA 3W6KB 5F0FA 1B4AA 2TCTA 3CCYA 1ETKA 2UXXA 2V26A 5M5XJ 1R1VA 2FOWA 5L3BA 5HLHA 1VQ5I 3SZGA 4BUPA 3S16J 4O3MA 5LEKA 2NS0A 1B8IB 4IOAF 3MQ0A 4KICA 4BMJA 4GEQB 1PYVA 1OLTA 5JFRA 3A01B 4OINF 2K4VA 1MBGA 2A6TA 1HOMA 4LGWA 3I54A 5D5WB 5TRDA 2KPMA 4NBQA 1Z91A 2N8GA 4BQAA 5ADZA 3CUOA 3DBRB 3H5AA 2R7OA 1BOBA 2MABA 1EJ9A 2EZLA 4DR5E 2ZJPF 3A2KA 1MMAA 2ENAA 1EKEA 1SFOJ 2EPNA 4XL9A 2X6WA 3T5XA 1IN5A 4JYKA 3VOEA 4P5OA 3F21A 4M3DA 2H1KA 2DOFA 2OTJI 1BIBA 2VJIA 2CFOA 4J19A 1YYOA 3F8MA 4KN4X 2LCEA 4HG2A 3KP6A 1FMWA 4KMUX 4R2PA 2FE3A 3QPSA 3WE2A 1IDYA 3BPVA 5E3MA 1XD7A 4JX6A 2IS2A 4JP0A 2DQRA 2K40A 3DTIA 3FM5A 1MIJA 3KIOA 4K2EA 2YTGA 4OIRF 3IAM2 4OMZA 2Y69H 3HKZA 2RC4A 4E4HA 4A0ZA 2EPAA 4RA2A 2BBGA 3L00A 4XKWA 3KP7A 3CCEI 4LLNA 3ZRGA 2B3TB 3SDGA 3V4GA 2IA0A 3H5RA 3RMPA 1G2HA 4BEHA 4CCNA 3IWCA 3HOWJ 2KIMA 2KIUA 1XX5A 2LBFA 4ZZDA 5TSEA 3M9AA 2PBIA 2HQRA 3BG5A 2RKHA 3GUDA 4RH8A 4JYAE 3W2AA 1T8IA 4F9AB 2FJ1A 3T8TA 1U78A 1KU7A 4DJAA 2ENHA 2XAHA 3ABKH 3FBNB 3JRBA 1RRJA 5D6FA 4R2EA 1FPQA 3J80Z 4Q5SF 3L1PA 1G3TA 2L3CA 2IHR1 3RPQA 4Y4RA 1BI1A 1LNWA 3M8JA 2Z3YA 4B1RA 2L2MA 2B7TA 2YX7A 3JRDA 2B7VA 2EA4A 5FFZA 2CH0A 2WAQA 2CG4A 2ESNA 2XF5A 3TW7A 1YJWI 2TRTA 3DLLF 3IWBA 1DGCA 3JW4A 1Q1VA 3KP4A 3OV8A 5J4VA 2V85A 2JT1A 4MEXF 1PJSA 1NCSA 2BOLA 2EZ6A 1LKXA 1UHMA 2YSPA 3K4NA 4YRVA 2HJJA 1B9NA 1BI2A 2F5VA 2IEKA 1R23A 3MVPA 3TEDA 1R49A 4F92B 2EWLA 3BG7A 3OYLA 3OL4A 2EMCA 3FZVA 3GFLA 2NOGA 1IBKE 4I6ZA 3O8GA 2VF1A 4F3QA 1TBXA 1BR1A 4BDYA 1VQLI 3PIOF 4IHVA 4XRFA 4RS8A 3QWLA 1WPKA 2V1NA 4DW6A 3R0JA 3HPSA 2IBDA 3H3UA 2UXBE 2PFBA 1V5GA 2EMWA 4M3EA 2LP0A 1Z67A 1GUUA 2KZVA 1UILA 1SMTA 1PJRA 1FSHA 4X8WA 5TGTA 3HJEA 1UHSA 4D1QA 1IC8A 1T4LB 2W7NA 3EQ1A 3K1PA 3LSGA 2VKVA 4P78A 4BS9A 3OL3A 3CMMA 1XSVA 4CA0A 4DBRA 3G71I 4U0WA 2IAIA 3THOB 5E1XA 1IAWA 2HDDA 3CDIA 3LSHA 4U87A 3CLQA 1HLVA 3F8FA 2R5ZB 3PUFA 3CQZJ 1JT6A 1WCMJ 3EETA 1JKOC 2EOYA 4CCMA 2DA2A 2V1UA 2XPVA 2DFHA 4HF1A 4K0KE 4UHTA 5J4YA 2DPDA 1TNTA 2ODRC 3BG9A 3K4JA 1T4NA 2EM5A 2K7IA 3QOPA 2MKDA 3HHHA 4QIWN 5AC5A 3VYYA 4MO7A 1TT0A 5TISC 3S8PA 1MNEA 3K9TA 5KAFC 2DLQA 1PUFB 1M1EB 3T1BA 3J7AO 2JP9A 2EIJH 2QUFA 4CUGA 2ZKZA 4UUSA 1SMYF 1U8RA 5E3OA 3ZPLA 3NQOA 1IO2A 2HR3A 4BKXA 3JTGA 1DI2A 4G94A 5EGOB 1S29A 1WFXA 3HHGA 4DGWB 4BQNA 5ED4A 3T1HE 3ZMSA 4HSTA 1REPC 1Y6IA 5C4XJ 4JI8E 1NG6A 3A0HC 4W1UA 2IGMA 1IN4A 2HZDA 2ZJQF 1ON2A 2F4VE 5HLGA 5JI6A 1OQYA 3CF5F 1R7JA 1X3WB 2VUMJ 1QU6A 2HNHA 4Q28A 3KEOA 3LOCA 2DJNA 2LLKA 1HNWE 4RAFA 5EEGA 5EG0B 3SZTA 3HPHA 1ON1A 5EEHA 3OS0A 1LVAA 2VBYA 1MZBA 2EFOA 4MLQA 2EN3A 2QCOA 1WJCA 1N78A 4I0BA 5K7FA 1IMUA 2EFNA 2PMZN 4BXXJ 1TQIA 2CSHA 1OYWA 1T33A 1MBFA 3F6HA 4LOCA 4IRIA 1ZLJA 2QSHX 1B72A 2PX9A 3F6GA 3QODA 2K7LA 2HPIA 3EUAA 4AC0A 5A6BD 2EIMH 1RKTA 1P7IA 3DPLC 4CCLA 4UB8C 3WU2C 1MSEC 2EH3A 3AUZA 2DMUA 1PDAA 1NTCA 5FGMA 4BJ5C 3FXOA 2J5OA 2HOTA 1F43A 2DFFA 1CGPA 2DA1A 2CJJA 3KPHA 3ML6A 1XGMA 5LHHA 4F2JC 2CYYA 1JGGA 3G3ZA 1G2DC 3RDIA 4PSXA 4AUXA 1QRYA 3GYHX 4MNUA 1SD7A 2DMYA 4JQFA 4DZJA 4JI5E 3QPLA 1ZELA 4ZYDA 1P92A 2VPRA 3ZOBA 3C4TA 5IOYA 1U5TB 1APLC 5KL7A 3WG7H 4ZJZA 1KYWA 3HQ1A 2EZHA 3Q0VA 3CF2A 5B5EC 4A3MJ 2QENA 2CS3A 1HSTA 3GVAA 3C2GA 1JUPA 5B1BH 2EM9A 2EM2A 4JV5E 1W7PB 1G4DA 1BW5A 2L92A 5LRSA 2QWWA 1K4TA 5KAIC 5AASA 2GOMA 4LF8E 2H94A 2BGCA 1YRNA 5L3DA 2A05A 2P5KA 2FV4B 3KETA 4BHBA 2MFZA 2JYAA 3I58A 3P5JA 2M5WA 2VBZA 2NVXJ 4DUZE 4OX9E 3ZQIA 2ENCA 2EM0A 3LSIA 4RLFA 2MBFA 2A6HF 3AFHA 4M71A 2L2KB 1X6FA 2VE7C 5J40A 1DQ3A 1IG7A 4JBAA 4BACA 2ECBA 1Y8QB 2ICWG 2EOXA 3KFWX 4IL6C 2DGCA 1JXSA 2M9HA 2FNAA 4KYWA 1ZYRF 3LWFA 4OU0A 4HOBA 5H6QA 1IV8A 2UZKA 2BY3A 1OCTC 1A1JA 2H1LA 1WHNA 1HKSA 2KIFA 2FNPA 3I64A 1VQOI 1FTTA 3ADJA 1G3WA 3WTSC 1N77A 5ILSA 4EV0A 2DOAA 5IYCJ 4A3LJ 3V7RA 5H2FC 2EWNA 2K85A 3REOA 1QPIA 2H6CA 3IKVA 3E5QA 2Q2EA 3PNVA 2JOBA 5HOOA 1YYVA 3S2DJ 4ENJA 3J7Yp 3V8LA 2EOFA 2ZO4A 1KU3A 3BCBA 1Z7UA 3RI4A 4ZH4F 1WJAA 4DV1E 5DS9A 3JRIA 2KRFA 4D5FA 2JMWA 5BR8E 2M7AA 4HV6A 4BU2A 3P1XA 3ZMZA 1XNQE 5D8LB 4GRIA 4KJZA 5KL5A 3I4MJ 1RR8C 3SEZA 1R9TJ 3HB9A 2YTQA 2Y31A 4BBRJ 2GA2A 3QU3A 3ZQHA 1ERDA 2B0LA 1R00A 2F8BA 2MLGA 3OSFA 2LTSA 2CW8A 5J47A 4Q4ZF 4DZPA 1O3TA 5CKTA 2DTRA 3S93A 4ZC3A 1Z7LA 1KU9A 1X4PA 2MGQA 4WX9A 2O8XA 2P81A 3JSPA 2BXYA 4E7SA 1JHFA 1T39A 2HVRA 4D7NA 1Y0UA 3WTUC 2D9HA 2YWQA 1QGPA 1D5YA 3DEWA 4F6MA 1FTZA 4U0VA 5D5XB 1X1PA 3PSIA 5ILVA 3ZQCA 5F08A 5ERIA 3U1DA 1MD0A 4RGXA 2V9KA 3JCUC 4E7JA 3BTIA 3V8KA 4F55A 1LVKA 2FRHA 1Z1BA 5K7ZA 4RB0A 1UMQA 2E7XA 1X1BA 5H20A 3SYTA 2LC2A 3R0AA 3LSMA 2RS7A 4E6KG 1YW8A 4EM0B 2EN6A 4XKBA 3K2AA 1LFBA 3NAUA 1S72I 3FHNA 2EN4A 1FY7A 1FOYA 1YS6A 2EFWA 4BHCA 3AKZA 4M73A 3F6OA 2EN7A 2PJPA 2L4AA 3G73A 3C6KA 3H92A 1Z6RA 5IT3A 2E1CA 3GMEA 1P47A 2DCEA 3R60A 3CO6C 1F36A 2L2NA 3ZQFA 5BNGA 2VQHA 4HNTA 2EV6A 4ZYHA 3Q0WA 4EJVA 3TKYA 1K7AA 3DKXA 2XC7A 4DR2E 2OZ6A 1ZBTA 4PJMA 4IEJA 1XTAA 1USSA 2XAFA 3RYRA 4X66E 5IY5H 4IHWA 5A6KA 1ZRDA 1FYKA 1BI3A 1R6RA 4LIVA 1WJFA 3GBGA 1OFCX 3TL4X 2RSIA 3DWLE 2KHMA 2OCEA 3H3ZA 5DM7F 1HW5A 2R7XA 3I59B 2Q0OA 3UKGA 2JSCA 3TOAA 4B44A 2UUZA 3H0DA 4R2DA 2EM8A 4XSZF 3GLXA 2EMAA 4HNUA 2F5DA 3PFIA 4R2CA 2PRTA 4UXNA 2RNGA 3MKWB 3E7LA 1X3UA 2EM4A 1YX3A 1GVDA 1V5FA 3I4PA 2AS5F 3QYEA 2NABA 1IN8A 4YHHE 1QZYA 4IQ4A 4M3BA 4HTGA 4IZZA 1OMIA 1TF3A 4A5MA 5D4SA 3OR2C 4TV7A 4A3FJ 1O57A 1OCCH 2E1MB 1VQ7I 2EM7A 2RQPA 1TF6A 3NWTA 4RAZA 4Y3OA 5D8KB 2LO3A 2GIZA 4AYBA 4AD9A 3HSRA 3OY9A 2P4WA 1JUSA 4EJOA 1UAAA 3FHZA 2ZCWA 3SXYA 1WWXA 1U8BA 1SANA 2FEZA 3BTCA 3QYBA 1W0TA 3LAJA 2EPRA 2EM6A 1G59A 3WTWC 3RQIA 3K4CA 4BYYA 3HTSB 2VKDA 4B8XA 3J80C 2W4SA 2H36X 2PMHA 4HLXA 5HLIA 2XGDA 1WKMA 2IA1A 3M1EA 4FISA 2ZSIB 3W2WA 1VQPI 3WU0A 4W97A 1YS7A 2Y2ZA 2IT0A 2NVQJ 2G9WA 6PAXA 1Y0NA 2M0MA 2BXZA 2A5YB 2L9NA 2HXIA 4HW0A 2WCC3 3EPLA 4OIPF 4ITVA 1RPWA 2RN7A 3TO6A 4S04A 1MMNA 1FBQA 2CMPA 3WU1B 3MSWA 2VN2A 5DCMA 1L4SA 4UV8A 4FTHA 3CMYA 4NC6A 3KLNA 4AM3A 4ZDOA 2OUMA 4PFPA 4AWXB 1ZK8A 4XBFA 5K5QA 3EPZA 4ZYEA 4R79A 4U7DA 3HKZN 1T95A 4L9JA 1B59A 3JRFA 2RQQA 2ZNYA 1NH3A 4X9JA 1QHHD 1TC3C 3R61A 2OTLI 1CF7B 1Y8RB 4ZDLA 1U9OA 1QA6A 2EOEA 1H9GA 1VZ0A 3I55I 2E36A 5HS7A 4XICA 2HGCA 4PJJA 5E17F 2G7HA 2CQXA 3H9QA 2EPUA 2M1BA 3D5RC 1N75A 3GX4X 2UWMA 3VB2A 2YTNA 2HVQA 2LY2A 1LDJA 4PZJA 4ZYAA 4E7ZA 2CQNA 2DLLA 3DF6A 5CVRA 4EM2A 2JPCA 1PP8F 3L2VA 1HNXE 3BJ6A 4LFCE 5B66C 1RIOH 4N9HA 2VBWA 3LA7A 5BS6A 5F0HA 5IYBJ 1U2WA 1A36A 3C2HA 3QPHA 2EQRA 1JKPC 1YLFA 3H1CA 5L3CA 4YY3E 5FRNA 2QQ8A 4D7MA 4ANJA 2E2JJ 2C6YA 5C3EJ 4B3RE 1KQ8A 1S7EA 2CW0F 1Z3YA 4ZTJA 3FDYA 5CPRB 5LMUE 4LF6E 4G9YA 4HEA2 2CW7A 5J3LA 4GFBA 3NRVA 3B6AA 4KN7X 3KWRA 2OZUA 4BH9A 4EJTA 3MWMA 2I9IA 1HSJA 2JRTA 4Y52J 5CJ9A 4EMSA 3UR3C 1S6LA 4N4OB 4O5GA 4CZZA 5FKMA 3P9CA 3AL0C 1SC7A 3WTXC 3BGHA 3C3WA 3S2WA 1YG2A 1P9QC 4G7HF 2B7EA 4GO1A 2R93J 2L02A 1MH4A 5L3FA 1A5JA 2FBKA 2RS6A 2HVSA 3BROA 2L33A 3V42A 2M1SA 3K70C 1H88C 3KP2A 2ZMEA 3MHHC 3CUQB 3LQQA 3QYFA 5E20A 2EK5A 2O8KA 4HV5A 2YR2A 3CCLI 2FSWA 3RKWA 1J0RA 1YW9A 2W84A 2O0YA 2XSDC 1D0XA 2LMZA 2ZXWH 1X58A 2G0EA 2DBBA 3BZKA 4KIFA 1PVEA 2ZFUA 4KT5C 1D8KA 2STWA 1R1UA 3M4OJ 1RESA 1T56A 2F48A 2M45A 1T6SA 4L5IA 2M8EA 2DQLA 3HRMA 2DI3A 4IO9F 2NUGA 2IW5A 2L9VA 5JHUA 3OYFA 1YX5A 4AIKA 2HHHE 3K4LA 3ASOH 3O2PE 3CCJI 1TW2A 2LY1A 3K6QA 2AXLA 1D5VA 4GYGA 4CCKA 2HQ5A 2NNYA 2P0WA 2GLOA 4CICA 3BG6A 4PJLA 4JI7E 1V5EA 3CCSI 4HRIA 4WXDA 2EOHA 2ZJRF 1YQAA 1HXDA 3DEEA 1FNNA 4AIDA 3DPTA 2BE5F 3RKXA 2YU8A 4BEHB 1ZG3A 3C1DA 3ZOQB 1HKTA 4AVPA 2V9VA 4LF5E 2LBFB 2MD0A 4KA4A 3MFKA 1JKQC 2ZXHA 1VQ8I 1BB8A 2GWRA 4LD5A 1X4OA 3GZ5A 1FP1D 2VJ4A 3BJAA 4EGZA 5FKKA 3FK6A 1Z6TA 3TO9A 4AIHA 2E2HJ 2ISYA 3GTOJ 2WZOA 4DR6E 1TQPA 4M2ZA 3C6MA 1XNRE 5IWAE 2XF7A 2KDZA 3CO7C 2Z33A 4XLFA 3LA2A 2LVSA 2VQCA 2LV2A 4PJNA 5J8FA 4D5CA 4LF9E 3CJQB 1W5TA 1DGWY 2STTA 3AAFA 1IBLE 2LF7A 5A69A 3ROUA 2YPRA 4BJTA 2MG4A 4F9CB 3RPUD 2LJHA 4LK0F 4LG0A 2VOPA 5A2QK 1YE9A 3SFIA 1KYQA 4FX4A 2A6EF 3F0CA 2OAZA 5HLTA 2EMYA 2GBYA 3VDXA 2KRHA 4FE7A 4B3ME 2IGOA 2M3AA 2ELKA 4UV9A 2O5RA 4XRMA 2RVCA 1TP4A 2EPOA 2DT5A 4JK1X 1WJDA 4IHSA 2XRLA 1ZLKA 1BW6A 4J8ZA 1SFEA 4EQQA 2DDBA 3DV8A 1JK2A 4NHJA 1AA7A 2K4JA 1WVRA 2YZTA 2ME6A 3BCAA 1BI0A 3I4NJ 4M9VC 2IVMA 1OPCA 4Y13A 3WG9A 2XAQA 2BEOA 3BPXA 5LGNA 1DP3A 4XKCA 5LRRA 1V54H 5KL2A 3UK3C 3CJNA 2HYFA 1J7KA 4O6JA 2P5VA 1MJAA 3F3XA 3KCCA 2MDGA 1Z77A 5IP6A 1KGSA 3Q9VA 4S0HB 2JOXA 4RGSA 4M0VA 2LY9A 3ABMH 3BG3A 3DBLB 3H36A 4MGRA 4QLCU 4UB6C 2FMLA 4RM3A 3FXQA 5J8CA 1IBME 3MN2A 4NQWA 1AKHA 2L2OA 4OAYA 1LUJB 2V86A 2GPIA 4O4KA 1A1GA 3OS1A 2XV4S 3UNGC 3JR9A 3Q3SA 4R1HA 1NEIA 2GA1A 1ZGJA 4KHPE 5GP9A 5FD5A 1FOXA 2HEOA 1D8JA 3OYCA 2YTIA 1VQ4I 1YJNI 2DTZA 4C3IJ 4ETSA 2FA5A 2AXTC 3BZ6A 3HRSA 5LGUA 1HW1A 1JT0A 3OMYA 3HG9A 2EOOA 5ICGA 3K10A 3LLHA 2WBUA 3P9KA 3HOVJ 2E5NA 1I5ZA 4MQ9F 1EH6A 1QNTA 2EINH 2HKOA 2P8TA 3O8HA 3HOTA 4WSGA 4BE2A 4YELA 2JUGA 5DCFA 1G6NA 2YTPA 4UUTA 1S8NA 1W7PD 3DBHB 3PNTA 2LOOA 1SAXA 3FXJA 2WA0A 3NEUA 4PJ0C 3K6GA 1XS9A 2K86A 1NK3P 2PJRA 4I8OA 3F8NA 2CV2A 4HX7A 3GTGJ 5TJJA 1L0OC 2QZ8A 2Y48A 5GPCA 2EOZA 2L8TA 4UUSB 4WK8F 2I5UA 5A2QZ 3E6CC 2R7VA 1BBYA 2QM3A 3MAJA 4BL0B 3H3VK 1S7OA 3I3LA 2YUSA 3HC7A 3BTJA 2EFQA 2DA5A 4GDFA 1XMOE 2VODA 2KISA 3TMOA 4GYIA 3HRTA 5E18F 2GHFA 4C3HJ 4X64E 2LT7A 2GIVA 2EL4A 1LEAA 1VTNC 2EPLX 1WSUA 1IW7F 1UFMA 2F5EA 4DR1E 4PSWA 4IRHA 4GZNC 2PQ8A 1J5YA 3J81K 1JTXA 1BA5A 2JY9A 1YSAC 2HFHA 1YZ9A 2BVMA 3ZQQA 3BZCA 4ASNA 4Q48A 4A12A 4MLVA 1YPNA 5KCMA 2V8QB 4CH7A 2R7TA 4ESBA 2ADRA 2CPNA 5LLQA 4G6DA 1T98A 2FGGA 4PCQA 3HOSA 1YI2I 1TLHB 1I94E 3F8BA 2UUBE 2EPXA 1TWHJ 4LF7E 2H8WA 1RQ0A 4CYCA 3A1YA 1I3QJ 1FKAE 1D0YA 5E3LA 4HBLA 5HS8A 3DJWA 1B72B 2YRHA 3GTLJ 2I10A 2KP6A 2X9DA 3MZYA 2O7OA 5DM6F 3DXJF 3OYAA 2RV8A 3A02A 3ELKA 2Y0SA 2EZKA 3VWBA 2JVGA 2B9DA 2KLOA 2E5LE 2DYRH 3LSTA 4A69C 4N0BA 2RDPA 1WGXA 5L3GA 2LE2A 2ZMEC 3B02A 2LTRA 2DLKA 4Q47A 2YTDA 2NUEA 1OKRA 1XCVA 3LSPA 1HA8A 2VKHA 5DUIA 4LTYA 2R7QA 5FJ8J 2M9AA 3PSFA 4XIDA 1H0MA 2V9PA 3HBLA 1I27A 4MTEA 5GAGJ 4BC7A 2M7QA 5JHFA 2CRGA 3TQNA 1SR9A 1MW7A 1O7FA 2L7ZA 4IHXA 2A69F 2LBSB 2GM4A 3Q5FA 2KIQA 2VLAA 2MC6A 2EIKH 2DJIA 1MBHA 3HUGA 4LF4E 4FCYA 4IPAA 3EPKA 2VQFE 2AO9A 1RI7A 3PNYA 1OCZH 5F64A 5LEJA 4WF2A 4V19K 2R5ZA 4XORA 2OF7A 4RMNA 1SD4A 2CUFA 2LREA 4F6NA 2CV0A 4FK5C 2I8DA 4OIQF 2LKSA 1YRNB 1ZQ3P 2R76A 1XGOA 2MC4A 3TBIA 4DNCA 2YTJA 1H9TA 2P6TA 3EYIA 4MFDA 1MMSA 3BR2A 1IUFA 3KZYA 2QEXI 2HGHA 1N25A 3FXRA 1MDMA 1X6HA 3U9GA 1YIJI 3F6VA 5EF6A 4X62E 2CFXA 1N33E 1S7AA 1NHAA 2H6BA 1SD5A 2VT2A 2XAUA 2ZFWA 2N3GA 3QG5C 2PEXA 5HDGA 1U3EM 3RZDJ 3OYJA 3AG4H 3J81Z 1E3HA 4Y17A 3VYSB 4NNJA 5CVJA 3S1MJ 2L6MA 3MMYB 3J7AY 2K9LA 3ZN1A 3HM5A 4R8HA 1QU3A 4CSWA 3PO2J 1BBGA 1MBKA 1GLNA 4N4NB 1XC5A 2EZIA 2QSGX 4B43A 3KE2A 5BPDA 3OMLA 1VNDA 2VPLA 2J7JA 3J7AG 1BOAA 1GVJA 4KITB 3ADLA 1IRZA 2MLKA 2DK8A 3HYIA 4LFBE 2CGPA 3W2VA 1XPXA 1W1WE 3WE3A 4HF2A 5FKNA 2VOOA 2WB1A 4A2UA 4B47A 3FF5A 2OPTA 1BC7C 2X4HA 2QQ9A 3FXKA 2XRNA 3U21A 4DV7E 2IGKA 2VKEA 1N34E 2HOSA 2EQ1A 4KIBA 4M9ZA 3IWDA 2OA4A 4O43A 2UV1A 3FXLA 3OIQA 3MKYB 4P7DA 3BJOA 4A3BJ 5CYVA 4BHPA 1FSEA 2JZYA 2NRAC 1HBXG 4IJAA 1X3ZB 1IUYA 4BC9A 3QRFF 2JRMA 1BBOA 4BGDA 2XAJA 3WTZA 3MKZA 3GO5A 3K1MA 4KUMA 3TDZC 1KQ9A 2FBIA 1POGA 2OQGA 2EV5A 3LSRA 3C7JA 1RZ4A 2HS5A 3CCUI 1UJ8A 4JI2E 2COMA 2EB7A 2EL5A 3OYIA 1K4SA 2KJBA 4JI3E 3DLAA 3GW2A 2CO5A 2E19A 3IAS2 3IHUA 3WODF 4AQYE 2DB2A 3ADGA 1PDNC 4DV6E 3ABUA 2GLIA 3MD2A 3H9JA 5F27A 1X1DA 1W36C 2DMPA 4AYBN 2VXZA 4V2FA 2Q8UA 3VYXA 1D0ZA 2DA4A 2Y0MA 2QSFX 2VI6A 5DYMA 5LBQA 1GHCA 5IXMB 4HZFA 4P9FA 1ZN2A 1MNDA 1OYIA 4QWQA 1RMDA 4E7KA 2HC5A 1MH3A 1RUNA 1ZG5A 4WSPA 2ADUA 3TDUC 1FIPA 3CZ6A 3N05A 2XF6A 4M6VA 4G6TB 3LQRA 3F23A 1WJEA 2FX0A 4EJWA 3LFUA 1MSFC 2LUQA 3R4KA 4JI4E 3S14J 4AU7A 3ULQB 3AV0A 3QAHA 3S3OA 3G6EI 4HDVA 2ELYA 4M74A 2V7FA 1IXCA 2EORA 4PGHA 4DYCA 2R0QC 3S32A 1LLMC 2EN8A 1TZLA 2ODRD 1TQMA 5E3NA 1I3AA 1ZHFA 2F4MB 4LMYA 1YJ9I 1FJLA 2WV0A 3K4BA 5JVGF 5E1ZB 1MNMC 3ZP5A 1PJTA 4XM3A 3PL8A 2ZM6E 1J5EE 4F91B 1P4WA 1MJ9A 3BR0A 2RPCA 4ESFA 2HOAA 4F7ZA 2LK2A 3A0BC 4XOPA 3T0YA 4UUVA 4R2SA 2ZXJA 2PI0A 3BTLA 2IXSA 2VJJA 1SFUA 3BLYA 3BR6A 1D3YA 3HL2A 1X6EA 3J7ZI 3FKJA 2HZTA 2DODA 4FE4A 5FO5A 3CP2A 1G8XA 2BYVE 2FF4A 3OR1C 2QBYA 1Z3XA 2FMYA 2A61A 3L2WA 4BY1J 1EV7A 1KONA 1MBEA 2BW3A 2FXAA 4A3GJ 4IS1C 1WH7A 2OJED 2RAEA 2LR8A 3RQ4A 1V4RA 1O3RA 1I1SA 4IF4A 1X47A 5M3MJ 2IA2A 3JTHA 3WHBA 1FOWA 1IGNA 3GXOA 3CCRI 2CQQA 4YFNF 1DPUA 3EPHA 1XGNA 4P96A 1HQCA 3DKWA 3P7NA 1IRGA 3I5UA 3D5SC 1K78A 2DA3A 2CUZA 2E35A 4XN0A 1YITI 2Z99A 4LJZF 2MA3A 4RM2A 5D6EA 4B3AA 5GAHJ 2R7ZJ 1ZU1A 3GCMA 2CV1A 3TQMA 2EPFA 3KZZA 4LU9A 3FIWA 5EZGA 4L5NC 4XNFA 3WHCA 3HOZJ 2IS1A 1T38A 2BY1A 4A0XA 1TW3A 4XLEA 4MTDA 4NC8A 5LD2C 2L54A 2R7UA 2QF7A 5K5OA 4RHBB 3ECRA 5D4RA 4LFAE 3DTEA 3F9KA 4J00A 5T6JA 3IH3A 3ZR8X 4RBOA 1UELB 3LA3A 3PUBA 5JR3A 4BNCA 2IGNA 4L0YB 2RQLA 2R3SA 3EUKL 4L8NA 4YEJA 1NK2P 4DV3E 5BQTA 4EM1A 2OD5A 4M3GA 2OV7A 1TWGJ 4D0PA 1K61A 4YG2F 1KQ0A 2GXBA 3VYTB 4MLOA 3S3MA 2DMIA 4ZZLA 1AH5A 1STUA 1LDDA 1TTYA 2L01A 5K7HA 2YRKA 3T1YE 1IJWC 2L9RA 1B1BA 1ZTRA 1L3LA 1G3SA 1IN6A 2DRPA 2E5ZA 3Q0UA 1UB9A 2F6CA 3JTZA 2GXGA 4A3CJ 5A6BA 2M0CA 2CUJA 1BL0A 5DCMB 3JAMZ 3HOYJ 2KOUA 3BR1A 5BPIA 2H27A 2QLZA 1S5LC 4MFEA 2UUAE 2HYJA 5JLWA 1OCRH 2EMLA 4FHTA 3G1LA 4NDLA 4XN3A 3PQJA 1FYLA 4GCVA 3CCMI 4I2OA 5KVRA 4DV4E 2IS6A 1Z1DA 3ZMTA 4A3JJ 1DP7P 1X48A 2HWVA 1R4NB 3QOEA 3QPTA 3ZQGA 3IRQA 3HDDA 4G8XA 2K02A 3E0JB 1VF9A 3J7YJ 1UN6B 1DDNA 5D5UB 4R03A 2GOXB 1FBSA 5F1RA 2L5QA 1RNLA 2LRDA 3BR5A 3L09A 3PFYA 4LG3A 3OYBA 1O3SA 2V6EA 1ACIA 1T08B 2AHQA 5JLXA 1IRFA 3HOXJ 2EFPA 3ZXSA 1OCPA 5EDNA 3SZPA 1IZ1A 3MKLA 2VBXA 4OOGC 3TOBA 2ELJA 3FMRA 1RETA 2DT6A 2NA2A 1XN7A 2XPUA 4IVNA 2A07F 1WRJA 2KT0A 3H0GJ 2JVHA 4BQQA 2FD5A 1YUJA 3K2ZA 3C2BA 1TWAJ 4YFXF 5ICCA 3CLOA 2XGCA 3DTKA 2DW4A 4QTRA 3SJMA 2B9SA 1JE8A 1ORKA 1Y56A 2EOMA 2MKNA 4L5JA 4NXNE 2O03A 3D5LA 4Y15A 2MC3A 5DD4A 3DU5A 3G1MA 4ENNA 2XDVA 1MEYC 1RC9A 4I99C 5GADJ 3FX3A 1ZR2A 5KL4A 1D1CA 2WBSA 2M2EA 1BN5A 4XLAA 3BIDA 1BC8C 5BMZA 1WHQA 1FOKA 1UHZA 4I98B 4BBYA 2VC1A 2A68F 2WBTA 1XB4A 4S05A 3GFMA 1EA3A 2JQ7A 2R92J 3IH4A 3N4MA 1STZA 4UVAA 1JTYA 1BM9A 2R7RA 5GTIC 1DGRM 2E7WA 3JRHA 2M4GA 4ZTFA 1Y39A 1LE8A 1ZARA 3I0TA 4Z2YA 5KL6A 3GLLA 3U2RA 2Z5UA 3COAC 2XIGA
chains in the Genus database with same CATH topology
1GXPA 4EJUA 4HQEA 1LB2A 3HIFA 3ABTA 3QP6A 1WQ2A 2OBPA 1U5TC 2R7FA 2HDCA 5FLXK 1XDUA 4YIFA 5IT9K 1FLIA 4M6YA 3K69A 1PP7U 4G7OF 1XCBA 2QYOA 4LB5A 1FX7A 3I71A 3MZHA 4NB5A 4MHGA 2ESHA 2F2EA 2D2WA 3E5XA 1FC3A 3RTRA 3WGIA 1P2FA 2MD5A 2ZNZA 1F4KA 1XGSA 2VC0A 4LG0B 2EV0A 3DFGA 2XHKA 2PN6A 3LAPA 4RGRA 1PUEE 1XMKA 4ENKA 3MEXA 3JSOA 3VODA 3HTUA 1A04A 2XASA 1EH7A 1IXSB 5FD6A 2O3FA 4CGZA 1MGTA 2HTSA 3ISPA 3T8RA 1QQIA 2D1VA 1K79A 1KU2A 3IWFA 1JGSA 5DUKA 1FWZA 4UVCA 4EGYA 4HX8A 3V7CA 3CUQA 4BAYA 2P7VB 4WXCA 2DK5A 4HAMA 4LLLA 3FWEA 5FLXZ 5IT9Z 1HKQA 3RKYA 2IJLA 2VT3A 4FT8A 2MH2A 3L2CA 2JTVA 1LQ1A 3HSEA 1E2XA 5J6XA 2WTEA 3Q9SA 2Y75A 3LFKA 4IRGA 5DDGA 4XLPF 2J5PA 3RIRA 1O7LA 2K4BA 1F1ZA 3HRUA 3CTAA 1DUXC 3QP5A 2RGVA 1P4XA 1QBJA 1OYYA 5LHIA 1FZPB 4L18B 4I0AA 5E1WA 2M30A 3E97A 4OIOF 2HOEA 3L7WA 2GAUA 2GQQA 2TDXA 4H0EA 2CQKA 2IRFG 4MQVA 2XKPA 4HX4A 4KIGA 1I1GA 2KJCA 4HDUA 2V1DA 1W4MA 4LK1F 2LSOA 3RYPA 4XLNF 3E6DA 3DQVC 2YSRA 3GFJA 4KFCA 1SD6A 2FBHA 2K27A 4LB6B 3ZMVA 3C18A 4HF0A 3ZMUA 1IXRC 1UHWA 4A0YA 5K1YA 2P7CB 3SHFA 3KEQA 1P6RA 5DV5A 3E6BA 3BOQA 3L9FA 2NNNA 2MH9A 2O61A 3D0SA 1MDMB 1YW7A 1J9IA 4A6EA 2JPBA 3W6JB 2E1NA 2W57A 4A5NA 5JVTA 3FM3A 3WTYC 2XROA 3F72A 2PLYA 3F22A 1YO5C 2EJRA 4I02A 1W5SA 1FP2A 2Z9OA 2H09A 3ECHA 4GGGA 2ACJA 1ZG1A 1XSXA 4FX0A 3M8FA 3GWZA 3E3VA 2QVOA 1R36A 2ELHA 2W85A 1E17A 1ZAOA 5AIPA 1J75A 3ZMDA 3FMSA 3RPUA 4U7BA 1YIOA 3P9IA 4U88A 3IKTA 4AIJA 1S3JA 4I09A 4L9NA 4YFKF 2L4MA 4KNYA 3CUQC 1OR7A 4CYDA 2UXNA 1I6XA 5K5RA 3EQLF 2M87A 4WWCA 4ZYGA 3VEPA 3GF2A 3BY6A 5LHGA 5CVUA 2W25A 2WWYA 5FFXA 3K0LA 1TNSA 3SFZA 1RUOA 1BIAA 3IC7A 5HDNA 4OMYA 1QZZA 3E6MA 2GZWA 3DF8A 4DQ2A 3ECOA 1BJAA 3KP5A 1ULYA 4PGGA 3GZ6A 4CHUA 3HSFA 2RNJA 2W24A 3I53A 2V79A 1QO0D 4WCGA 2V6CA 1F5TA 1J2XA 1LJ9A 3EUHA 4HLYA 5ILUA 2KKOA 4M72A 5HVQC 1U5TA 1SFXA 3WGGA 2QBYB 3WTVC 2O6GE 3WTTC 2VE9A 1W7PA 1K6OA 1ODDA 4P9UA 5BOXA 4ENMA 5E8IA 2YU3A 4RB1A 5HS9A 2XKOA 3GFIA 2DO7A 2F5FA 1K78B 4P55A 3JAMK 4XSXF 1QPMA 4EVIA 1FT9A 3M8EA 3DEUA 1O3QA 1YTYA 1ZGAA 1USTA 4L9VA 5DD8A 3O3KA 1ZH5A 5F6FA 4G7ZF 2V1XA 2ZBKA 5H6RA 2YX4A 5ICFA 3WGHA 3K1NA 2BV6A 3B73A 4LLGF 1IF1A 4A6DA 3BP8A 1B9MA 1C0WA 4ON0A 2LKPA 3E5UA 4KDPA 1T0FA 1F9NA 1Z05A 3DP7A 1Z9CA 5D5VB 5FB2A 2X0LA 1R22A 2QQBA 2OQRA 4IHTA 1AWCA 2ETHA 2IP2A 3ZN0A 2D1HA 2ISZA 2VONA 3PQKA 4HQMA 1MKMA 4I7HA 1XSDA 4HYEA 1ZREA 2EA2A 2HKXA 3N97A 2XUBA 4YIIA 1R5HA 4CXFA 3M7GA 1ONVA 3MCZA 2LNBA 3V8JA 1JHHA 2P6SA 3KP3A 3O6BB 2Q8KA 4KMFA 2HYGD 4PDKA 4O5VA 1ZRCA 4RAYA 2FU4A 1KA8A 3CDHA 3BWGA 2G7UA 2FQ3A 2DAOA 1FBUA 1T2KA 1UCRA 3SQNA 1WI9A 2NYXA 1HW2A 4UNOA 2PMUA 4GXOA 2L3DA 4BXUA 1KYZA 4CO8A 1P4AA 1R1TA 2F5CA 4LFUA 5L3EA 2WC2A 3OOPA 2ZJ2A 3R6SA 1V3FA 3V7SA 2CSOA 3RJPA 3F8CA 2A3SA 1YFHA 1B6AA 1DPRA 3ZQ7A 2BBYA 1EH8A 4OOIA 2QQAA 4N9IA 3I59A 1G3YA 3KLOA 1XDSA 2XAGA 4IXAA 4L0ZB 2DPUA 3TGNA 4M6XA 2HQNA 4ESJA 1AOYA 3FMQA 5CLSA 3EDPA 2DFIA 2LF8A 3ERED 1R58A 2NAZA 5DEQA 1IN7A 3IWZA 2ZMEB 2IPQX 3IL2A 4UVBA 2HTJA 2XVCA 4MEYF 4M9SA 5AONA 4B09A 2P5LC 4I01A 2R7DA 1LEBA 5HDKA 5LGTA 3QU6A 3TO7A 2VE8A 1LDKB 4L9TA 1Q1HA 2D45A 1J59A 5KK1A 2OU2A 4U0YA 3EYYA 3FXUA 4CDGA 4WXHA 4G6QA 2LDUA 5AIQA 1U6GA 2CWEA 2PG4A 1R5GA 4RB2C 1FYMA 2DU9A 1CF7A 3IRRA 2FOKA 4RB3C 3VFZA 3GEZA 4M9XA 1ZRFA 5E8GA 1MJBA 5ICEA 1GXQA 4HA8A 2XGXA 3J80K 4RGUA 5CVIA 3BDDA 1XMAA 4E70A 5CVVA 3W6KB 1B4AA 2UXXA 1R1VA 5L3BA 5HLHA 4O3MA 5LEKA 2NS0A 3MQ0A 4KICA 5JFRA 4OINF 4LGWA 3I54A 5D5WB 5TRDA 4BQAA 1Z91A 3CUOA 3T5XA 1IN5A 3VOEA 4P5OA 3F21A 1BIBA 3F8MA 4KN4X 3KP6A 4KMUX 2FE3A 3WE2A 3BPVA 1XD7A 2DQRA 3FM5A 4K2EA 4OIRF 4OMZA 2RC4A 4A0ZA 3L00A 3KP7A 4LLNA 3V4GA 2IA0A 2KIMA 2KIUA 4ZZDA 3M9AA 2PBIA 2HQRA 2RKHA 3GUDA 3T8TA 1U78A 1KU7A 2XAHA 5D6FA 1FPQA 3J80Z 4Q5SF 1G3TA 3RPQA 1BI1A 1LNWA 2Z3YA 2YX7A 2EA4A 5FFZA 2CG4A 2ESNA 3JW4A 3KP4A 3OV8A 2JT1A 4MEXF 1UHMA 1B9NA 1BI2A 1R23A 3FZVA 3GFLA 1TBXA 4XRFA 4RS8A 3R0JA 3H3UA 2PFBA 1SMTA 1FSHA 3K1PA 1XSVA 4U0WA 5E1XA 1IAWA 3F8FA 3EETA 2V1UA 4HF1A 4UHTA 2DPDA 1TNTA 3QOPA 3HHHA 3K9TA 3T1BA 3J7AO 2QUFA 2ZKZA 1U8RA 1SMYF 3ZPLA 3NQOA 3JTGA 2HR3A 4G94A 1S29A 3HHGA 5ED4A 3ZMSA 1REPC 1IN4A 1ON2A 5HLGA 5JI6A 1R7JA 3KEOA 5EEGA 3SZTA 1ON1A 5EEHA 1LVAA 2VBYA 1MZBA 2EFOA 4I0BA 2EFNA 1TQIA 1OYWA 4IRIA 1ZLJA 2K7LA 3DPLC 5FGMA 2J5OA 1CGPA 3ML6A 1XGMA 5LHHA 2CYYA 3G3ZA 3RDIA 3GYHX 4MNUA 1SD7A 4JQFA 4ZYDA 1P92A 1U5TB 1KYWA 2QENA 1HSTA 3GVAA 1W7PB 1G4DA 5LRSA 2QWWA 2H94A 2BGCA 5L3DA 2P5KA 3KETA 4BHBA 3I58A 2M5WA 2VBZA 2MBFA 2A6HF 4M71A 4JBAA 3KFWX 1JXSA 2FNAA 4KYWA 1ZYRF 3LWFA 4OU0A 4HOBA 5H6QA 2UZKA 1HKSA 2KIFA 2FNPA 3I64A 1G3WA 3WTSC 5ILSA 4EV0A 3V7RA 2EWNA 3REOA 2H6CA 3IKVA 3E5QA 2Q2EA 5HOOA 1YYVA 4ENJA 3V8LA 2ZO4A 1KU3A 1Z7UA 3RI4A 4ZH4F 2KRFA 4HV6A 3ZMZA 5D8LB 2GA2A 3QU3A 2B0LA 1R00A 2MLGA 4Q4ZF 1O3TA 2DTRA 1KU9A 4WX9A 2O8XA 3JSPA 1JHFA 1T39A 1Y0UA 3WTUC 1QGPA 4U0VA 5D5XB 5ILVA 5ERIA 3U1DA 1MD0A 4RGXA 3V8KA 2FRHA 4RB0A 2E7XA 5H20A 3R0AA 1YW8A 4EM0B 1FY7A 1YS6A 2EFWA 4BHCA 4M73A 3F6OA 2PJPA 2L4AA 3G73A 3H92A 1Z6RA 5IT3A 2E1CA 3R60A 3CO6C 2EV6A 4ZYHA 4EJVA 3TKYA 1K7AA 2OZ6A 1USSA 2XAFA 3RYRA 1ZRDA 1FYKA 1BI3A 3H3ZA 1HW5A 3I59B 2Q0OA 2JSCA 3TOAA 4XSZF 3GLXA 2F5DA 3PFIA 4UXNA 1X3UA 3I4PA 2AS5F 1IN8A 1QZYA 1OMIA 4A5MA 5D4SA 4TV7A 1O57A 2RQPA 4RAZA 5D8KB 4AD9A 3HSRA 2P4WA 4EJOA 3FHZA 2ZCWA 3SXYA 1WWXA 2FEZA 3LAJA 3WTWC 4BYYA 3HTSB 4B8XA 2PMHA 4HLXA 5HLIA 1WKMA 2IA1A 3M1EA 3WU0A 1YS7A 2IT0A 2G9WA 6PAXA 2A5YB 4HW0A 4OIPF 2RN7A 3TO6A 4S04A 3WU1B 1FBQA 2VN2A 5DCMA 4UV8A 3KLNA 4AWXB 4XBFA 5K5QA 4ZYEA 4R79A 4U7DA 4L9JA 1B59A 2ZNYA 3R61A 1CF7B 1H9GA 5HS7A 2HGCA 5E17F 2G7HA 2M1BA 2UWMA 3GX4X 3VB2A 1LDJA 4PZJA 2DLLA 5CVRA 4EM2A 2JPCA 1PP8F 3BJ6A 1RIOH 4N9HA 2VBWA 3LA7A 5BS6A 1U2WA 3QPHA 1YLFA 5L3CA 2C6YA 1KQ8A 2CW0F 4G9YA 3NRVA 4KN7X 2OZUA 4BH9A 4EJTA 3MWMA 1HSJA 2JRTA 5CJ9A 4EMSA 1S6LA 4CZZA 3P9CA 3WTXC 3C3WA 3S2WA 1YG2A 4G7HF 4GO1A 2L02A 5L3FA 2FBKA 3BROA 3KP2A 2ZMEA 3CUQB 3LQQA 5E20A 2EK5A 4HV5A 2YR2A 2FSWA 3RKWA 1J0RA 1YW9A 2W84A 2O0YA 2DBBA 4KIFA 4KT5C 1D8KA 2STWA 1R1UA 2M45A 1T6SA 4L5IA 2M8EA 2DQLA 3HRMA 2DI3A 2IW5A 5JHUA 4AIKA 3O2PE 1TW2A 2AXLA 1D5VA 4GYGA 2NNYA 4CICA 4WXDA 1YQAA 1HXDA 1FNNA 3DPTA 2BE5F 3RKXA 1ZG3A 3C1DA 1HKTA 4AVPA 2V9VA 4KA4A 3MFKA 2GWRA 4LD5A 3GZ5A 1FP1D 3BJAA 4EGZA 4AIHA 1Z6TA 3TO9A 2ISYA 1TQPA 2Z33A 3CO7C 3LA2A 5J8FA 1W5TA 2STTA 3AAFA 2LF7A 3ROUA 2YPRA 4LK0F 4LG0A 2VOPA 5A2QK 4FX4A 2A6EF 2OAZA 4UV9A 2RVCA 2DT5A 4JK1X 4IHSA 1ZLKA 1SFEA 4EQQA 3DV8A 4NHJA 2K4JA 1BI0A 2IVMA 1OPCA 4Y13A 3WG9A 2XAQA 2BEOA 3BPXA 5LGNA 5LRRA 3CJNA 2HYFA 1J7KA 4O6JA 2P5VA 1MJAA 3F3XA 3KCCA 3Q9VA 1KGSA 4RGSA 4MGRA 4QLCU 2FMLA 3FXQA 5J8CA 4NQWA 2XV4S 4R1HA 2GA1A 1ZGJA 5FD5A 2HEOA 1D8JA 4ETSA 2FA5A 3BZ6A 3HRSA 5LGUA 1HW1A 5ICGA 3P9KA 1I5ZA 4MQ9F 1EH6A 1QNTA 2HKOA 2P8TA 3HOTA 5DCFA 1G6NA 1SAXA 1S8NA 1W7PD 3NEUA 2K86A 3F8NA 4HX7A 5TJJA 1L0OC 2QZ8A 2Y48A 4WK8F 5A2QZ 3E6CC 1BBYA 2QM3A 3MAJA 1S7OA 2EFQA 2VODA 4GYIA 3HRTA 5E18F 2GIVA 1LEAA 1VTNC 1WSUA 1IW7F 1UFMA 2F5EA 4IRHA 2PQ8A 1J5YA 3J81K 2HFHA 4ASNA 4Q48A 4A12A 4ESBA 5LLQA 4G6DA 1T98A 4PCQA 3HOSA 1TLHB 3F8BA 4HBLA 5HS8A 3MZYA 3DXJF 2RV8A 3ELKA 3LSTA 4N0BA 2RDPA 5L3GA 3B02A 4Q47A 1OKRA 1XCVA 5DUIA 1H0MA 1I27A 4MTEA 3TQNA 1O7FA 2A69F 3Q5FA 3HUGA 4IPAA 5F64A 1RI7A 5LEJA 4WF2A 1SD4A 4OIQF 1XGOA 4DNCA 1H9TA 2P6TA 3EYIA 3KZYA 3FXRA 1MDMA 3U9GA 3F6VA 2CFXA 1S7AA 1NHAA 2H6BA 1SD5A 2VT2A 2ZFWA 2PEXA 5HDGA 1U3EM 3J81Z 4Y17A 5CVJA 3ZN1A 4R8HA 5BPDA 3KE2A 1BOAA 1GVJA 2MLKA 2DK8A 3HYIA 2CGPA 3WE3A 4HF2A 2VOOA 4A2UA 3FF5A 1BC7C 2X4HA 2QQ9A 2XRNA 4KIBA 4M9ZA 2OA4A 3BJOA 5CYVA 4BHPA 1FSEA 2JZYA 2NRAC 1HBXG 4IJAA 1IUYA 3QRFF 2XAJA 3WTZA 3GO5A 3K1MA 4KUMA 3TDZC 1KQ9A 2FBIA 2OQGA 2EV5A 3C7JA 1RZ4A 2HS5A 2COMA 2EB7A 2KJBA 3GW2A 2CO5A 3IHUA 3WODF 1PDNC 3ABUA 2VXZA 2Y0MA 1GHCA 5DYMA 5LBQA 4HZFA 4P9FA 1ZN2A 1OYIA 4QWQA 1RUNA 1ZG5A 2ADUA 3TDUC 3LQRA 3F23A 4EJWA 3R4KA 3ULQB 3QAHA 4HDVA 4M74A 1IXCA 4PGHA 1TQMA 1ZHFA 4LMYA 2WV0A 5E1ZB 3ZP5A 1P4WA 1MJ9A 4ESFA 4F7ZA 4UUVA 3T0YA 2ZXJA 2PI0A 1SFUA 1D3YA 2HZTA 5FO5A 2BYVE 2FF4A 2QBYA 2FMYA 2A61A 1EV7A 2FXAA 1V4RA 1O3RA 1I1SA 4IF4A 2IA2A 3JTHA 3GXOA 4YFNF 1DPUA 1XGNA 4P96A 1HQCA 3DKWA 3P7NA 1IRGA 3I5UA 1K78A 2Z99A 4LJZF 2MA3A 5D6EA 3KZZA 1T38A 4A0XA 1TW3A 4MTDA 2L54A 5K5OA 5D4RA 3LA3A 5JR3A 4BNCA 4L0YB 2R3SA 5BQTA 4EM1A 2OD5A 4D0PA 4YG2F 1KQ0A 2GXBA 4ZZLA 1LDDA 1TTYA 2L01A 1B1BA 1L3LA 1G3SA 1IN6A 1UB9A 2GXGA 5DCMB 3JAMZ 5BPIA 2H27A 2QLZA 4FHTA 3PQJA 1FYLA 4GCVA 4I2OA 5KVRA 1Z1DA 3ZMTA 1DP7P 2HWVA 3QPTA 3IRQA 4G8XA 2K02A 1DDNA 5D5UB 1FBSA 5F1RA 1RNLA 3L09A 1O3SA 1IRFA 2EFPA