4ZYGA

Crystal structure of methylated sulfolobus solfataricus o6-methylguanine methyltransferase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
150
Chain Sequence
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 44
structure length 150
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zygA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zygA01
4HA8A 3K1MA 2XIGA 1P4AA 1W7PA 1SD7A 1HW2A 1OKRA 2CGPA 1QGPA 2IT0A 2RDPA 1ZHFA 1MZBA 3R0AA 5F64A 1LDJA 5K5OA 4UV8A 1IRGA 3T5XA 3GEZA 3EETA 1XGNA 2YR2A 2EWNA 4WX9A 1LJ9A 1TQPA 4L9NA 5FFXA 1KQ0A 4WXDA 3GF2A 5K5QA 1L0OC 4BHPA 2PI0A 1S6LA 3C1DA 4ETSA 4AIKA 3E5UA 3F8FA 3WTXC 2VC1A 3QU6A 5FGMA 3GX4X 1LEAA 2XAQA 2MLKA 2DFIA 2OA4A 3RKXA 4CZZA 4I09A 2JPCA 2H6BA 3FXQA 4CXFA 2XKPA 2HKXA 2LDUA 4QLCU 4R8HA 4HX4A 2E1CA 4PCQA 1F5TA 1G4DA 2D2WA 5TJJA 2HFHA 2CG4A 4MTDA 3NRVA 1P4WA 5L3FA 5LGTA 4FT8A 1PUEE 5D5VB 5DDGA 2O0YA 1TBXA 3ERED 4DQ2A 1KYWA 2BYVE 1J7KA 2K4BA 3GFIA 3P9IA 2LNBA 2BGCA 4EGYA 4IHSA 1DDNA 1JXSA 4YFKF 3F6OA 4HLXA 4BHCA 4ZZLA 3HOSA 2VBYA 2P7CB 4A5MA 4KIFA 1BN5A 2EV6A 4LLNA 2DW4A 2F2EA 3FMQA 4U0YA 5J8CA 2XRNA 1ZG5A 1ZG1A 3WGHA 4UXNA 1MDMA 4G9YA 5HVQC 3WTSC 2UWMA 1YG2A 2M45A 3CTAA 2ZFWA 3JAMZ 1FNNA 2KRFA 1HSJA 1Z1DA 4NQWA 4XLPF 4OIOF 2VC0A 3E6MA 4KICA 1ZGJA 1STZA 3TKYA 1FYLA 5IT9Z 2QZ8A 3LAPA 1IF1A 1B9NA 2QVOA 5ILUA 3ROUA 1ZGAA 1R23A 1TQIA 1ONVA 3RDIA 1ON2A 5ILVA 4LFUA 2OBPA 1TQMA 2LKPA 4LMYA 2L4AA 1QQIA 4LD5A 3R60A 2DO7A 3EUHA 1YFHA 1FLIA 5L3EA 3F22A 1YW8A 2NS0A 1K78A 4WCGA 4LGWA 2LSOA 2XVCA 2QWWA 3ELKA 4A5NA 1KU3A 1D8KA 4A0XA 4U0WA 3D5LA 4B8XA 2YPRA 4CICA 2XGXA 1XGOA 2JPBA 2V1XA 4I0AA 2M1BA 3BPVA 4PGHA 3ECOA 3F8CA 2DPDA 3C3WA 3MFKA 1MKMA 2KIFA 3WE3A 4G94A 1HSTA 3BWGA 2Q8KA 2IJLA 1UHWA 5D8LB 1O57A 2FSWA 2COMA 3MEXA 4P9FA 3NEUA 3QAHA 5CVVA 4RGSA 4ON0A 1TNSA 3HYIA 3EYYA 2L3DA 1ZLKA 2WC2A 3DP7A 3L2CA 4L5JA 5AIPA 2DT5A 4EJVA 1XSXA 1T98A 3R0JA 3QOPA 4A6DA 3HRSA 4M9ZA 3LSTA 2XROA 3TO6A 1H9GA 3BJAA 4CGZA 4HW0A 2GIVA 1JHFA 5HS9A 1UFMA 4BXUA 1T6SA 1B59A 2ZXJA 3FF5A 1QNTA 1LDDA 4KFCA 5LHIA 4OMYA 2DU9A 2HKOA 4ZYEA 2G7HA 1WRJA 1YLFA 1IN4A 3WE2A 4WK8F 2ZNYA 1IXRC 4Q47A 1FY7A 4JK1X 4PDKA 4Z2YA 3VB2A 3RI4A 1T38A 1BIBA 3KP5A 4HF0A 3LQRA 4YFNF 2HZTA 4HDVA 3B02A 1D3YA 3V7CA 1SAXA 5DYMA 1U8RA 4HOBA 1FSHA 3M8EA 3EYIA 4WXHA 4P5OA 2VN2A 1XSVA 5D8KB 4I01A 3WODF 2ZKZA 2DPUA 1U5TA 2A3SA 2XAFA 1BJAA 2C6YA 2GAUA 1IAWA 2JRTA 3IRQA 4KMUX 4UV9A 2QQAA 3WGGA 2F5CA 2MH2A 1EH7A 1ZH5A 3U9GA 5JVTA 3ZPLA 2PMHA 4WF2A 2VBZA 2L4MA 2EB7A 3K1NA 3SZPA 2CFXA 2F5EA 3BOQA 3SXYA 5HDGA 3I58A 4ESFA 3WTZA 5LRRA 3CUQC 2M5WA 2ESNA 5HLIA 4OU0A 3I4PA 1BC7C 3HRMA 1PP8F 2CYYA 4HV6A 1R1VA 5DCMA 5L3BA 6PAXA 1Y0UA 3KP6A 1R5HA 2OU2A 2UZKA 4A0ZA 2XAGA 3ZN0A 4AVPA 3V8JA 1S7OA 2FNPA 4RB1A 4KN7X 2VOOA 4RGRA 2D1HA 2DK8A 2QM3A 1KA8A 5DCMB 4R1HA 1HW5A 4LLLA 4BQAA 1HBXG 4I98B 4YIIA 2E1NA 3F72A 1PDNC 3PQJA 3DPTA 3FWEA 4WXCA 1AOYA 2K86A 1XGSA 4EJOA 1Z05A 1LEBA 3GW2A 2Q2EA 5DV5A 4HZFA 4IRGA 5E1ZB 5CYVA 1RNLA 3P9CA 2BV6A 4L5IA 2STWA 1V4RA 5CVUA 3EDPA 4MNUA 2HOEA 5E18F 1CF7A 3O3KA 2PEXA 3ZQ7A 3BDDA 1TNTA 5HLGA 4Q4ZF 2KIUA 4P55A 1IN6A 4A12A 2FNAA 5LEKA 1U5TB 3IRRA 1Z9CA 3DXJF 1F1ZA 4RB3C 1XDSA 3BPXA 4ENMA 2ADUA 2HQNA 1XGMA 2FBIA 2DQRA 2HQRA 3CDHA 4EVIA 4EMSA 1OYWA 3F8MA 1GXQA 1MDMB 4F7ZA 2P7VB 4HAMA 1O7LA 4XBFA 3JSOA 4MEYF 4AD9A 3FMSA 4BNCA 3FMRA 4EM1A 2DAOA 3K69A 1W7PD 1OR7A 1Z6TA 4U7DA 3IWZA 2O61A 1XSDA 3E97A 3GFMA 5D6FA 1O7FA 3BJOA 4M9SA 1KQ8A 1W5SA 2V1UA 2VE8A 1WI9A 1I6XA 2HYGD 3SZTA 4Y13A 3HTUA 1QZZA 2K4JA 2OQRA 2OZ6A 2KIMA 1AWCA 4Q48A 3RYRA 1SMYF 1FBSA 1SD6A 4DNCA 2RQPA 3P9KA 4XSXF 4AIHA 1YW9A 5HLHA 4O6JA 1JHHA 5JHUA 1IXCA 4HQMA 5FD6A 4M73A 5HOOA 1B6AA 3DV8A 2P5KA 2ZO4A 3SHFA 2K02A 1SD4A 1FYMA 3CUQB 3KP4A 3O2PE 1O3TA 3ZMZA 1FZPB 1G3SA 2MC3A 2EV0A 3FM5A 4ASNA 4G8XA 4R79A 4OMZA 1P6RA 1U2WA 3E6DA 2FOKA 5K5RA 1WKMA 1S3JA 1XB4A 4PZJA 5E1XA 1L3LA 3HTSB 1MD0A 3CUOA 1MJAA 4FX0A 4YIFA 1U78A 3M9AA 2XAJA 4BYYA 5H6QA 1WSUA 3WU1B 1QZYA 3SFZA 5FD5A 3IKVA 3TGNA 1KGSA 5BS6A 1XDUA 2WV0A 4HYEA 4KUMA 2EFQA 2QQBA 3HRUA 2QENA 3DF8A 5ED4A 2NRAC 1X3UA 1IN8A 2CW0F 1FBUA 2A6HF 3DKWA 2QBYB 2A6EF 2IRFG 1U3EM 3NQOA 2EFPA 3PFIA 4B09A 2J5OA 1TW3A 3CUQA 3H92A 4FHTA 4PGGA 4U7BA 2FEZA 2ACJA 3LQQA 1J2XA 1DPRA 3H3UA 5H6RA 4EM2A 2P5LC 1FP1D 1HKSA 1ZRCA 2ISYA 1I5ZA 2A61A 3ZMSA 5AONA 5KVRA 1Z91A 3E5QA 3ZP5A 3ZMUA 2MBFA 4OIQF 2G7UA 5CVIA 4UVAA 2VE9A 3GO5A 4EQQA 4O5VA 1J75A 2YU3A 3P7NA 3FXUA 1IXSB 3L9FA 4L9TA 3TOAA 3V7SA 3HSEA 2GQQA 3S2WA 2QBYA 2PBIA 3FX3A 4HBLA 2EJRA 4XRFA 3WTYC 2B0LA 1BI2A 2MD5A 1LVAA 1IRFA 2RGVA 3HHGA 4XSZF 1R58A 3ABUA 3I5UA 1UB9A 2ETHA 2L54A 3FHZA 3KLNA 2H27A 1U6GA 2A69F 2QYOA 4MQ9F 5D5XB 3F6VA 4GGGA 1ZRDA 5TRDA 2BE5F 2KKOA 3CLOA 1FP2A 3GWZA 1I1SA 1NHAA 3N4MA 1RI7A 3RKYA 4ESBA 1REPC 1W4MA 2EK5A 4LJZF 2ZCWA 4CHUA 2FBHA 2J5PA 5BOXA 2V9VA 3LWFA 3IKTA 1Z6RA 2PN6A 5K1YA 4A2UA 1BC8C 1SMTA 1LNWA 3ISPA 2K27A 3W6KB 2YX4A 2WTEA 3VOEA 3TQNA 1LQ1A 3BZ6A 3JAMK 4FX4A 3TO9A 2JZYA 3JTHA 1IUYA 2W24A 1FYKA 5FFZA 2VT2A 1P4XA 1BOAA 2JT1A 4RS8A 4Y17A 3QRFF 3OV8A 4M74A 5JR3A 2VBWA 3C18A 1HXDA 3RYPA 4KT5C 1I1GA 2MH9A 5BMZA 3J81Z 4LG0B 2NAZA 2MA3A 2RVCA 3GLXA 1YW7A 1R22A 1O3QA 3KP3A 3TDUC 1K79A 2FQ3A 2VODA 4CYDA 1V3FA 3H3ZA 1QO0D 2W85A 3I64A 4HDUA 3HSRA 2EFWA 2IA1A 2W25A 4G6QA 2V6CA 1SFUA 4M6YA 2DLLA 3WU0A 2V1DA 1W5TA 1BI1A 2UXXA 1UHMA 2XUBA 1TLHB 4AIJA 3D0SA 5HDKA 3GXOA 3K0LA 2OZUA 1IN5A 2YSRA 3F8NA 1J5YA 1OMIA 3QP5A 5J6XA 1R36A 2FU4A 2GXBA 3R4KA 2A68F 2DBBA 4YG2F 2CWEA 1HKTA 4LK1F 4EV0A 2HWVA 4IXAA 5FB2A 5ICGA 1U5TC 5KK1A 5F6FA 5CLSA 3J80K 2A07F 2VBXA 4ZYGA 2M8EA 1BI3A 3Q9SA 1G3WA 5LHGA 1USTA 3WTUC 1ZYRF 1BIAA 2A5YB 4U0VA 1YQAA 5LRSA 1B1BA 2R7FA 3MAJA 2ISZA 3MCZA 5E17F 3JSPA 4M6XA 1FPQA 1MJBA 3KCCA 2P4WA 3KETA 2PFBA 5LHHA 3V8KA 4GCVA 4EJWA 2HTSA 4EJTA 4KIGA 3ULQB 2ZNZA 2AS5F 1OYYA 3Q9VA 3MQ0A 2NNNA 4RGXA 2VOPA 1P2FA 3RPUA 1JE8A 2R7DA 3QPTA 4IRHA 1T2KA 4IVNA 3RPQA 4KDPA 2STTA 2D45A 2L01A 5JI6A 3QP6A 1FOKA 2HDCA 5E8GA 4UVCA 4MEXF 4BHBA 2K7LA 2XAHA 2Q0OA 3JW4A 1KYZA 4MHGA 3KP7A 4RAZA 4JQFA 4MGRA 1YS7A 5ICEA 3GVAA 3E6CC 4G7HF 2GZWA 2H94A 3B73A 2WWYA 4JBAA 5E8IA 4OOIA 4M9XA 5AIQA 4L9JA 2O03A 4RGUA 5LGUA 1XMKA 4S05A 4RAYA 1VTNC 3BJ6A 1DP7P 2ZJ2A 3T0YA 2MLGA 3TDZC 5DD8A 2FF4A 3WTVC 5HDNA 2P5VA 5BPIA 3GZ6A 4UNOA 4TV7A 4CDGA 5A2QK 3F3XA 3E3VA 2O6GE 2O3FA 1FBQA 1ZN2A 2Z5UA 2Y75A 5LEJA 3M8FA 2FMLA 3CO6C 4L18B 3WGIA 4OIPF 1F4KA 3RIRA 3K9TA 3N97A 1FT9A 3GUDA 1XMAA 5IT3A 5ILSA 3W6JB 2GA1A 2X4HA 2FXAA 2W84A 4UVBA 1H9TA 3R61A 2OAZA 3J81K 2M30A 5CJ9A 2H6CA 1YIOA 1YS6A 1O3SA 4N0BA 5DD4A 2HYFA 2DQLA 5D4SA 3DQVC 1FSEA 4KYWA 3M7GA 4P9UA 1ZAOA 3GFLA 2ZBKA 1T0FA 2IW5A 5CVRA 2HR3A 1A04A 3FM3A 4LB6B 1D8JA 2M87A 3MWMA 1SFEA 2PMUA 3FXRA 5ICFA 3I54A 1E2XA 3FZVA 4RB2C 1TTYA 5DUIA 3K1PA 2IA2A 1RUNA 2R3SA 1XD7A 2IVMA 1S29A 1R5GA 3IL2A 2HEOA 2PLYA 2Z9OA 3QU3A 3U2RA 3L09A 3BP8A 3K2ZA 4ENJA 2E7XA 2VT3A 2Y48A 1QBJA 5J8FA 3R6SA 3CO7C 4ENKA 1KU2A 1H0MA 1ZREA 4M72A 5D4RA 1YYVA 3KZZA 1R1UA 2IP2A 1K7AA 1DUXC 3RKWA 1HQCA 2RV8A 1ZG3A 3G73A 5D6EA 2EV5A 3HOTA 5FO5A 1GVJA 4KMFA 1FX7A 5DCFA 5LLQA 1J9IA 4I02A 2QQ9A 3U1DA 1XN7A 5L3GA 2PG4A 2VONA 3KEOA 2AXLA 3KFWX 5HS7A 2PJPA 2LF7A 1BBYA 1P92A 3ZN1A 2IA0A 4GYIA 3LA3A 1JGSA 2FE3A 4WWCA 1ZLJA 2QUFA 1FWZA 4D0PA 3LFKA 1W7PB 3GZ5A 1LB2A 4IHTA 2P6TA 3QPHA 2GWRA 3O6BB 4HV5A 3KE2A 1J0RA 1G6NA 2Z33A 3JTGA 3ECHA 3CJNA 4RB0A 1GHCA 1WWXA 4HX7A 1O3RA 2ZMEB 4G7ZF 3REOA 1MGTA 2H09A 2ELHA 3LA7A 4ZH4F 1CF7B 3VODA 4GYGA 4YFXF 4ENNA 2ZMEA 4I0BA 4KN4X 4L9VA 2CO5A 2FMYA 1RZ4A 3V7RA 2FRHA 5DUKA 4P96A 3J7AO 4BAYA 1R00A 3KEQA 3F21A 1BI0A 4BH9A 1BM9A 1C0WA 4U88A 3KZYA 4O3MA 4AWXB 5L3CA 4GO1A 2RC4A 2D1VA 2FA5A 3GFJA 5HS8A 2EFNA 3BY6A 4GXOA 1HW1A 5EEGA 1OYIA 1E17A 4K2EA 1XCBA 4OIRF 2EA2A 2BEOA 3T1BA 4ZZDA 1S7AA 2KJCA 4A0YA 3ML6A 5IT9K 4HF1A 5FLXK 1KU9A 1WQ2A 1EH8A 3GYHX 4G7OF 1ZRFA 4M71A 2RNJA 2RKHA 4UUVA 5E20A 2TDXA 4HQEA 3KLOA 2CQKA 2DI3A 1IN7A 1ON1A 2JSCA 3C7JA 4EM0B 3WG9A 5LBQA 2JTVA 2QLZA 1K6OA 4IPAA 2P8TA 2HTJA 3BROA 1K78B 3HUGA 1EH6A 5E1WA 3COAC 2UXNA 4XLNF 4IJAA 3MZYA 4NB5A 3SQNA 3L00A 2GXGA 4NHJA 2PQ8A 2VXZA 2V79A 3V4GA 4S04A 2EA4A 1R1TA 2DK5A 4L0ZB 3ZMVA 3DEUA 4OINF 4CO8A 1D5VA 4Y15A 5ERIA 5A2QZ 1ZARA 5EEHA 1J59A 1G3TA 4MQVA 2OD5A 1B9MA 2L02A 3E6BA 1YO5C 3HSFA 1USSA 3I59A 4H0EA 3G3ZA 4IF4A 2OQGA 1SD5A 1PP7U 1XCVA 3T8RA 4N9HA 5JFRA 1IZ1A 2E7WA 3KP2A 3VEPA 2LF8A 4LB5A 1I27A 3RJPA 3HRTA 3IC7A 2GA2A 4A6EA 5FLXZ 4KA4A 4KIBA 1FC3A 2O8XA 2W57A 4KNYA 3E5XA 1LDKB 1Z7UA 2EFOA 2FBKA 5ICCA 2HS5A 4LLGF 5H20A 4UHTA 3VFZA 5LGNA 4E70A 2KJBA 1RUOA 3J80Z 3IWFA 4IRIA 2F5FA 3TO7A 1B4AA 4HF2A 3EQLF 2CSOA 4Q5SF 2RN7A 4G6DA 4ZYDA 1SFXA 1DPUA 2XHKA 4EGZA 4MTEA 2Y0MA 1GXPA 4HX8A 2G9WA 3T8TA 4N9IA 3DPLC 3OOPA 1TW2A 3I71A 4ESJA 1CGPA 2YX7A 5L3DA 1OPCA 3PQKA 2XV4S 2XASA 1RIOH 3HHHA 3ZMTA 1G3YA 4EJUA 5D5UB 3M1EA 1EV7A 3L7WA 5F1RA 2F5DA 1T39A 3LA2A 3AAFA 2NYXA 4I2OA 1IW7F 4LG0A 4L0YB 2XKOA 1R7JA 1YTYA 2Z3YA 2X0LA 3MZHA 3RTRA 5CVJA 3LAJA 3V8LA 1KQ9A 3F8BA 3I0TA 2Z99A 2IPQX 3WTTC 3HIFA 4HLYA 3ZMDA 1ODDA 1Q1HA 5BQTA 2P6SA 4I7HA 2NNYA 3F23A 2DTRA 3I59B 5BPDA 4ZYHA 2ESHA 1ULYA 1KU7A 1F9NA 1HKQA 3TOBA 3WTWC 3DFGA 1UCRA 4QWQA 1S8NA 2HGCA 3Q5FA 1MJ9A 2BBYA 5DEQA 4LK0F 1QPMA 3IHUA 3I53A 5D5WB 3ABTA
chains in the Genus database with same CATH superfamily
5B5EC 1NEIA 4HA8A 2UV1A 1BBGA 4BC9A 2W4SA 3K1MA 4XICA 2XIGA 4NNJA 1P4AA 1W7PA 4WSGA 2DOEA 1SD7A 1HW2A 1OKRA 4A3FJ 3A02A 2EPXA 2CGPA 1H88C 2V83A 3GTKJ 1QGPA 2IT0A 2RDPA 1X4PA 1ZHFA 1MMAA 3ZRGA 1APLC 2EQRA 1KJKA 1MZBA 2X48A 1VNDA 3R0AA 1RR8C 2M9AA 5F64A 2HI3A 4O43A 2XSDC 1LDJA 2CS3A 2W48A 1SANA 4UV8A 5K5OA 1IRGA 3J7AG 4DV0E 3T5XA 3GEZA 3EETA 1X19A 3I4NJ 1XGNA 2YR2A 2EWNA 1YJ9I 4CCMA 4WX9A 1LJ9A 3S2HJ 1TQPA 2JVHA 4L9NA 1KQ0A 4WXDA 5FFXA 2R5ZA 3GF2A 5K5QA 2EJ4A 1WHUA 1MBGA 1L0OC 2CQXA 1V5GA 2LJUA 4BHPA 1XMXA 3OL4A 2PI0A 3JR9A 1S6LA 2QCOA 3C1DA 2R7RA 1N78A 1T4NA 4FK5C 4ETSA 4AIKA 3PNVA 3BCBA 3E5UA 3F8FA 3WTXC 1VQ9I 3TP0A 1N25A 2VC1A 4C3HJ 5DNYA 3QU6A 5FGMA 2N3GA 4CSWA 2LFBA 4R8OA 3CDLA 3DKYA 3GX4X 4NZVA 2IAIA 3GCMA 1LEAA 2XAQA 1RQ0A 2MLKA 2F48A 2DFIA 2OA4A 2EM5A 1AKHB 5IOZA 5F0HA 2Y30A 4XKWA 4B4CA 3RKXA 5A6KA 4CZZA 3NARA 4I09A 2JPCA 2EOHA 2H6BA 4RH8A 2NABA 1OR7C 1Y8RB 2BHYA 1PDAA 5DS9A 2VPLA 3FXQA 4CXFA 1N77A 4EEFG 2XKPA 2HKXA 2LDUA 2CV0A 1I6HJ 3VYXA 3S15J 1AA7A 4QLCU 4R8HA 4NC7A 4HX4A 3G4SI 2E1CA 2K5CA 1SC7A 3LSHA 4PCQA 3OS1A 2EM3A 4LF5E 3ADLA 1NCSA 2LTRA 1LKXA 2VJIA 3THNA 2XB0X 1F5TA 1RRJA 1QA6A 1G4DA 2HYJA 3QYFA 2D2WA 5TJJA 4OAZA 2BW3A 3CQZJ 2HFHA 5K7ZA 2CG4A 4MTDA 3CP2A 1P47A 2V4JC 2LVSA 2NOJB 3VK6A 3NRVA 3VYSB 2EOMA 1P4WA 2X51A 2IGOA 3AG3H 3OYAA 1IC8A 2CPNA 5L3FA 1ZBTA 4V2GA 4LITA 4F92B 5LGTA 4FT8A 4IHYA 4RLFA 4D7NA 1PUEE 1QZEA 2FOWA 5D5VB 4F6MA 3ZXSA 3FXKA 2ZSHB 5DDGA 1JK2A 2LOOA 2LTSA 2O0YA 1TBXA 3ERED 3S32A 4DQ2A 1KYWA 1UILA 2BYVE 2VJJA 1J7KA 2K4BA 1EA3A 4BUPA 4QIWN 2EH3A 3GFIA 4LF6E 3P9IA 3H09A 2LNBA 2BGCA 4EGYA 4ZC3A 4IHSA 2F8BA 1K4SA 3HEFA 3C6KA 3ABMH 5E3NA 2EL5A 1W36C 1PVEA 1J26A 1BR1A 1P9QC 3K2AA 4YFKF 3F6OA 1DDNA 1JXSA 2EN7A 3THOB 4HLXA 4BHCA 4NC6A 2YTFA 4ZZLA 2VJ5A 3HOSA 1MW7A 2VBYA 2P7CB 4A5MA 3M3YJ 4KIFA 1GUUA 1BN5A 1R6RA 2EV6A 4B3XA 2A6TA 3VPRA 4LLNA 3A2KA 2DW4A 2EN8A 4IJDA 3BG9A 2LRSA 2F2EA 3FMQA 2R5YA 3A03A 4MLVA 2PRTA 4M2ZA 3BLYA 4U0YA 5J8CA 2R0QC 2NVTJ 4DR7E 4BQQA 2XRNA 1ZG5A 3BGHA 1ZG1A 2EOYA 3WGHA 4UXNA 5M3MJ 5KL2A 1A1FA 1MDMA 3HOUJ 4G9YA 5CKTA 4BDYA 3CCJI 4WYQB 3RZOJ 5HVQC 3WTSC 3N05A 3OYJA 4L8NA 2UWMA 2X1DA 1YG2A 1XTAA 2ZXWH 1VQLI 2M45A 2HXIA 3CTAA 2ZFWA 3JAMZ 5KAFC 2JXPA 2VKHA 1FNNA 5TGTA 2KRFA 1HSJA 1Z1DA 4NQWA 2EQ3A 4XLPF 1X2MA 2ZMEC 4PSXA 3E6MA 2VC0A 3DLAA 3HGYA 4JX6A 4KICA 4OIOF 1ZGJA 5K7HA 5IYBJ 1YYOA 2LG4A 3JRCA 1STZA 3TKYA 1FYLA 5IT9Z 2FV4B 2EIKH 2L2MA 2LTPA 2QZ8A 3LAPA 2F6CA 3D5RC 4HNTA 1IF1A 1B9NA 2QVOA 3IWBA 5ILUA 2RPCA 3WHBA 2NUGA 3ROUA 1ZGAA 4A93J 1R23A 4IKFA 2EL6A 5DM7F 3HKZN 1TQIA 4XLCA 3JRHA 1YITI 1T0FC 3NWTA 4HSRA 4C3JJ 1ONVA 2A5WA 3RDIA 1ON2A 2EZKA 4XOPA 5ILVA 4LFUA 2OBPA 1TQMA 2MYSA 2LKPA 4I99C 4LMYA 2L4AA 1IUFA 1QQIA 2KLOA 3TP3A 4LD5A 3R60A 2DO7A 3EUHA 1YFHA 1FLIA 2EORA 2HGHA 5L3EA 3F22A 1YW8A 3Q0VA 2NS0A 1K78A 3K10A 3KIOA 4HRIA 3S1MJ 4LF9E 4WCGA 2V89A 4LGWA 4AYBN 2LSOA 3ZOBA 1IDYA 2XVCA 5C3EJ 1OCRH 2QWWA 3ELKA 4A5NA 1KU3A 2CQNA 1IJWC 1D8KA 3CC7I 5EJCA 2CSHA 5M5WJ 3LSIA 4A0XA 5JVGF 4U0WA 1P7JA 3D5LA 4B8XA 4HEA2 2YPRA 1PJTA 4CICA 2FUG2 3MKZA 2XGXA 1XGOA 2JPBA 2V1XA 2DN0A 1ETKA 4I0AA 2M1BA 3BPVA 5LL6R 2VIXA 2X6XA 1R9TJ 4PGHA 3AG2H 2YTDA 3ECOA 1X48A 2A05A 1JGGA 1HNWE 3H0GJ 2WBUA 3F8CA 1ETOA 3QOEA 2KMUA 4BEHB 2DPDA 4X0GA 2EOJA 3C3WA 2DA3A 3MFKA 1MKMA 4DW6A 2KIFA 2YTJA 1TT5B 1RC7A 3WE3A 5IPAA 1V55H 5FRMA 4G94A 4B3SE 1HSTA 3ERMA 4UUSA 1ETWA 3BWGA 4RM2A 2Q8KA 2L3CA 4F3QA 4PFPA 2IJLA 1UHWA 3QODA 5D8LB 1O57A 1WJPA 4LIVA 4RDUA 3CC2I 1OCZH 1JK1A 1FIPA 3CCRI 3KYDB 3BF2A 5F3WA 3H9QA 2PJRA 2L33A 2ME0A 4JV5E 2FSWA 2ENHA 5F27A 1NH3A 2COMA 3MEXA 2HDWA 4P9FA 3NEUA 1BJZA 3QAHA 5CVVA 4D7MA 2LMZA 4RGSA 4ON0A 5LFAA 2QEXI 1TNSA 4N4NB 3G2BA 1GZ6A 1BOBA 4DUYE 3HYIA 3EYYA 2L3DA 3ADJA 5FRNA 3ZQHA 1ZLKA 2WC2A 1UMQA 1MBHA 3DP7A 3SFIA 3L2CA 4L5JA 2B63J 3EPHA 5AIPA 1AAYA 2DT5A 4EJVA 1YX3A 5FKMA 1XSXA 1K61A 1WJAA 1T98A 2X85A 2Y0SN 3R0JA 4XKCA 2MDGA 2M0MA 3QOPA 4A6DA 3L2QA 2EM4A 3HRSA 4M9ZA 2WV1A 3LSTA 2Y31A 1HF0A 5FJ8J 2XROA 4XLAA 3K70D 3TO6A 1H9GA 3SJMA 2GM4A 1A5JA 3BJAA 2VQCA 3U1KA 4NC8A 4BJ6C 3CCLI 4CGZA 4HW0A 4M3BA 3LLHA 2GIVA 1JHFA 4A3LJ 5HS9A 1DGRM 1UFMA 4YRVA 4BXUA 2COBA 1T6SA 5J3LA 3K4MA 4UB8C 1B59A 3VDXA 3CCSI 2ZXJA 1TWHJ 4DUZE 2V9PA 3FF5A 1B8IA 2CTDA 3HZJA 1QNTA 2DXIA 1LDDA 4KFCA 5LHIA 2XPVA 4OMYA 2DU9A 2HKOA 2LD5A 3HQ1A 4ZYEA 2YTPA 2G7HA 1WZ2A 4CCOA 4AQYE 1WRJA 4J01A 3ZQIA 3SYTA 3OYEA 2QSFX 3A1YA 1OCPA 1YLFA 1DU6A 1IN4A 3WE2A 2FTXB 4Q28A 3I55I 1WH7A 4WK8F 2ZNYA 2NVQJ 2EOXA 1IXRC 3CCVI 1Y1VJ 4Q47A 4F9CB 1FY7A 3OTOE 1YSAC 4JK1X 2MGQA 1FOYA 1POGA 4PDKA 2BY0A 2FD5A 4Z2YA 3VB2A 3RI4A 5IV8B 4MLOA 1T38A 2BY2A 2WBSA 2K3FA 1BIBA 2KDZA 4NXNE 5A6AA 3KP5A 2LJHA 4HF0A 3LQRA 4YFNF 2EMLA 2HZTA 4MFEA 4HDVA 3B02A 4W97A 2W1OA 1D3YA 3V7CA 1SAXA 5DYMA 3PIOF 3JREA 1U8RA 1RETA 4HOBA 1FSHA 2DA1A 3M8EA 3IAS2 3EYIA 4WXHA 2RS7A 2N3HA 3H9GA 1HLVA 2TCTA 4P5OA 4JYAE 2OJED 1TZLA 3BZKA 3BT9A 2K4VA 2VN2A 5C4JJ 1XSVA 3PNTA 3VHTB 4M3FA 5D8KB 3S3OA 1BL0A 4E7JA 3P1XA 2KQRA 4I01A 5FLXC 2LR8A 3C2GA 3WODF 5CPRB 2ZKZA 4AVZA 2DPUA 5E3OA 1U5TA 1GQEA 2EMFA 2A3SA 3WU2C 2GOMA 2XAFA 1BJAA 2C6YA 3GTGJ 2GAUA 1IAWA 4R03A 4F6NA 2KP6A 2XGCA 5HNFA 2JRTA 3IRQA 2NA2A 1YIJI 2UXCE 2QF7A 2EN3A 1IQSA 2Z16A 4KMUX 2DDBA 1YYKA 4JI5E 1TWAJ 1U9NA 2WADA 4UV9A 2QQAA 3WGGA 1EF4A 2DRPA 2ZFUA 3CD6I 5GPAA 4W1UA 3GBGA 2F5CA 4KWYA 2MH2A 1EH7A 1ZH5A 4B48A 3U9GA 2CQQA 5IP7J 1X1DA 2E34A 5AE2A 5JVTA 3ZPLA 1GV5A 2ZJQF 3EUKL 2MG4A 2PMHA 3RQIA 1VZ0A 3CMAI 3CZ6A 1SVOA 2VBZA 4WF2A 2L4MA 4XK4A 2EB7A 3FISA 4JP0A 2CFXA 2F5EA 3K1NA 3SZPA 4LFAE 3BOQA 1UHSA 3BIDA 2KPMA 3SXYA 2EM7A 5HDGA 3I58A 2EQ0A 3PFYA 4ESFA 2EPLX 3WTZA 1UJ8A 2OPTA 5LRRA 4BL0B 2KZGA 4DZPA 3CUQC 3G71I 2ID3A 2M5WA 1Y56A 2ESNA 3TMOA 1FOWA 3IWDA 5HLIA 4OU0A 2RSMA 2QQ8A 3I4PA 1BC7C 3HRMA 1PP8F 2R7SA 3M99B 2CYYA 2LMDA 2G0EA 3AG1H 1A1LA 2LRDA 3GTMJ 4HV6A 2EMCA 1R1VA 4M3GA 5DCMA 5L3BA 2ECBA 5EZGA 6PAXA 3MN2A 1Y0UA 3KP6A 1R5HA 2F4VE 2OU2A 4DMIA 4BE2A 2UZKA 4J00A 4B44A 2XAGA 4A0ZA 3ZN0A 4MLQA 2B9DA 4FASD 3CLQA 2E19A 4AVPA 5EG0B 3V8JA 3WHCA 2GLOA 1S7OA 2FNPA 1OQYA 4RB1A 1O0WA 4KN7X 4DV1E 4BQOA 2VOOA 2BBGA 2X1EA 2V85A 1ETVA 2D1HA 2DK8A 4RGRA 4Y7NJ 3LSGA 3J81C 2QM3A 1KA8A 5DCMB 3OMYA 4R1HA 3SDGA 1HW5A 2ZXIA 4LLLA 3CMYA 4DV4E 4Y52J 4BQAA 2LE2A 4U87A 1A6QA 1HBXG 1FIAA 4G12A 4I98B 4YIIA 2E1NA 4C3IJ 1TF6A 1DGWY 3F72A 3O8HA 1HA8A 2GHFA 1PDNC 5ADZA 1MEYC 3PQJA 1I50J 4D5CA 3DPTA 2EM6A 2BVLA 3FWEA 4WXCA 1AOYA 2K86A 1XGSA 1TWGJ 4EJOA 1Z05A 4DBRA 1GLNA 1LEBA 3GW2A 3IH4A 2HPIA 2OCEA 4IZZA 2X1CA 2CV2A 1IBLE 3ZCOA 1QU3A 4DR1E 3S17J 2WZOA 4II3A 2Q2EA 3EPZA 5DV5A 4HZFA 4IRGA 2KONA 3K6QA 1BB8A 1EKZA 5E1ZB 5CYVA 1BA5A 2K7IA 1Y1WJ 4HG2A 1RNLA 5GAHJ 3P9CA 2FGGA 2BV6A 4L5IA 3JRGA 2H1LA 5IOYA 3S2DJ 1N75A 2STWA 1VQ7I 4LFCE 1V4RA 3JU0A 3Q3SA 5CVUA 3I56I 2L7ZA 3EDPA 4MNUA 2I9IA 5LMUE 1VI0A 2HOEA 5E18F 1CF7A 2EINH 3O3KA 2PEXA 3ZQ7A 2KRCA 3LSMA 1OFCX 1VQNI 4L5EA 3BQZA 3K70C 4O5GA 1X3ZB 2YRKA 3BDDA 1ERDA 4HPQA 1N36E 1TNTA 2V88A 2EWLA 4XRMA 5HLGA 2LUPB 1RESA 4Q4ZF 1G8XA 2UUCE 2KIUA 4P55A 1IN6A 4A12A 2EPMX 2FNAA 5LEKA 2LV2A 1U5TB 4BY7J 5E3MA 1D0YA 3IRRA 2CMPA 3RQ4A 2JA6J 2EPZA 2VL8A 1Z9CA 3DXJF 3J7AY 2R7TA 1F1ZA 5C4XJ 4DR2E 2GOXB 4N4RB 1WH5A 4RB3C 1XDSA 1FMVA 4IO9F 2L2NA 1HDPA 3TQMA 1W5CC 2JPAA 1JKOC 4X6AJ 3BPXA 4JI1E 1YUJA 4ENMA 2ADUA 1EJ9A 5IYDJ 2HQNA 4DYRA 4S0HB 3MHHC 3DJWA 4IHXA 1XGMA 4BS9A 1Z7LA 2FBIA 2DQRA 2HQRA 3OYHA 2CH0A 3CDHA 5DTDA 4EVIA 4EMSA 3CESA 1OYWA 1NTCA 1XPXA 3F8MA 1GXQA 3MKLA 4OX9E 2NS7A 5J1UA 3GLLA 1MDMB 4F7ZA 5EGOA 2P7VB 2GPIA 2EM0A 4HAMA 3JRDA 2X6YA 2ME6A 4FE7A 1O7LA 1F2IG 2NOGA 1DQUA 4XBFA 3JSOA 4FISA 2DMNA 4MEYF 2ZJRF 3BG5A 3Q0WA 4AD9A 1JKPC 3FMSA 4BNCA 4NDLA 3FMRA 3PO2J 3LSPA 1X2NA 4V19K 3HPHA 4EM1A 3V42A 2DAOA 4F52A 1GDTA 2CV1A 5HLTA 3K69A 2EMZA 1W7PD 1OR7A 1Z6TA 4U7DA 3IWZA 2O61A 1XSDA 2VKEA 3E97A 1OISA 5M5XJ 2EOSA 3GFMA 5D6FA 1O7FA 2EOQA 3BJOA 1U0JA 4WFTA 3HTXA 4M9SA 2ZB9A 2YTEA 2L7MP 1KQ8A 3HM5A 1W5SA 3BQYA 2V1UA 2VE8A 3F9KA 1WI9A 1I6XA 2HYGD 3OIPA 3SZTA 4Y13A 3HTUA 1QZZA 2M0CA 2K4JA 2OQRA 1ZR9A 2OZ6A 2KIMA 2AQFA 1PJQA 3HBLA 1AWCA 2O7OA 4Q48A 3W6VA 3RYRA 4LOCA 1SMYF 1FBSA 1SD6A 4DNCA 2RQPA 3PSIA 1E3HA 3P9KA 4X65E 3GMEA 2NUEA 4XSXF 3E0JB 1T4OA 4AIHA 1YW9A 5HLHA 3S8PA 3BTJA 2R5YB 1N3GA 1PJSA 1J5EE 1WJFA 1S7EA 4O6JA 1JHHA 2I8DA 2K9QA 5JHUA 1IXCA 2YTNA 3HDDA 3S93A 5AE1A 4HQMA 5FD6A 1LE8A 4M73A 5HOOA 2YRMA 2TRTA 1B72A 1VQ4I 1B6AA 2UXBE 3DV8A 2P5KA 3HC7A 4RA2A 2ZO4A 3A0HC 4A3MJ 4IQJA 4F2JC 3AG4H 2HQ5A 4NHRA 2DMQA 3SHFA 1NG7A 2K02A 4JYKA 4XMYA 2M1SA 1SD4A 1FYMA 3CUQB 3KP4A 4XNFA 3O2PE 2DB2A 2NXNB 1O3TA 2F4OB 3ZMZA 1FZPB 1G3SA 2MC3A 1ZQ3P 4IHVA 5EEAA 2DLQA 2DODA 1MBKA 4X62E 2EV0A 2K85A 2LP0A 1X5WA 3FM5A 1IV8A 1WI3A 2E1MB 4ASNA 3PIPF 4XL9A 4G8XA 2P81A 4R79A 4OMZA 4B3ME 4F54A 4CCLA 1P6RA 1S9HA 1U2WA 2FOKA 3E6DA 3W2WA 2D9HA 3LSKA 2CUZA 1YRNA 5K5RA 2I10A 1WKMA 1S3JA 4XONA 1XB4A 1X6EA 2CW8A 4PZJA 5E1XA 4DGWB 1L3LA 5CFFE 1JI8A 3HTSB 1MD0A 5JHFA 3CUOA 1MJAA 2M4GA 4FX0A 5EYRA 2E5NA 3M9AA 4YIFA 1U78A 2OTJI 2MKNA 2XAJA 4UUTA 4BYYA 2R1FA 5H6QA 1WSUA 1XC5A 4IQ4A 3WU1B 4R2QA 4GZNC 3FHNA 1VQOI 4XIDA 4FCYA 1QZYA 3SFZA 3BZCA 1ITYA 3PSFA 3L2VA 5FD5A 3IKVA 2R7WA 3TGNA 1MMDA 1KGSA 5JLWA 5BS6A 1IG7A 2EMWA 1XDUA 2WV0A 4HYEA 4KUMA 4PJLA 2B7VA 2EFQA 2QQBA 2EILH 2QENA 3HRUA 3TEDA 3DF8A 5ED4A 3OYBA 1OCCH 1TWCJ 1LPQA 2NRAC 1X3UA 2JSPA 1OCTC 3OIOA 1IN8A 2BY1A 1A35A 2CW0F 2YSPA 1FBUA 3NWSA 2A6HF 2DA2A 4C2MJ 4FE4A 3DKWA 2I13A 3HGGA 2QBYB 3PUFA 1K6YA 2A6EF 3JRAA 2EPNA 2IRFG 1XS9A 4AIDA 5EGOB 3JCUC 1U3EM 2VPRA 3NQOA 4NBQA 2EFPA 2L9RA 4GFBA 1GV2A 3PFIA 4B09A 2DYRH 2J5OA 3M1CA 4ZJZA 1TW3A 3CUQA 1FEXA 3H92A 2V9KA 4FHTA 4PGGA 4JX4A 1B69A 1BBOA 1Z3XA 4BKXA 4U7BA 2XF5A 2FEZA 2ACJA 4M0VA 2R7UA 3ECRA 2L0KA 3LQQA 3HB9A 1J2XA 1DPRA 3H3UA 2HU9A 4XKVA 2XGEA 5H6RA 2M7BA 3DLLF 4EM2A 2P5LC 4C2UA 4NUBA 1Y39A 2M34A 1W0UA 4UY8I 2DA7A 3BTLA 1FP1D 4GRIA 5FKOA 1HKSA 3ASNH 3CJTB 2Y9YA 1ZRCA 2ISYA 4PJJA 2V6EA 1I5ZA 2YPNA 2A61A 2JA8J 4OWRB 3ZMSA 5AONA 5KVRA 1Z91A 1TC3C 3S1RJ 3E5QA 2BHZA 2LK2A 3ZP5A 3GZNB 2CUJA 4RM3A 5KHDA 3VWBA 2JVGA 3QYEA 1JTYA 2VI6A 3MSWA 3ZQGA 2RS6A 3KEYA 4ZDOA 3K4BA 4PFOA 3ZMUA 2MBFA 5FLMJ 3NAUA 2EN1A 5M5YJ 4OIQF 2JVAA 2G7UA 5CVIA 1TP4A 4UVAA 2VE9A 3GO5A 4EQQA 2IHR1 4O5VA 2YU3A 1J75A 4A3BJ 3P7NA 2H8WA 3FXUA 1Q1VA 1IXSB 4DV3E 3IP4B 2DGCA 3DBLB 3L9FA 4L9TA 3TOAA 2Q2EB 3V7SA 1GVDA 3TL4X 1UN6B 4DV7E 3HSEA 2GQQA 1AHDP 2KL4A 3S2WA 5F0CA 2QBYA 5BR8E 2PBIA 2M4KA 3FX3A 4HBLA 2AHQA 2HZDA 3OMLA 3VYYA 2EJRA 4XRFA 1U9OA 1ZELA 2DOFA 3UK3C 3WTYC 5EDNA 2B0LA 1BI2A 1UAAA 2MD5A 1LVAA 5J4YA 4BY1J 5B1AH 1IRFA 1X6FA 5HODA 2XDVA 1D0XA 2RGVA 3HHGA 4BXFA 2XPUA 5GAGJ 4X66E 3KYCB 1OCOH 4XSZF 3ZOQB 2WA0A 1R58A 1VQMI 3ABUA 4AM3A 3I5UA 2MDRA 1UB9A 2ETHA 2L54A 1DQ3A 2WBTA 3FHZA 3ASOH 1JKQC 3DEEA 3KLNA 1UG0A 2H27A 1U6GA 4PSWA 2A69F 2F4IA 2QYOA 4MQ9F 5D5XB 4XRSA 3F6VA 3GTOJ 3PUBA 4GGGA 5TISC 4HTGA 1ORKA 1ZRDA 5TSEA 4DR6E 2DA4A 5TRDA 2BE5F 4PUSA 5F04A 2KKOA 5FROA 3CLOA 4TUGA 4B47A 3BR0A 1JT6A 2L9VA 4PJNA 4CYCA 2L3JA 1FP2A 3GWZA 1I1SA 1QHGA 1NHAA 3HPGA 5LD2C 3L2UA 3N4MA 1RI7A 3RKYA 3EUHC 4M3DA 4ESBA 3A01A 1T95A 1REPC 1W4MA 2YWQA 2E1MA 2EK5A 4LJZF 2ZCWA 4CHUA 2HC5A 4RLQA 1NK2P 2RQLA 3DBHB 3DCFA 2FBHA 1W1WE 3G1OA 1XX5A 1R4MB 5F1JA 3PM1A 2J5PA 4DBQA 5BOXA 2V9VA 2WAEA 3LWFA 3IKTA 3JTZA 2DMUA 4BJTA 4J8ZA 2E2HJ 2VRDA 3U21A 1ZR2A 1JUMA 1Z6RA 2PN6A 5K1YA 4YEJA 2JUGA 1DGCA 4A2UA 3CCUI 1BC8C 2MD0A 2M4IA 4F9BB 1SMTA 1LNWA 4XLFA 3MHSC 4MO7A 5A6JA 3ISPA 2K27A 2HOAA 2JN6A 3W6KB 2YX4A 2WTEA 3VOEA 3TQNA 1LQ1A 3HOXJ 3ESWB 2ZC2A 2DMTA 1MH4A 3HUGB 3BZ6A 4CH7A 3JAMK 4FX4A 2EOOA 3TO9A 2JZYA 2QSHX 4D5FA 3KPHA 1X49A 3JTHA 1IUYA 4WPYA 1VQPI 2W24A 2VQFE 1DU0A 5EF6A 1FYKA 1T33A 5FFZA 5KL7A 5LMNE 2L8TA 1A1GA 2VT2A 3L2RA 1S72I 1P4XA 1BOAA 2JT1A 4RS8A 4Y17A 4YY3E 3QRFF 4MFDA 3OV8A 2M3AA 3CP8A 3RCOA 4M74A 5JR3A 2VBWA 3C18A 2WBMA 2HOSA 2YUSA 1HXDA 2VUMJ 2W00A 3RYPA 1MIJA 4KT5C 1YPNA 1I1GA 3CMEI 4ABZA 4XQFA 2MH9A 4E4HA 5BMZA 2LY9A 2YRHA 3J81Z 4O4KA 4LG0B 3T1HE 3VSKA 2JUCA 2NAZA 3EPKA 3B6CA 1T4LB 5E3LA 3MD2A 2MA3A 2RVCA 2UUBE 4LG3A 1LFBA 2KHMA 3GLXA 5F0FA 1YW7A 1R22A 1VF9A 1O3QA 3CC4I 3KP3A 3TDUC 5M3FJ 1K79A 2FQ3A 2VODA 3FKIJ 3SEZA 4CYDA 3H3VK 1V3FA 2RTXA 3H3ZA 2V86A 4A3IJ 1QO0D 3HKZA 2R93J 5EZHA 1OJLA 3K4NA 2W85A 3I64A 4HDUA 4BDZA 3HSRA 2EFWA 1WJBA 2IA1A 2W25A 3Q0UA 4G6QA 2N8XA 1B8IB 4BACA 2B7EA 2V6CA 1XG1A 2QGUA 1SFUA 3GTJJ 4M6YA 1PUFB 3BR2A 2DLLA 3WU0A 2OC6A 4H4KC 2V1DA 1W5TA 2CUEA 3CMMA 1N32E 1BI1A 1AH5A 2PX9A 1JJ8C 2UXXA 1QVUA 2H36X 2MC6A 4DJAA 1UHMA 3HL2A 2XUBA 1TLHB 2HVQA 1N33E 4LF7E 4AIJA 3D0SA 3RZDJ 2Y9ZA 5E79C 4D9JA 2EOZA 5IP6A 5HDKA 1E0EA 1U8BA 3GXOA 3K0LA 1Z3YA 3PJRA 3SZGA 3OR2C 3P5JA 2OZUA 2ODRC 1IN5A 1UHZA 1HNZE 2LH9A 2YSRA 4B1RA 1G59A 3F8NA 1STUA 1J5YA 2EPOA 1OMIA 2K40A 3QP5A 2V26A 5J6XA 5IXMB 1R36A 2FU4A 1ACIA 3E7LA 1WXRA 1YYWA 2GXBA 1PJRA 2AQEA 3R4KA 2A68F 4AU7A 4FTHA 2DBBA 4YG2F 2CWEA 2ID6A 4X8WA 4E7SA 3IV5A 1HKTA 4LK1F 4PK4A 2HWVA 4EV0A 4IXAA 5FB2A 2KISA 4J19A 3J7ZI 5ICGA 1U5TC 4X9JA 5KK1A 1LLMC 5F6FA 4C30A 2EZIA 3OYMA 1ETXA 5CLSA 3J80K 2A07F 2VBXA 4ZYGA 2M8EA 3BR1A 4CA0A 1BI3A 3UKGA 4R2SA 4JI7E 1PYVA 3Q9SA 1G3WA 3UR3C 3M07A 2IXSA 4GEQB 1A36A 4R2RA 3AFHA 2DFEA 4ZTFA 1LVKA 5LHGA 4XM3A 1USTA 3K4CA 3WTUC 1ZYRF 1BIAA 4PJMA 1RPWA 2M8GX 1YE9A 2JWTA 5GTIC 4IX7A 1RR7A 2D5VA 1DI2A 2A5YB 3HOZJ 1G2DC 2LBSB 4U0VA 1YQAA 2DT7B 5LRSA 2RQQA 2EPAA 1B1BA 1L4SA 2R7FA 2NUFA 3MAJA 2L6MA 2ISZA 1O4XA 4YELA 4Y3OA 1A1HA 1WVRA 3MCZA 5E17F 3BR5A 1HOMA 2EP3A 3JSPA 4M6XA 1FPQA 2HXOA 1MJBA 2DYSH 1QHHD 3KCCA 2P4WA 3KETA 1YZ9A 2R4GA 4R2DA 3LOCA 3H1CA 2L7FP 2PFBA 4CCJA 5LHHA 1ZR4A 4UB6C 4QTRA 3V8KA 4BQNA 4GCVA 4A3DJ 4EJWA 5FKNA 3FXMA 1W0TA 2VASA 1SAUA 2FQ4A 1A6IA 2HTSA 3CDIA 2F4MB 4EJTA 4KIGA 4E7ZA 2JA7J 2YT4A 2ELKA 2EPPA 4R2EA 4DV5E 3ULQB 2B3TB 2ZNZA 4KJZA 2AS5F 1OYYA 2EL4A 3Q9VA 5FKLA 3MQ0A 2NNNA 4RGXA 4AUXA 2VOPA 1P2FA 3RPUA 4R2CA 1IBME 2DJNA 5K7FA 4XRSG 2JWOA 1UZCA 1JE8A 2Q8UA 5T6JA 4GDFA 2JP9A 2JA2A 2R7DA 3QPTA 1VQ6I 3MKYB 2MABA 4IRHA 1T2KA 2YTIA 1MNDA 1V5EA 4IVNA 2DCEA 3BCAA 1VQ8I 1MNEA 3FXOA 3LMLA 3RPQA 3LNQA 1H89C 4KDPA 4Y4RA 2STTA 2MW8A 3BTIA 2D45A 2E72A 1RMDA 2L01A 2L92A 2UU9E 5JI6A 2UXDE 1Z77A 2GXAA 3QP6A 1MMNA 1FOKA 2HDCA 1D1AA 2X6WA 5E8GA 1WGXA 2OCCH 4UVCA 4MEXF 2JOXA 4BHBA 2K7LA 1YJWI 4ZYAA 2XAHA 2Q0OA 3KWRA 3JW4A 1KYZA 2L5QA 4X64E 3TBIA 4MHGA 3KP7A 4RAZA 5J1YA 4LU9A 4E7LA 2HDDA 4JQFA 4MGRA 4EATA 4JI6E 1YS7A 2LUQA 2LC2A 1YHQI 4BJ5C 2R7VA 2X6OA 4OAYA 5ICEA 4IOCF 1X3CA 3GVAA 1G2HA 3D5SC 3E6CC 3F0CA 4G7HF 1HC8A 1UG2A 2GZWA 3OIQA 2H94A 4XKBA 2E60A 1ZTRA 1SVLA 1K83J 4D1QA 4A3GJ 4P7DA 4V2FA 2R76A 1BR2A 3B73A 2DTZA 1N34E 2WWYA 4JBAA 3KZIC 3G1LA 4E6KG 5E8IA 3T1YE 4CUGA 2BOLA 1ENHA 4IL6C 4NQWB 4OOIA 4C9YA 4YHHE 4M9XA 2HHHE 5AIQA 1GT0C 1WJEA 4L9JA 2WB1N 2O03A 4GKKE 4RGUA 5LGUA 1T08B 1XMKA 2OUMA 3RMPA 3BC8A 2LBFB 3I9V2 4S05A 2ELYA 1MMGA 1QRYA 2VJ4A 1D5YA 5H2FC 2EM2A 4RAYA 2VKVA 2M7QA 1M1EB 1VTNC 3D1NI 3W2AA 3BJ6A 1DP7P 2OF7A 2E1OA 2ZJ2A 3T0YA 2MLGA 3VYTB 3TDZC 4MIMA 1MBJA 2FF4A 5DD8A 3WTVC 2LKXA 5J47A 2RAEA 4IS1C 2CQ7A 5HDNA 3A4CA 2P5VA 5BPIA 1JKRC 3GZ6A 1IGNA 2V87A 4UNOA 1R4NB 4TV7A 1AU7A 1WCMJ 4BBSJ 2ZJPF 3OSFA 4CDGA 1YX5A 3A01B 5A2QK 4F93B 3F3XA 3E3VA 2O6GE 2O3FA 1FBQA 1DP3A 1ZN2A 2Z5UA 2Y75A 2QKMB 5LEJA 3FBNB 3M8FA 2FMLA 3K4KA 3CO6C 4L18B 3WGIA 3H9JA 1Z1BA 4JI0E 3W3CA 1A1IA 4BU2A 4OIPF 2M9HA 1D1CA 1F4KA 2R7QA 2CU7A 3FDYA 1VQKI 2EIJH 9ANTA 3RIRA 3K9TA 3N97A 1FT9A 2F5VA 2H8RA 3GUDA 1XMAA 5IT3A 3J80C 5ILSA 3W6JB 3C2HA 2GA1A 3VSLA 2X4HA 2FXAA 2W84A 4UVBA 5F08A 3OYLA 1H9TA 4I8OA 3R61A 2OAZA 3I3LA 1OLTA 1K4TA 2R7ZJ 4IEJA 3HG9A 5GPCA 3J81K 5J40A 2M30A 5CJ9A 1YOVB 2H6CA 3ZQFA 3AUZA 2OTLI 2MC5A 1YIOA 2IS6A 2NS8A 1YS6A 2EPRA 3AV0A 2ZM6E 5IP9J 1O3SA 2V8QB 4DOZA 4N0BA 5DD4A 2HYFA 2K9MA 1X47A 2DQLA 2IS2A 5D4SA 1R71A 2WAFA 3OL3A 2CUFA 3DQVC 2VXDA 1FSEA 4LIUA 1Y0NA 4KYWA 2JR1A 4M30A 1P7IA 2EMYA 1XMOE 3M7GA 4P9UA 1D0ZA 2RSIA 3FIGA 3VYRB 1ZAOA 3GFLA 4N4OB 2ZBKA 1T0FA 2IW5A 5CVRA 2HR3A 3EUAA 1A04A 2LREA 3JAMC 3FM3A 2DDAA 1TL8A 4LB6B 2YTOA 2ZXHA 4II2A 5JLXA 3IAM2 2BVMA 2VE7C 1D8JA 1HDDC 2M87A 3H36A 3MWMA 1SFEA 3S3NA 1SVMA 4DKKA 2KZVA 2Z2SB 2PMUA 2KOUA 2LVHA 3FXRA 1TWFJ 5ICFA 3I54A 2EIMH 1E2XA 5DM6F 3FZVA 4RB2C 2R7XA 1TTYA 3OYIA 2W7NA 2R92J 4KISA 5GAEJ 5DUIA 3K1PA 3K4JA 3C4TA 4R2PA 2EN2A 1UBDC 1X3WB 5B66C 2IA2A 2R3SA 1RUNA 1XD7A 2IVMA 1S29A 4Z6YA 1WJDA 1R5GA 3IL2A 3S16J 4CCNA 4TUIA 1VFCA 2HEOA 2PLYA 2Z9OA 3QU3A 4UUSB 2LLKA 1A1KA 2BY3A 3U2RA 3L09A 2NVUB 3BP8A 3K2ZA 1MSFC 1X6HA 2X9DA 1X1AA 3H0DA 4ENJA 5IT9C 1ETYA 1ZU1A 4R2AA 1LFPA 2E7XA 2JA5J 4XLEA 4QPQA 1IV6A 2VT3A 2Y48A 4RAFA 1QBJA 3DU6A 5J8FA 3CCQI 3SDBA 2E1MC 3HPSA 3R6SA 2ELJA 1I3AA 2WB1A 3CO7C 4LF8E 4O24A 4ENKA 1KU2A 1H0MA 1ZREA 2EMIA 4JI8E 4M72A 5D4RA 1IMUA 2R7OA 1YYVA 2AXTC 4YIRX 4A3CJ 4B3RE 4FQGA 3KZZA 3ZQLA 4P1WA 1R1UA 1YJNI 3MVPA 2IP2A 1K7AA 3EPJA 2VQLA 1F43A 1MH3A 1DUXC 2VF1A 4K0KE 3RKWA 4A3EJ 2LO3A 1HQCA 2RV8A 2WAQN 3DBRB 1ZG3A 3G73A 4BBYA 1Z21A 3DU5A 5D6EA 2EV5A 2JY9A 2EPFA 1HNXE 3BG6A 1V54H 5KL6A 3HOTA 5FO5A 2YU5A 1GVJA 3CJQB 4KMFA 1FX7A 3BG3A 5DCFA 4RBOA 3BG7A 3OYNA 5LLQA 1J9IA 5HNHA 2R5ZB 4I02A 2QQ9A 1ZGWA 3U1DA 1XN7A 5L3GA 2O8KA 1D1BA 1V5FA 3S1NJ 2E71A 2ZSIB 2E35A 2MSYA 2PG4A 2VONA 3KEOA 2AXLA 2W82A 2L7KA 4FETA 4M6VA 2YTQA 3DEWA 3KFWX 5HS7A 2PJPA 2LF7A 1BBYA 1P92A 2E5LE 3ZN1A 2IA0A 4GYIA 2VQHA 4RHBB 2EN6A 1T56A 3LA3A 4DZJA 2IS1A 1JGSA 2FE3A 3LFUA 4WWCA 3DWLE 1ZLJA 2QUFA 3LSRA 3BBGA 1FWZA 4ZDPA 3LFKA 1W7PB 4D0PA 3GZ5A 3OOUA 1JJ6C 1LB2A 2WAQA 4IHTA 2E2JJ 1WPKA 2P6TA 2L9NA 2GWRA 3O6BB 3QPHA 4HV5A 2EM9A 2J7JA 3KE2A 5AE3A 2XAUA 2YZTA 3WG7H 2DJIA 1J0RA 1G6NA 2IGKA 3JTGA 3ECHA 3CJNA 2Z33A 1FTTA 4RB0A 1GHCA 1WWXA 4HX7A 5AASA 3ZQQA 1O3RA 2ZMEB 2A25A 2IS4A 4BBRJ 4G7ZF 3REOA 1MGTA 2CFOA 2H09A 1Z67A 3ABLH 3JRBA 2N8GA 1BW5A 2ELHA 3LA7A 3KX2A 4ZH4F 2CT1A 4QSHA 1CF7B 3VODA 4E7IA 2EMXA 3PNYA 3FK7A 4GYGA 2YS9A 2BB8A 2EZHA 4ITVA 3C4BA 4JI2E 4YFXF 3H5RA 1NK3P 1KZHA 2Y69H 4ENNA 2CJJA 5KNLA 2LY2A 2BZTA 1LE8B 3KYLA 1KYQA 2ZMEA 4BC7A 4I0BA 2RREA 3S3MA 5J4VA 3GTLJ 3EPLA 4KN4X 4L9VA 2CO5A 2FMYA 2DMPA 2WY7Q 1KONA 3GTPJ 3JRFA 1RZ4A 3V7RA 2FRHA 1NG6A 5DUKA 4P96A 3J7AO 3DTEA 4BAYA 1R00A 1X58A 1FTZA 3K6GA 3KEQA 3F21A 3FKJA 2EOFA 2Q1ZB 1LFUP 1YUIA 1BI0A 4BH9A 3AL0C 4DR5E 1ZK8A 4JOMA 3ZR8X 1BM9A 1IBKE 1X4OA 4CZCA 1C0WA 1XMQE 2DA5A 4U88A 4ZDLA 4DIQA 2HJJA 3KZYA 5IWAE 1WJ5A 4O3MA 1S5LC 2V7FA 1W36D 3MMYB 4AWXB 3HJEA 1MNMC 4DYCA 5L3CA 1PUFA 1YRNB 4GO1A 4DR4E 2EMHA 2RC4A 2DMYA 3LSJA 2EMAA 2D1VA 2FX0A 2FA5A 3GFJA 1H8AC 5HS8A 2MC4A 1IRXA 2VQEE 2DLKA 3G6EI 2EOEA 2EFNA 3HOWJ 1FJLA 1ZBQA 3BY6A 2JYAA 4GXOA 1R49A 4Y33A 1HW1A 4XOTA 5EEGA 1OYIA 1B72B 1E17A 4K2EA 1I94E 1XCBA 4OIRF 4IOAF 5IY5H 2EA2A 3OY9A 2BEOA 3T1BA 4ZZDA 1S7AA 2KJCA 4A0YA 1QPIA 2ODRD 3ML6A 3F6HA 5J1RA 3H5NA 3CJRB 4JX5A 2V1NA 5IT9K 2HOTA 2AO9A 4HF1A 3L2WA 1QU6A 2DFFA 4E7KA 3FIWA 5FLXK 3OYCA 2M2EA 1FJGE 2IGMA 2HPMA 4F91B 1KU9A 3B6AA 1WQ2A 2UUZA 4E7HA 2DIXA 4GKJE 1SFOJ 2M7AA 5KAIC 1EH8A 1RC9A 3GYHX 1SEUA 4KZSA 4CYCB 3H35A 5AC4A 4G7OF 3IH3A 5C44J 1IDZA 1ZRFA 4M71A 3RKQA 2RNJA 3OYDA 2RKHA 3J7YJ 4BEHA 3OSGA 4BXXJ 3F6GA 3C2BA 4B3AA 4UUVA 5E20A 3CCMI 4G6TB 2JQ7A 1IRZA 2TDXA 4CCKA 4HQEA 2DT6A 2O9LA 2EE8A 4HEIA 3KLOA 2KFDA 2CQKA 3H5AA 2WY8Q 2DI3A 1SR9A 5EG0A 3L1PA 1IN7A 3E1SA 1ON1A 1FOXA 2JSCA 2FJ1A 3C7JA 5FKKA 4EM0B 3WG9A 2K9LA 5LBQA 2LT7A 2EOIA 4B43A 2DFHA 5KL5A 1UELB 4B3TE 1JTXA 2WCC3 2JTVA 3AL0B 2ICWG 2QLZA 1K6OA 4IPAA 1MMSA 2P8TA 1X1BA 2PMZA 2YSOA 3HPZA 2HTJA 4AC0A 1VQ5I 3IUOA 4X1EA 3C6MA 3BROA 1K78B 3J7Yp 3CCYA 3HUGA 4A3JJ 1EH6A 5E1WA 3COAC 2UXNA 5KL4A 1E3PA 2Y2ZA 4XLNF 3W2VA 4IJAA 3S14J 3OYGA 3QG5C 3MZYA 1A1JA 2JOBA 3RPUD 4NB5A 1X1PA 3SQNA 4M9VC 3SEQA 3L00A 2GXGA 2GLIA 2K9NA 3OR1C 2PQ8A 4NHJA 3ZQCA 5GTHC 3BR6A 1G2FC 2Z1DA 2VXZA 1WHQA 2V79A 3V4GA 4S04A 4DR3E 2EA4A 3FBIB 1R1TA 4IHWA 2DK5A 1WJCA 2H1KA 1MBEA 4L0ZB 3ZMVA 2LCEA 5GP9A 4LTYA 2DA6A 3M8JA 1YI2I 4BCAA 2LY1A 1HR0E 1ZAAC 1Y8QB 3DTIA 3DEUA 1TT0A 1XNQE 2HQAA 2OV7A 4PJ0C 4OINF 2JRMA 3BTCA 4BE0A 1T8IA 3DTKA 4CO8A 2L9SA 1SFKA 1RKWA 1D5VA 4RMNA 4Y15A 3PL8A 5ERIA 5A2QZ 3CCEI 1ZARA 2XSJC 5EEHA 2QA4I 3I4MJ 3TW7A 2VB6A 3ONQA 1J59A 5KCMA 3HXLA 1JUPA 3ADIA 3FXJA 1G3TA 4MQVA 4JI4E 5A6BD 3IH2A 2DSYA 2OD5A 1B9MA 3FXLA 2L02A 3QYBA 3E6BA 2MFZA 1YO5C 3HSFA 1USSA 3I59A 4H0EA 4KITB 3G3ZA 4P78A 1J09A 4IF4A 1I3QJ 2VKDA 3G1MA 2OQGA 2VQGA 1SD5A 1PP7U 1XCVA 2JK3A 1FMWA 2YTGA 2ENAA 4QPOA 4N9HA 3T8RA 1IZ1A 2E7WA 3KP2A 3VEPA 5JFRA 2XB5A 3QQAA 1F36A 2IBDA 2LF8A 4LB5A 2B9SA 4A69C 1I27A 3RJPA 1ETQA 3HRTA 2EPKX 3IC7A 2BW3B 2GA2A 3DKXA 4XLHA 4A6EA 4KIBA 1LUJB 5FLXZ 4KA4A 2E5ZA 1FC3A 1HCRA 2O8XA 2K3PA 2W57A 4KNYA 3E5XA 2VLAA 4HSTA 1LDKB 2XF7A 3M4OJ 1Z7UA 2EFOA 4Q35B 4LF4E 2FBKA 2I5UA 5ICCA 4NXME 2HS5A 2O5RA 2XPWA 4LLGF 4KHPE 4XN3A 2LYCA 2PJRB 3BR3A 2ADRA 5H20A 2LKSA 2JMWA 5B1BH 3OYKA 4OOGC 1A31A 1TF3A 3HOYJ 4UHTA 3OS0A 3VFZA 2EPUA 4BMJA 3QWLA 5LGNA 2EZLA 2JJ7A 4E70A 5BNGA 2E36A 3FK6A 2KJBA 2IEKA 2L2OA 1RUOA 4BGDA 3MZ8A 4ANJA 2KDOA 5GADJ 2LBFA 3J80Z 1IO2A 2EMBA 3IWFA 4IRIA 4BE1A 1JT0A 2F5FA 2MKDA 4JI3E 3TO7A 1B4AA 2B7TA 3ADGA 3EQ1A 2EBIA 2YU9J 4HF2A 3EQLF 2CSOA 4Q5SF 2KRHA 3JRIA 3VYUB 2DOAA 3QPLA 2RN7A 1E3OC 3CF5F 3GTQJ 1JUSA 2DMIA 2XF6A 4G6DA 4ZYDA 1SFXA 2CRGA 2EN4A 3CF2A 2XHKA 1DPUA 2HVRA 2YU8A 4EGZA 4MTEA 2Y0MA 5A69A 4DV2E 1GXPA 4HX8A 4AYBA 2G9WA 2XC7A 3T8TA 2NVYJ 4N9IA 3DPLC 3IWCA 1Y6IA 2XRLA 1TW2A 1EKEA 3I71A 3OOPA 4C2TA 4ESJA 3S1QJ 2ENCA 4F9AB 2XGDA 1CGPA 2K9SA 2P0WA 2YX7A 5L3DA 3DPUA 1OPCA 3PQKA 3X2QH 4F55A 2XV4S 2QSGX 2PMZN 2E2IJ 2XASA 5FLVA 5B3SH 1BR4A 1ZKGA 1RIOH 3HHHA 4DV6E 3ZMTA 1Z0XA 1G3YA 4EJUA 5CQEA 5D5UB 5KL3A 3M1EA 1EV7A 5A2QC 1WHNA 5A6BA 1GTKA 3OWTA 1RKTA 1AKHA 1XNRE 1I39A 3L7WA 5F1RA 2F5DA 5IYCJ 1T39A 2ELZA 1QVTA 5CQGA 3LA2A 3MKWB 3AAFA 2NYXA 4I2OA 4HNUA 1IW7F 3TW6A 4LG0A 2KT0A 2HNHA 4L0YB 2XKOA 1R7JA 1YTYA 2L2KB 2Z3YA 3QPSA 2KIQA 2X0LA 3MZHA 2QKLB 3RTRA 3DF6A 5CVJA 2CW7A 2RNGA 1IQOA 3V8LA 3LAJA 1KQ9A 3F8BA 3I0TA 4KT6A 4HNVA 2Z99A 2IPQX 4A3KJ 3WTTC 1MSEC 3HIFA 4HLYA 3ABKH 3ZGKA 1TN9A 3ZMDA 3PO3J 4DYQA 1ODDA 2EMGA 3OS2A 1Q1HA 1R5ID 3RSNA 5BQTA 2P6SA 4M3EA 2KHXA 2IGNA 4I7HA 2EPCA 4L5NC 4XR6A 2NNYA 3F23A 3K7AJ 2DTRA 3I59B 2EMKA 2BXYA 1MBFA 5BPDA 3OYFA 1BW6A 4ZYHA 2HVSA 2ECCA 3K4LA 4ZTJA 3HOVJ 2ESHA 4XN0A 3AKZA 4LFBE 2GBYA 3LL7A 1CQTA 3O8GA 1ULYA 1KU7A 1F9NA 3UNGC 5AC5A 1HKQA 4XORA 1WFXA 4RAGA 2GIZA 3TOBA 3WTWC 2EM8A 3DFGA 1UCRA 3LMMA 1S8NA 4QWQA 4WSPA 2EZ6A 2HGCA 2Y0SA 3A0BC 3Q5FA 1MJ9A 2BBYA 5DEQA 1FKAE 4I6ZA 4LK0F 2UUAE 1QPMA 2EQ1A 3IHUA 2BXZA 1PKPA 3I53A 5D5WB 3ABTA 4I76A 2NVXJ 1X1CA
chains in the Genus database with same CATH topology
4HA8A 3K1MA 2XIGA 1P4AA 1W7PA 1SD7A 1HW2A 1OKRA 2CGPA 1QGPA 2IT0A 2RDPA 1ZHFA 1MZBA 3R0AA 5F64A 1LDJA 5K5OA 4UV8A 1IRGA 3T5XA 3GEZA 3EETA 1XGNA 2YR2A 2EWNA 4WX9A 1LJ9A 1TQPA 4L9NA 5FFXA 1KQ0A 4WXDA 3GF2A 5K5QA 1L0OC 4BHPA 2PI0A 1S6LA 3C1DA 4ETSA 4AIKA 3E5UA 3F8FA 3WTXC 2VC1A 3QU6A 5FGMA 3GX4X 1LEAA 2XAQA 2MLKA 2DFIA 2OA4A 3RKXA 4CZZA 4I09A 2JPCA 2H6BA 3FXQA 4CXFA 2XKPA 2HKXA 2LDUA 4QLCU 4R8HA 4HX4A 2E1CA 4PCQA 1F5TA 1G4DA 2D2WA 5TJJA 2HFHA 2CG4A 4MTDA 3NRVA 1P4WA 5L3FA 5LGTA 4FT8A 1PUEE 5D5VB 5DDGA 2O0YA 1TBXA 3ERED 4DQ2A 1KYWA 2BYVE 1J7KA 2K4BA 3GFIA 3P9IA 2LNBA 2BGCA 4EGYA 4IHSA 1DDNA 1JXSA 4YFKF 3F6OA 4HLXA 4BHCA 4ZZLA 3HOSA 2VBYA 2P7CB 4A5MA 4KIFA 1BN5A 2EV6A 4LLNA 2DW4A 2F2EA 3FMQA 4U0YA 5J8CA 2XRNA 1ZG5A 1ZG1A 3WGHA 4UXNA 1MDMA 4G9YA 5HVQC 3WTSC 2UWMA 1YG2A 2M45A 3CTAA 2ZFWA 3JAMZ 1FNNA 2KRFA 1HSJA 1Z1DA 4NQWA 4XLPF 4OIOF 2VC0A 3E6MA 4KICA 1ZGJA 1STZA 3TKYA 1FYLA 5IT9Z 2QZ8A 3LAPA 1IF1A 1B9NA 2QVOA 5ILUA 3ROUA 1ZGAA 1R23A 1TQIA 1ONVA 3RDIA 1ON2A 5ILVA 4LFUA 2OBPA 1TQMA 2LKPA 4LMYA 2L4AA 1QQIA 4LD5A 3R60A 2DO7A 3EUHA 1YFHA 1FLIA 5L3EA 3F22A 1YW8A 2NS0A 1K78A 4WCGA 4LGWA 2LSOA 2XVCA 2QWWA 3ELKA 4A5NA 1KU3A 1D8KA 4A0XA 4U0WA 3D5LA 4B8XA 2YPRA 4CICA 2XGXA 1XGOA 2JPBA 2V1XA 4I0AA 2M1BA 3BPVA 4PGHA 3ECOA 3F8CA 2DPDA 3C3WA 3MFKA 1MKMA 2KIFA 3WE3A 4G94A 1HSTA 3BWGA 2Q8KA 2IJLA 1UHWA 5D8LB 1O57A 2FSWA 2COMA 3MEXA 4P9FA 3NEUA 3QAHA 5CVVA 4RGSA 4ON0A 1TNSA 3HYIA 3EYYA 2L3DA 1ZLKA 2WC2A 3DP7A 3L2CA 4L5JA 5AIPA 2DT5A 4EJVA 1XSXA 1T98A 3R0JA 3QOPA 4A6DA 3HRSA 4M9ZA 3LSTA 2XROA 3TO6A 1H9GA 3BJAA 4CGZA 4HW0A 2GIVA 1JHFA 5HS9A 1UFMA 4BXUA 1T6SA 1B59A 2ZXJA 3FF5A 1QNTA 1LDDA 4KFCA 5LHIA 4OMYA 2DU9A 2HKOA 4ZYEA 2G7HA 1WRJA 1YLFA 1IN4A 3WE2A 4WK8F 2ZNYA 1IXRC 4Q47A 1FY7A 4JK1X 4PDKA 4Z2YA 3VB2A 3RI4A 1T38A 1BIBA 3KP5A 4HF0A 3LQRA 4YFNF 2HZTA 4HDVA 3B02A 1D3YA 3V7CA 1SAXA 5DYMA 1U8RA 4HOBA 1FSHA 3M8EA 3EYIA 4WXHA 4P5OA 2VN2A 1XSVA 5D8KB 4I01A 3WODF 2ZKZA 2DPUA 1U5TA 2A3SA 2XAFA 1BJAA 2C6YA 2GAUA 1IAWA 2JRTA 3IRQA 4KMUX 4UV9A 2QQAA 3WGGA 2F5CA 2MH2A 1EH7A 1ZH5A 3U9GA 5JVTA 3ZPLA 2PMHA 4WF2A 2VBZA 2L4MA 2EB7A 3K1NA 3SZPA 2CFXA 2F5EA 3BOQA 3SXYA 5HDGA 3I58A 4ESFA 3WTZA 5LRRA 3CUQC 2M5WA 2ESNA 5HLIA 4OU0A 3I4PA 1BC7C 3HRMA 1PP8F 2CYYA 4HV6A 1R1VA 5DCMA 5L3BA 6PAXA 1Y0UA 3KP6A 1R5HA 2OU2A 2UZKA 4A0ZA 2XAGA 3ZN0A 4AVPA 3V8JA 1S7OA 2FNPA 4RB1A 4KN7X 2VOOA 4RGRA 2D1HA 2DK8A 2QM3A 1KA8A 5DCMB 4R1HA 1HW5A 4LLLA 4BQAA 1HBXG 4I98B 4YIIA 2E1NA 3F72A 1PDNC 3PQJA 3DPTA 3FWEA 4WXCA 1AOYA 2K86A 1XGSA 4EJOA 1Z05A 1LEBA 3GW2A 2Q2EA 5DV5A 4HZFA 4IRGA 5E1ZB 5CYVA 1RNLA 3P9CA 2BV6A 4L5IA 2STWA 1V4RA 5CVUA 3EDPA 4MNUA 2HOEA 5E18F 1CF7A 3O3KA 2PEXA 3ZQ7A 3BDDA 1TNTA 5HLGA 4Q4ZF 2KIUA 4P55A 1IN6A 4A12A 2FNAA 5LEKA 1U5TB 3IRRA 1Z9CA 3DXJF 1F1ZA 4RB3C 1XDSA 3BPXA 4ENMA 2ADUA 2HQNA 1XGMA 2FBIA 2DQRA 2HQRA 3CDHA 4EVIA 4EMSA 1OYWA 3F8MA 1GXQA 1MDMB 4F7ZA 2P7VB 4HAMA 1O7LA 4XBFA 3JSOA 4MEYF 4AD9A 3FMSA 4BNCA 3FMRA 4EM1A 2DAOA 3K69A 1W7PD 1OR7A 1Z6TA 4U7DA 3IWZA 2O61A 1XSDA 3E97A 3GFMA 5D6FA 1O7FA 3BJOA 4M9SA 1KQ8A 1W5SA 2V1UA 2VE8A 1WI9A 1I6XA 2HYGD 3SZTA 4Y13A 3HTUA 1QZZA 2K4JA 2OQRA 2OZ6A 2KIMA 1AWCA 4Q48A 3RYRA 1SMYF 1FBSA 1SD6A 4DNCA 2RQPA 3P9KA 4XSXF 4AIHA 1YW9A 5HLHA 4O6JA 1JHHA 5JHUA 1IXCA 4HQMA 5FD6A 4M73A 5HOOA 1B6AA 3DV8A 2P5KA 2ZO4A 3SHFA 2K02A 1SD4A 1FYMA 3CUQB 3KP4A 3O2PE 1O3TA 3ZMZA 1FZPB 1G3SA 2MC3A 2EV0A 3FM5A 4ASNA 4G8XA 4R79A 4OMZA 1P6RA 1U2WA 3E6DA 2FOKA 5K5RA 1WKMA 1S3JA 1XB4A 4PZJA 5E1XA 1L3LA 3HTSB 1MD0A 3CUOA 1MJAA 4FX0A 4YIFA 1U78A 3M9AA 2XAJA 4BYYA 5H6QA 1WSUA 3WU1B 1QZYA 3SFZA 5FD5A 3IKVA 3TGNA 1KGSA 5BS6A 1XDUA 2WV0A 4HYEA 4KUMA 2EFQA 2QQBA 3HRUA 2QENA 3DF8A 5ED4A 2NRAC 1X3UA 1IN8A 2CW0F 1FBUA 2A6HF 3DKWA 2QBYB 2A6EF 2IRFG 1U3EM 3NQOA 2EFPA 3PFIA 4B09A 2J5OA 1TW3A 3CUQA 3H92A 4FHTA 4PGGA 4U7BA 2FEZA 2ACJA 3LQQA 1J2XA 1DPRA 3H3UA 5H6RA 4EM2A 2P5LC 1FP1D 1HKSA 1ZRCA 2ISYA 1I5ZA 2A61A 3ZMSA 5AONA 5KVRA 1Z91A 3E5QA 3ZP5A 3ZMUA 2MBFA 4OIQF 2G7UA 5CVIA 4UVAA 2VE9A 3GO5A 4EQQA 4O5VA 1J75A 2YU3A 3P7NA 3FXUA 1IXSB 3L9FA 4L9TA 3TOAA 3V7SA 3HSEA 2GQQA 3S2WA 2QBYA 2PBIA 3FX3A 4HBLA 2EJRA 4XRFA 3WTYC 2B0LA 1BI2A 2MD5A 1LVAA 1IRFA 2RGVA 3HHGA 4XSZF 1R58A 3ABUA 3I5UA 1UB9A 2ETHA 2L54A 3FHZA 3KLNA 2H27A 1U6GA 2A69F 2QYOA 4MQ9F 5D5XB 3F6VA 4GGGA 1ZRDA 5TRDA 2BE5F 2KKOA 3CLOA 1FP2A 3GWZA 1I1SA 1NHAA 3N4MA 1RI7A 3RKYA 4ESBA 1REPC 1W4MA 2EK5A 4LJZF 2ZCWA 4CHUA 2FBHA 2J5PA 5BOXA 2V9VA 3LWFA 3IKTA 1Z6RA 2PN6A 5K1YA 4A2UA 1BC8C 1SMTA 1LNWA 3ISPA 2K27A 3W6KB 2YX4A 2WTEA 3VOEA 3TQNA 1LQ1A 3BZ6A 3JAMK 4FX4A 3TO9A 2JZYA 3JTHA 1IUYA 2W24A 1FYKA 5FFZA 2VT2A 1P4XA 1BOAA 2JT1A 4RS8A 4Y17A 3QRFF 3OV8A 4M74A 5JR3A 2VBWA 3C18A 1HXDA 3RYPA 4KT5C 1I1GA 2MH9A 5BMZA 3J81Z 4LG0B 2NAZA 2MA3A 2RVCA 3GLXA 1YW7A 1R22A 1O3QA 3KP3A 3TDUC 1K79A 2FQ3A 2VODA 4CYDA 1V3FA 3H3ZA 1QO0D 2W85A 3I64A 4HDUA 3HSRA 2EFWA 2IA1A 2W25A 4G6QA 2V6CA 1SFUA 4M6YA 2DLLA 3WU0A 2V1DA 1W5TA 1BI1A 2UXXA 1UHMA 2XUBA 1TLHB 4AIJA 3D0SA 5HDKA 3GXOA 3K0LA 2OZUA 1IN5A 2YSRA 3F8NA 1J5YA 1OMIA 3QP5A 5J6XA 1R36A 2FU4A 2GXBA 3R4KA 2A68F 2DBBA 4YG2F 2CWEA 1HKTA 4LK1F 4EV0A 2HWVA 4IXAA 5FB2A 5ICGA 1U5TC 5KK1A 5F6FA 5CLSA 3J80K 2A07F 2VBXA 4ZYGA 2M8EA 1BI3A 3Q9SA 1G3WA 5LHGA 1USTA 3WTUC 1ZYRF 1BIAA 2A5YB 4U0VA 1YQAA 5LRSA 1B1BA 2R7FA 3MAJA 2ISZA 3MCZA 5E17F 3JSPA 4M6XA 1FPQA 1MJBA 3KCCA 2P4WA 3KETA 2PFBA 5LHHA 3V8KA 4GCVA 4EJWA 2HTSA 4EJTA 4KIGA 3ULQB 2ZNZA 2AS5F 1OYYA 3Q9VA 3MQ0A 2NNNA 4RGXA 2VOPA 1P2FA 3RPUA 1JE8A 2R7DA 3QPTA 4IRHA 1T2KA 4IVNA 3RPQA 4KDPA 2STTA 2D45A 2L01A 5JI6A 3QP6A 1FOKA 2HDCA 5E8GA 4UVCA 4MEXF 4BHBA 2K7LA 2XAHA 2Q0OA 3JW4A 1KYZA 4MHGA 3KP7A 4RAZA 4JQFA 4MGRA 1YS7A 5ICEA 3GVAA 3E6CC 4G7HF 2GZWA 2H94A 3B73A 2WWYA 4JBAA 5E8IA 4OOIA 4M9XA 5AIQA 4L9JA 2O03A 4RGUA 5LGUA 1XMKA 4S05A 4RAYA 1VTNC 3BJ6A 1DP7P 2ZJ2A 3T0YA 2MLGA 3TDZC 5DD8A 2FF4A 3WTVC 5HDNA 2P5VA 5BPIA 3GZ6A 4UNOA 4TV7A 4CDGA 5A2QK 3F3XA 3E3VA 2O6GE 2O3FA 1FBQA 1ZN2A 2Z5UA 2Y75A 5LEJA 3M8FA 2FMLA 3CO6C 4L18B 3WGIA 4OIPF 1F4KA 3RIRA 3K9TA 3N97A 1FT9A 3GUDA 1XMAA 5IT3A 5ILSA 3W6JB 2GA1A 2X4HA 2FXAA 2W84A 4UVBA 1H9TA 3R61A 2OAZA 3J81K 2M30A 5CJ9A 2H6CA 1YIOA 1YS6A 1O3SA 4N0BA 5DD4A 2HYFA 2DQLA 5D4SA 3DQVC 1FSEA 4KYWA 3M7GA 4P9UA 1ZAOA 3GFLA 2ZBKA 1T0FA 2IW5A 5CVRA 2HR3A 1A04A 3FM3A 4LB6B 1D8JA 2M87A 3MWMA 1SFEA 2PMUA 3FXRA 5ICFA 3I54A 1E2XA 3FZVA 4RB2C 1TTYA 5DUIA 3K1PA 2IA2A 1RUNA 2R3SA 1XD7A 2IVMA 1S29A 1R5GA 3IL2A 2HEOA 2PLYA 2Z9OA 3QU3A 3U2RA 3L09A 3BP8A 3K2ZA 4ENJA 2E7XA 2VT3A 2Y48A 1QBJA 5J8FA 3R6SA 3CO7C 4ENKA 1KU2A 1H0MA 1ZREA 4M72A 5D4RA 1YYVA 3KZZA 1R1UA 2IP2A 1K7AA 1DUXC 3RKWA 1HQCA 2RV8A 1ZG3A 3G73A 5D6EA 2EV5A 3HOTA 5FO5A 1GVJA 4KMFA 1FX7A 5DCFA 5LLQA 1J9IA 4I02A 2QQ9A 3U1DA 1XN7A 5L3GA 2PG4A 2VONA 3KEOA 2AXLA 3KFWX 5HS7A 2PJPA 2LF7A 1BBYA 1P92A 3ZN1A 2IA0A 4GYIA 3LA3A 1JGSA 2FE3A 4WWCA 1ZLJA 2QUFA 1FWZA 4D0PA 3LFKA 1W7PB 3GZ5A 1LB2A 4IHTA 2P6TA 3QPHA 2GWRA 3O6BB 4HV5A 3KE2A 1J0RA 1G6NA 2Z33A 3JTGA 3ECHA 3CJNA 4RB0A 1GHCA 1WWXA 4HX7A 1O3RA 2ZMEB 4G7ZF 3REOA 1MGTA 2H09A 2ELHA 3LA7A 4ZH4F 1CF7B 3VODA 4GYGA 4YFXF 4ENNA 2ZMEA 4I0BA 4KN4X 4L9VA 2CO5A 2FMYA 1RZ4A 3V7RA 2FRHA 5DUKA 4P96A 3J7AO 4BAYA 1R00A 3KEQA 3F21A 1BI0A 4BH9A 1BM9A 1C0WA 4U88A 3KZYA 4O3MA 4AWXB 5L3CA 4GO1A 2RC4A 2D1VA 2FA5A 3GFJA 5HS8A 2EFNA 3BY6A 4GXOA 1HW1A 5EEGA 1OYIA 1E17A 4K2EA 1XCBA 4OIRF 2EA2A 2BEOA 3T1BA 4ZZDA 1S7AA 2KJCA 4A0YA 3ML6A 5IT9K 4HF1A 5FLXK 1KU9A 1WQ2A 1EH8A 3GYHX 4G7OF 1ZRFA 4M71A 2RNJA 2RKHA 4UUVA 5E20A 2TDXA 4HQEA 3KLOA 2CQKA 2DI3A 1IN7A 1ON1A 2JSCA 3C7JA 4EM0B 3WG9A 5LBQA 2JTVA 2QLZA 1K6OA 4IPAA 2P8TA 2HTJA 3BROA 1K78B 3HUGA 1EH6A 5E1WA 3COAC 2UXNA 4XLNF 4IJAA 3MZYA 4NB5A 3SQNA 3L00A 2GXGA 4NHJA 2PQ8A 2VXZA 2V79A 3V4GA 4S04A 2EA4A 1R1TA 2DK5A 4L0ZB 3ZMVA 3DEUA 4OINF 4CO8A 1D5VA 4Y15A 5ERIA 5A2QZ 1ZARA 5EEHA 1J59A 1G3TA 4MQVA 2OD5A 1B9MA 2L02A 3E6BA 1YO5C 3HSFA 1USSA 3I59A 4H0EA 3G3ZA 4IF4A 2OQGA 1SD5A 1PP7U 1XCVA 3T8RA 4N9HA 5JFRA 1IZ1A 2E7WA 3KP2A 3VEPA 2LF8A 4LB5A 1I27A 3RJPA 3HRTA 3IC7A 2GA2A 4A6EA 5FLXZ 4KA4A 4KIBA 1FC3A 2O8XA 2W57A 4KNYA 3E5XA 1LDKB 1Z7UA 2EFOA 2FBKA 5ICCA 2HS5A 4LLGF 5H20A 4UHTA 3VFZA 5LGNA 4E70A 2KJBA 1RUOA 3J80Z 3IWFA 4IRIA 2F5FA 3TO7A 1B4AA 4HF2A 3EQLF 2CSOA 4Q5SF 2RN7A 4G6DA 4ZYDA 1SFXA 1DPUA 2XHKA 4EGZA 4MTEA 2Y0MA 1GXPA 4HX8A 2G9WA 3T8TA 4N9IA 3DPLC 3OOPA 1TW2A 3I71A 4ESJA 1CGPA 2YX7A 5L3DA 1OPCA 3PQKA 2XV4S 2XASA 1RIOH 3HHHA 3ZMTA 1G3YA 4EJUA 5D5UB 3M1EA 1EV7A 3L7WA 5F1RA 2F5DA 1T39A 3LA2A 3AAFA 2NYXA 4I2OA 1IW7F 4LG0A 4L0YB 2XKOA 1R7JA 1YTYA 2Z3YA 2X0LA 3MZHA 3RTRA