4ZYGA

Crystal structure of methylated sulfolobus solfataricus o6-methylguanine methyltransferase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
150
Chain Sequence
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 44
structure length 150
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zygA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zygA01
1BI2A 4GCVA 4GYIA 1W4MA 1EH8A 2G7HA 3LA7A 2FE3A 5HLHA 3MCZA 2QYOA 2O03A 1FYLA 5DD4A 2RQPA 3IRQA 4GO1A 4QLCU 3O3KA 4M6XA 4YFKF 1Z9CA 1XGNA 1XD7A 2HR3A 4ZZLA 5A2QK 3V7CA 3C7JA 3F6VA 3EYYA 5H6RA 1DDNA 2ESHA 3TOBA 1HW1A 2PMUA 3BROA 2RC4A 1LDDA 2P7CB 4I98B 4M6YA 5D5UB 1ZAOA 3MAJA 1U5TA 1RI7A 4IF4A 1K7AA 5HS9A 3WG9A 3GO5A 3WGGA 2GAUA 4IVNA 5CYVA 4FHTA 5H20A 3BY6A 4N9IA 1B59A 2PI0A 1I1SA 4UVAA 4ZYEA 1U78A 1G3YA 3GF2A 1T98A 2EB7A 2BEOA 2Y48A 5JFRA 5E1XA 3LSTA 1TLHB 1I6XA 4HQMA 3FXUA 1XGSA 2ZMEB 5TJJA 2L4MA 1G6NA 2IRFG 1QZZA 3GWZA 4OINF 2EV5A 4LFUA 2D1HA 5FB2A 3COAC 1J5YA 1JE8A 1WQ2A 3K1PA 5AIPA 2FF4A 2CWEA 3ZMDA 1HBXG 3RKXA 4LLNA 1RIOH 4O5VA 4WX9A 4LLGF 2F2EA 3MZHA 4U7BA 2KIFA 4A5MA 2EA2A 3Q9VA 5DCMB 1W7PA 3TO6A 1I1GA 4Q5SF 1B6AA 3MEXA 3BOQA 3F21A 1TQMA 3SXYA 2E1NA 1R1TA 2DBBA 3QPHA 5FD5A 1ZRCA 1B4AA 1A04A 1Z7UA 3IWFA 1YS6A 3WGIA 5J8CA 2ISYA 2FNAA 3IWZA 1EV7A 4KIBA 3D5LA 2V9VA 2E7WA 2OQRA 3DV8A 5AONA 4HX4A 4L5IA 4F7ZA 4FX0A 1FBSA 1U6GA 4N9HA 2X4HA 2IA1A 4IHSA 3ZMVA 5E1ZB 1BIAA 3H3ZA 1ZGAA 4XSXF 4U7DA 3VEPA 1JGSA 3CLOA 5ICEA 4HX8A 1HKSA 3S2WA 5FO5A 3GFIA 4ESBA 2PQ8A 2VT3A 1TW2A 4KDPA 4YFNF 2K4BA 3R6SA 3I53A 2IVMA 1YFHA 2DLLA 2M87A 1XSXA 5EEGA 3REOA 5ICGA 1IRFA 2K02A 3RDIA 4BNCA 5E17F 4MHGA 3E3VA 2FMYA 3HHGA 5BS6A 1YYVA 3I54A 2EV0A 4EJOA 4YG2F 2JSCA 2HKXA 1OR7A 1QQIA 2CO5A 2R7FA 2P7VB 2H27A 5LBQA 4KFCA 1TW3A 2IPQX 1OYIA 2HKOA 1BI1A 2QWWA 3HRTA 2VBYA 1ZRFA 2L54A 2Z9OA 1FOKA 1S8NA 2KRFA 3J81Z 1W5TA 1BC7C 2DK8A 1YW9A 5D5VB 1USTA 3V8LA 4PCQA 1J2XA 2V6CA 3KLNA 4I09A 1XB4A 4U0YA 3N97A 1QBJA 3KFWX 3FM3A 5HLIA 5LGUA 3TDUC 1C0WA 2BBYA 5DEQA 2LNBA 4G6QA 5JI6A 3O2PE 2PFBA 4G8XA 5AIQA 2LF8A 1MDMB 3ISPA 2IW5A 3CUQC 3NRVA 1UHMA 5DUKA 2H09A 2JRTA 4DQ2A 1O7LA 1K6OA 1BN5A 3I0TA 4WF2A 1RUNA 3KZYA 2JZYA 3CDHA 1PDNC 4OIPF 4NQWA 1Q1HA 2DPDA 5E8GA 1IXSB 2Y75A 3KP3A 1P92A 4P96A 1XCVA 4Q48A 2K27A 4M71A 2XKPA 4OU0A 1RUOA 1J9IA 2RNJA 3IC7A 4AIHA 1H9GA 1B1BA 1R5GA 4A5NA 5L3DA 5D6EA 5HS8A 3WTYC 1T2KA 5EEHA 1HSJA 4OOIA 4OMZA 4WXCA 2DI3A 3QOPA 4S04A 3HOTA 1MKMA 2IT0A 1SD4A 2QENA 3WTUC 2BV6A 2MH2A 3J80Z 5LHIA 2STWA 3LA3A 1AOYA 4RGXA 1ZGJA 2QQ9A 3T8TA 3EQLF 1U5TC 5ED4A 2Q0OA 5LEJA 1HSTA 1K78A 2OAZA 2O0YA 5JHUA 2HGCA 5ICCA 2VT2A 5IT9Z 2FQ3A 5CVRA 1SFEA 2DK5A 3AAFA 4HDVA 3K9TA 1P4WA 5LGNA 1O3TA 4LD5A 3WE2A 4L9TA 5DYMA 1FYKA 3HRSA 3HRUA 3OV8A 3QU6A 5CJ9A 2QZ8A 4AVPA 2QUFA 2D2WA 2A68F 4LG0B 2F5EA 4UV9A 4AWXB 4P9UA 2FBKA 3SZTA 3HSRA 3WTTC 3GZ6A 3RTRA 5F64A 5L3EA 3GVAA 2KIUA 4RS8A 1REPC 2M30A 2EA4A 1ZG1A 3F6OA 4G7HF 2NAZA 2W24A 1D3YA 4YIFA 3M7GA 4UV8A 2XASA 1IRGA 1NHAA 2BYVE 3GLXA 4BH9A 3R60A 1ZG5A 3LFKA 5D4RA 3ABUA 2VBWA 3HYIA 2HFHA 3CTAA 1FPQA 2K4JA 1F1ZA 3ECOA 4GYGA 1XN7A 2ZNYA 3IKVA 3E5QA 1BI3A 5K5OA 1TQPA 5IT3A 2G9WA 1ULYA 5L3BA 3TO7A 3FXQA 4M74A 4L18B 4EJUA 1KYWA 3CJNA 4MQVA 4TV7A 2A3SA 1IN6A 2HYGD 3ZMUA 2UZKA 1LEBA 1ZLJA 3KLOA 1IZ1A 4I7HA 1YO5C 1QNTA 4I01A 4H0EA 1XSDA 4RAZA 3IL2A 4RGSA 1SMYF 1KU9A 2FSWA 1FBUA 3DF8A 3ML6A 3I59A 1UHWA 4IHTA 3M1EA 3FF5A 4HA8A 4ZYDA 2XRNA 4L9JA 1STZA 3K69A 1MGTA 4UVCA 1IXCA 3QAHA 3CUOA 2XUBA 1R1VA 2G7UA 4EM0B 2ADUA 4I0AA 2MBFA 4GGGA 4G7ZF 2P4WA 3KP5A 1ZARA 4ASNA 3BJAA 3DPLC 3L00A 3E5UA 2A5YB 3F8FA 4LB5A 4LGWA 1U5TB 3DFGA 2JTVA 4XSZF 4P9FA 2ZFWA 3F23A 2VONA 1YQAA 5BPDA 2RGVA 2QBYA 5HDNA 2FMLA 1OYWA 2XKOA 4P55A 2EV6A 3QRFF 1FWZA 2VC0A 4NB5A 2ZBKA 2ESNA 1I5ZA 2P5LC 5BOXA 5LEKA 3HIFA 4PGGA 3TQNA 1PP8F 4ESFA 4ZYHA 1R7JA 4L0ZB 1Z6TA 3HUGA 4CICA 5LHGA 3N4MA 5H6QA 4G9YA 5BPIA 2EK5A 3SZPA 1Z91A 4KIFA 3W6KB 2PG4A 4EMSA 3QP6A 2W57A 2ETHA 3G3ZA 4UUVA 1XDUA 1YG2A 3NQOA 3K1MA 5K5QA 1BC8C 1D8KA 4HBLA 1YS7A 4A12A 3GEZA 5HS7A 3KEQA 2Z99A 2VN2A 2HDCA 1IUYA 2B0LA 4HAMA 3ECHA 3R61A 4ENJA 2HOEA 2QLZA 3B73A 5LHHA 2XVCA 3DKWA 4HLXA 2A61A 5HDGA 5D6FA 5LRSA 2YPRA 4IJAA 5KVRA 4CO8A 3R0AA 3WTXC 1FZPB 5ILVA 2MA3A 1FC3A 3CUQB 1UCRA 3M8EA 1SFXA 5ICFA 3P7NA 2Z33A 2KKOA 1PUEE 5E20A 5D5WB 2DTRA 4RGRA 5K1YA 3MWMA 3ZN1A 4MNUA 2XV4S 4MEXF 3DQVC 1ZRDA 1X3UA 2ISZA 1ODDA 3ULQB 2LF7A 4A0XA 5D8LB 4Y15A 4YIIA 2P8TA 4HZFA 5E8IA 3DXJF 1MJ9A 2K7LA 4WCGA 1D8JA 2W85A 3ZMZA 2STTA 3G73A 2GA1A 3U2RA 1Y0UA 2UXXA 2WWYA 2L01A 2Z5UA 3RYRA 4RB1A 3GUDA 5BMZA 4RB0A 2F5FA 3HSEA 5LLQA 1LB2A 1IN5A 4HF0A 3WTVC 3J80K 1SD7A 4M72A 3TDZC 5TRDA 1WRJA 5DD8A 1XDSA 2DU9A 4OIRF 2DO7A 5LGTA 1YW8A 2L4AA 5DUIA 5FD6A 4U0WA 3FM5A 3BPVA 4IRHA 2DQRA 3FWEA 5F1RA 3GFMA 3GXOA 3FMSA 5E18F 3WU1B 1R00A 4M73A 1FBQA 3FXRA 1LQ1A 2A6EF 2HZTA 3B02A 3SHFA 1DP7P 4U88A 2PLYA 1XSVA 3I59B 2AXLA 2VODA 4P5OA 1XGMA 2GXBA 3I4PA 3OOPA 4U0VA 3R4KA 3BJ6A 1W5SA 1GHCA 2HS5A 2F5DA 4LJZF 4HLYA 1KU7A 1XCBA 3KP4A 3HTSB 5ERIA 3E97A 4XLPF 2ZXJA 3TO9A 2OD5A 4HX7A 4HQEA 2LDUA 4FX4A 3V4GA 3P9KA 4R79A 3VODA 1K78B 2X0LA 3RPUA 1MJAA 3DP7A 1OPCA 2NNNA 5DDGA 3Q5FA 4AIKA 2CYYA 2HTJA 2J5PA 1WSUA 2FOKA 3TGNA 4BHBA 3HSFA 1O3SA 1CF7A 3F3XA 4AD9A 5D5XB 1VTNC 4KN4X 3JAMZ 4KIGA 1MDMA 3WU0A 3GZ5A 3T1BA 3QU3A 2K86A 2IA0A 1DPRA 1L0OC 1LDJA 2D1VA 3ROUA 2E7XA 1LEAA 5CVIA 5F6FA 3BZ6A 3DPTA 1RNLA 3J81K 2ZNZA 1T38A 3E6MA 5IT9K 4EJWA 2IA2A 3SQNA 2V1XA 1H9TA 4LK0F 5A2QZ 2NS0A 2C6YA 2MC3A 3M9AA 1QO0D 3DEUA 4HV6A 1ZG3A 4I2OA 3PFIA 3V8JA 4KYWA 3F8NA 1SD5A 4EJVA 3EYIA 2MLKA 4HF1A 2ZJ2A 4KA4A 5DCFA 4CDGA 1SFUA 3L7WA 2EJRA 5CLSA 3KCCA 2DT5A 4HF2A 4BXUA 2F5CA 2ACJA 1FNNA 1MD0A 2PMHA 1FLIA 4A0ZA 1TNTA 4HYEA 3EETA 3BWGA 4WXDA 1F4KA 1HW5A 3F8MA 1WKMA 3MFKA 4M9XA 2GWRA 1QGPA 1ZLKA 2EFPA 3JTGA 5D8KB 4WK8F 2NNYA 2MH9A 1I27A 3ZN0A 4BHPA 4MTDA 1BM9A 3D0SA 4WWCA 2RN7A 3WTZA 1KGSA 1KQ0A 3RYPA 3JTHA 1V4RA 2YR2A 1QPMA 1CGPA 4YFXF 1BOAA 3JSPA 4OIQF 1USSA 2QM3A 1O3QA 4CYDA 2RVCA 3F8CA 3C1DA 2DW4A 4JQFA 1XMKA 4O6JA 2PEXA 2HQRA 3KE2A 3ZMTA 1BI0A 1XMAA 2Z3YA 4LB6B 4K2EA 2O3FA 1GXPA 4Q47A 3LAJA 2A07F 1FYMA 1ONVA 2UXNA 2CQKA 1S6LA 2XAGA 4BAYA 1YLFA 3LQQA 4I0BA 1J59A 4N0BA 4KN7X 3GW2A 2WV0A 2EFOA 2YX4A 2COMA 1O7FA 4CZZA 4LG0A 1FY7A 3E6CC 1R36A 1P2FA 2M8EA 4KUMA 3P9CA 4L9NA 4AIJA 4KICA 2RV8A 3QP5A 1F5TA 1WWXA 2YX7A 4GXOA 1LVAA 1LDKB 2W25A 1KQ8A 5FLXZ 1JHFA 2XAJA 4KMUX 2P5VA 1U2WA 4EQQA 1U3EM 3JSOA 1P4AA 4G6DA 3C18A 3ZPLA 2PN6A 2HWVA 2GIVA 1DPUA 4EVIA 3FHZA 1FSEA 3V8KA 3F8BA 5DCMA 1T0FA 4ZZDA 2DQLA 4ENKA 2KJBA 3T8RA 3GFJA 1SD6A 5L3GA 5L3FA 3I58A 2OA4A 4NHJA 4LMYA 2CW0F 2ZMEA 1JXSA 2J5OA 4ENMA 2M1BA 1UFMA 3F22A 2PBIA 1TQIA 4B09A 5FLXK 1G3WA 3BJOA 1S7OA 5D4SA 2VBZA 2H6BA 1PP7U 1P6RA 3E6DA 2TDXA 4B8XA 2IJLA 4XLNF 3F72A 1J75A 5CVJA 2WC2A 2BGCA 5KK1A 1AWCA 3GYHX 4MQ9F 2H94A 2HYFA 4UXNA 5L3CA 1J7KA 5FGMA 1B9MA 3WGHA 4CXFA 2VXZA 1OKRA 3Q9SA 3ELKA 3M8FA 3L09A 2BE5F 4LK1F 5K5RA 1F9NA 3FZVA 1R1UA 3KP6A 1HXDA 2Q2EA 4PZJA 4ZH4F 5HVQC 1U8RA 2CFXA 3E6BA 4RAYA 2FU4A 2DAOA 1KQ9A 1ZH5A 1EH6A 4Y13A 1RZ4A 2GA2A 1EH7A 4HDUA 3L2CA 1Z05A 4XBFA 2A6HF 1KU2A 4BHCA 2OQGA 2MD5A 2JT1A 1IAWA 1FX7A 4MGRA 2KJCA 2MLGA 4RGUA 4EM2A 4XRFA 1ZN2A 3BPXA 1SMTA 3CUQA 3SFZA 4EGZA 4MTEA 1YTYA 3CO7C 1BIBA 2ELHA 1ON2A 5DV5A 2FBHA 1B9NA 3KP2A 4LLLA 1CF7B 4A2UA 1R22A 2RKHA 3BDDA 2FBIA 2FEZA 4D0PA 3FMRA 3MZYA 1BJAA 3LWFA 3RPQA 3ZP5A 3K2ZA 5LRRA 3ZQ7A 4I02A 1GXQA 3LA2A 1HW2A 1P4XA 2M45A 3CO6C 3GFLA 1L3LA 2CGPA 2NRAC 3HTUA 3ZMSA 4CHUA 4IRIA 4OMYA 2Y0MA 3FX3A 2JPCA 2V1UA 2HQNA 2CG4A 1G4DA 1YIOA 3WE3A 3EDPA 3KEOA 2H6CA 5CVUA 4E70A 3KP7A 4R1HA 1FT9A 3LAPA 1O3RA 2KIMA 2QBYB 2P6SA 1R23A 4UVBA 1XGOA 1IN8A 4PDKA 4EV0A 4BYYA 3O6BB 1IXRC 4L0YB 3VFZA 3I64A 4IXAA 3W6JB 3BP8A 3T0YA 3R0JA 2OU2A 4KT5C 4BQAA 2FRHA 5ILSA 3U9GA 2LSOA 3L9FA 2XGXA 6PAXA 4L9VA 3T5XA 2CSOA 4FT8A 2GXGA 5JR3A 4ZYGA 1R5HA 1TTYA 4ETSA 2QVOA 3WODF 3K1NA 1W7PB 2DFIA 2AS5F 2A69F 2OZUA 2VBXA 4IPAA 2XHKA 3I71A 3KZZA 5FFZA 1TBXA 4IRGA 2XAHA 4M9ZA 1S29A 4M9SA 2XAQA 1SAXA 1UB9A 1R58A 2GZWA 4Z2YA 5BQTA 1H0MA 4HV5A 1W7PD 2Q8KA 3JW4A 5JVTA 4EGYA 1QZYA 1Z1DA 5CVVA 3HOSA 4PGHA 4KNYA 2NYXA 4RB3C 3C3WA 3RKWA 2EFNA 1IN4A 3RJPA 4JBAA 1OMIA 1S3JA 5J6XA 1O57A 2OZ6A 1FSHA 1Z6RA 3IHUA 4UHTA 2XIGA 1YW7A 5HDKA 1ON1A 1S7AA 2XROA 4ON0A 1OYYA 2ZCWA 5FFXA 1KU3A 2O6GE 3PQKA 4ENNA 4A6DA 4ESJA 2QQBA 3H92A 3V7SA 3MQ0A 3J7AO 4QWQA 4Y17A 4O3MA 2PJPA 3RI4A 4CGZA 4DNCA 1IW7F 4S05A 2M5WA 3I5UA 3IKTA 2R3SA 4EJTA 1BBYA 1ZREA 1JHHA 1HKTA 2EWNA 5ILUA 2FXAA 3VB2A 4HW0A 2EFQA 3KETA 1MZBA 2IP2A 1T39A 3HRMA 3PQJA 5J8FA 4A0YA 2L02A 1D5VA 1J0RA 3QPTA 3U1DA 1KA8A 3IRRA 3RKYA 3FMQA 2LKPA 2VC1A 1K79A 2QQAA 4A6EA 1ZHFA 2O8XA 1T6SA 1KYZA 2HTSA 3WTWC 2V79A 3ERED 2VE8A 1HQCA 1G3SA 2GQQA 2P5KA 1ZYRF 5HOOA 1HKQA 4MEYF 1LNWA 1E17A 4JK1X 2HEOA 4KMFA 2YU3A 1IF1A 1MJBA 3HHHA 3H3UA 4G94A 3LQRA 1E2XA 4G7OF 2JPBA 1IN7A 2XAFA 2OBPA 1G3TA 3P9IA 2V1DA 3E5XA 4L5JA 3V7RA 2WTEA 5E1WA 1FP2A 2E1CA 2VOPA 1LJ9A 5HLGA 2R7DA 3JAMK 4OIOF 1FP1D 1V3FA 2P6TA 2ZKZA 3EUHA 1GVJA 2ZO4A 2VE9A 3TOAA 4UNOA 2EFWA 2VOOA 3ABTA 2UWMA 4EM1A 4RB2C 2D45A 3VOEA 4Q4ZF 2DPUA 2O61A 1WI9A 3WTSC 1DUXC 2W84A 4WXHA 2L3DA 2FA5A 2RDPA 4R8HA 3GX4X 3TKYA 1TNSA 2FNPA 4HOBA 3RIRA 3K0LA 3NEUA 2YSRA
chains in the Genus database with same CATH superfamily
1BI2A 4GCVA 4GYIA 1W4MA 4PJLA 3D1NI 3LL7A 3VYYA 2X1CA 1EH8A 2G7HA 4XNFA 1OCZH 3KX2A 3OSFA 3LA7A 2FE3A 5HLHA 1N32E 3MCZA 2QYOA 3A1YA 1VI0A 2O03A 3S8PA 1MH4A 1FYLA 2DA1A 2DT7B 2RQPA 5DD4A 3IRQA 2WCC3 3M07A 4GO1A 4QLCU 2GBYA 5HODA 3O3KA 4M6XA 4YFKF 5E79C 1IMUA 4PFPA 2ZXHA 1Z9CA 3F6GA 2YU5A 1XGNA 5TISC 1XD7A 2BXYA 3TW6A 4P78A 2KRCA 2HR3A 4ZZLA 2ZXWH 2VI6A 1MBJA 2DFFA 5A2QK 3V7CA 3C7JA 2DYRH 3F6VA 3EYYA 2OF7A 1FMVA 5C4JJ 2W48A 5H6RA 2M0CA 4AYBA 3JR9A 2EOEA 4FE4A 2LTPA 1LLMC 2DA5A 3CLQA 2DFEA 1DDNA 2ESHA 3TOBA 2RREA 1HW1A 1VQ8I 2PMUA 3BROA 2RC4A 4DR5E 2E2HJ 2BB8A 3GTGJ 1WHQA 1LDDA 2P7CB 3BF2A 5B3SH 2IS1A 4I98B 3BR0A 4M6YA 5EYRA 5D5UB 2R7TA 2MKNA 1ZAOA 1GDTA 4DUZE 2YTNA 3MAJA 1U5TA 2K85A 3K4JA 3PM1A 2CV1A 2JR1A 1QU3A 1RI7A 5M3MJ 4DYCA 1I3QJ 4C3JJ 1V5EA 4IF4A 2H1LA 1K7AA 4GDFA 2NVYJ 5HS9A 1A35A 3KPHA 2JXPA 2WADA 3WG9A 3GO5A 5F3WA 2VASA 3WGGA 1IJWC 2GAUA 4IVNA 5CYVA 4FHTA 2XF7A 5IYDJ 3M3YJ 2XRLA 5H20A 1A1GA 3BY6A 2ENAA 4N9IA 3OYCA 2JMWA 1B59A 2PI0A 2EP3A 1ZAAC 1I1SA 2X51A 4UVAA 3A0HC 4ZYEA 1MMGA 1U78A 2ELZA 2EMYA 1G3YA 3GF2A 1WH7A 2JK3A 1WPKA 2N8GA 4R8OA 4R2EA 1FKAE 4DR6E 2L9VA 1T98A 4XR6A 3QPLA 2EB7A 2BEOA 2Y48A 3LSGA 5JFRA 1D1BA 5E1XA 3HOZJ 3EPLA 3BR5A 2NUFA 4DYRA 3LSTA 3E0JB 2O8KA 1TLHB 1I6XA 2EQRA 2L9NA 4WSGA 3KIOA 4HQMA 3DJWA 3KZIC 3FXUA 4O43A 1YOVB 1R9TJ 4IKFA 1XGSA 3CMAI 1TT0A 2ZMEB 5TJJA 1J09A 2L4MA 1G6NA 3BQYA 1A1KA 1J26A 3S93A 3K70D 2V1NA 4NQWB 2B63J 3IP4B 3U1KA 4BXFA 2IRFG 1QZZA 3GWZA 3PUFA 4OINF 2EV5A 3VPRA 4LFUA 2D1HA 5FB2A 4BC7A 3VHTB 3COAC 1J5YA 1W0TA 1WQ2A 3A02A 3K1PA 2FF4A 5AIPA 1JE8A 2L2NA 2WY7Q 2CWEA 1U9NA 5CKTA 3S32A 3ZMDA 1HBXG 4Q28A 3RKXA 2CW8A 4LLNA 1RIOH 4O5VA 1Y8QB 4WX9A 4LLGF 3BG7A 2F2EA 3MZHA 2QSGX 4U7BA 3OYLA 3HUGB 4JYKA 2X6OA 2KIFA 4A5MA 2VQHA 4XOPA 1WJ5A 2CH0A 2EA2A 2JSPA 1W7PA 3Q9VA 5DCMB 4C2MJ 2YSOA 3TO6A 1I1GA 4F55A 3OMLA 4Q5SF 1B6AA 2L9RA 3MEXA 2DODA 1R71A 3KWRA 3BOQA 1A1FA 2H8RA 3F21A 2KDZA 3B6AA 4R2RA 1TQMA 3SXYA 4HPQA 3J7YJ 4GZNC 2E1NA 1R1TA 3GMEA 2BY1A 2DBBA 3QPHA 5FD5A 4G12A 3HL2A 1GQEA 4ZC3A 4K0KE 2UUZA 2I10A 1ZRCA 3BG6A 4XKBA 1QVTA 1B4AA 5FRNA 3MN2A 3J7AY 1A04A 5JLWA 5M3FJ 4DR1E 1Z7UA 3IAM2 3IWFA 1YS6A 2KOUA 4DR4E 3WGIA 2VPRA 3HGGA 3K4CA 1RMDA 3UR3C 5J8CA 2ISYA 4BBYA 2F4IA 2FNAA 1GLNA 1DGCA 4HG2A 3MSWA 4XL9A 3IWZA 3PUBA 1EV7A 4KIBA 3I4MJ 1K83J 1FJGE 3D5LA 2V9VA 2E7WA 2OQRA 1AH5A 1JJ6C 2HDWA 1YYWA 3DV8A 5AONA 2R7QA 4HX4A 4L5IA 4F7ZA 4FX0A 1FBSA 1MBFA 2XB0X 5FKNA 2EM2A 4EEFG 4IO9F 5BR8E 2BY2A 3MKWB 3X2QH 2LVSA 3O8HA 1U6GA 3IWCA 4N9HA 2YU9J 2HNHA 2X4HA 2IA1A 2JA5J 4IHSA 3RKQA 2M7BA 1JTXA 3ZMVA 5E1ZB 1A1IA 2VQLA 1MNEA 1RKTA 2QCOA 4MLQA 1BIAA 1FOXA 3H3ZA 1W1WE 1ZGAA 2M34A 4XSXF 3VEPA 4U7DA 3G71I 2HOSA 1JGSA 1RC7A 3CLOA 4B3TE 2E5ZA 2V88A 5ICEA 4HX8A 2WBUA 2VF1A 1X1PA 1HKSA 3S2WA 3FKJA 5FO5A 1T95A 3GFIA 1T4OA 4M3BA 2F8BA 1YI2I 4ESBA 2PQ8A 3CF5F 4CH7A 2RAEA 3K4BA 2VT3A 1TW2A 1PKPA 1QVUA 3SYTA 2EL6A 2RTXA 1WJCA 3UK3C 2LTRA 4GKJE 2Y31A 4RH8A 3MKYB 4KDPA 4YFNF 2EOIA 1VFCA 4KJZA 1MBGA 2EIJH 3AUZA 2K4BA 2HQ5A 2DB2A 3VYRB 3R6SA 2QKLB 3I53A 3OYAA 4XICA 3L2RA 1VQOI 3L2UA 2JOBA 2IVMA 1YFHA 1T33A 2DLLA 5EGOB 2VJ5A 2EILH 2M87A 1BR1A 4UB6C 4UUSA 3CC7I 1XSXA 5EEGA 3REOA 4BY1J 1T4LB 2L5QA 5J1YA 5ICGA 1IRFA 2K02A 1AA7A 3RDIA 4AVZA 1PJTA 2K40A 3HEFA 4BNCA 5E17F 3BR3A 3FIGA 3HJEA 1ZELA 5GTIC 4MHGA 3E3VA 2FMYA 3HHGA 5BS6A 1YYVA 3I54A 2EV0A 4B44A 4EJOA 2DMIA 1X19A 2P81A 1IUFA 1XMOE 2VQFE 4YG2F 1T56A 4ZTFA 2EOMA 2JSCA 3OIPA 2HKXA 3MZ8A 5F04A 1OR7A 1QQIA 1BB8A 2CO5A 2R7FA 2EMLA 1IV8A 2DLQA 3MMYB 1B72B 2H1KA 2JA7J 3VYXA 2P7VB 1Z0XA 1UHSA 2H27A 5IWAE 3ZQQA 5LBQA 4KFCA 1TW3A 1G2FC 2IPQX 3BT9A 4F92B 1OYIA 2W4SA 2HKOA 1BI1A 2ECCA 1N33E 2M4KA 2QWWA 2DXIA 4XIDA 3HRTA 2IS4A 3I3LA 2HHHE 3H0GJ 2VBYA 2VQGA 1ZRFA 3FIWA 2L54A 4CYCA 2ECBA 3D5SC 2Z9OA 3S1MJ 1WI3A 1FOKA 1S8NA 1XNQE 4DIQA 2KRFA 3J81Z 1HNZE 1W5TA 1MSEC 3MHSC 1XC5A 1BC7C 2DK8A 2YUSA 1A1JA 1YW9A 2HPMA 1TT5B 5D5VB 1USTA 1NG7A 2A25A 3V8LA 1VQLI 3ZOBA 3CJRB 3W2AA 4PCQA 3J7Yp 1J2XA 2KIQA 2V6CA 3KLNA 4I09A 4JI2E 3SDGA 2CW7A 1XB4A 3MKLA 4JI6E 5M5XJ 2OTLI 1Z3XA 2EPMX 4U0YA 3N97A 3DU6A 9ANTA 4DMIA 1UELB 1TWHJ 3ABLH 2YS9A 1QBJA 3KFWX 3FM3A 4AM3A 3CCQI 5A6KA 5HLIA 5LGUA 4A3GJ 3TDUC 1C0WA 4BDZA 1BR2A 5J1UA 2BBYA 5DEQA 2VRDA 2LNBA 4G6QA 1ETWA 4C3IJ 1LPQA 1IQSA 5JI6A 3TEDA 3FBNB 4AYBN 3VSKA 3O2PE 2PFBA 4G8XA 5AIQA 2BZTA 3K2AA 1A6QA 2LF8A 1ZR4A 2KZVA 3ISPA 1MDMB 2PJRA 2IW5A 3ZQCA 3CUQC 4G6TB 3DKYA 3NRVA 1UHMA 2DCEA 4IZZA 4FK5C 5DUKA 3RZDJ 3HOWJ 2HXOA 2H09A 2FV4B 2JRTA 4DQ2A 1X3ZB 1O7LA 1K6OA 2EM0A 1BN5A 3BR6A 3I0TA 5EEAA 5EG0A 1WJDA 2GLOA 4WF2A 2E5LE 2KHXA 3IWBA 2WA0A 3ADLA 1SFKA 1RUNA 1MSFC 1DP3A 2EN8A 3CCUI 5AE1A 3KZYA 3OYNA 4LF9E 1YX3A 3BTCA 5A6AA 3DTKA 2JZYA 3CDHA 1XNRE 5EJCA 1PDNC 2L7MP 2DMUA 3JRAA 2HVRA 5F0CA 4NC8A 4OIPF 4NQWA 2LKSA 1Q1HA 1TL8A 2CV2A 5E8GA 2DPDA 1R4MB 1HLVA 1FEXA 1I3AA 1IXSB 2K9QA 1VQ4I 3HPZA 3HXLA 1MBKA 2JA6J 1XMQE 2Y75A 2CUZA 2IEKA 3FXMA 3KP3A 3HPGA 1P92A 4P96A 3BG5A 1XCVA 1XMXA 2X85A 2V9KA 4Q48A 4RAGA 2K27A 4M71A 2CT1A 2EQ3A 2YPNA 2XKPA 4OU0A 1RUOA 1J9IA 2RNJA 2QSHX 2I5UA 4PK4A 1TWAJ 3IC7A 3ZQGA 5ADZA 4AIHA 2VLAA 1H9GA 1B1BA 1SFOJ 1R5GA 2XB5A 4A5NA 3IH4A 1DGWY 3MD2A 5LMUE 3IH2A 2KLOA 5L3DA 2IHR1 4NHRA 2EN1A 5D6EA 3NWSA 5HS8A 3WTYC 2CQNA 4X62E 4CA0A 2WAQA 2FD5A 1IGNA 1T2KA 2CUEA 2BVMA 3BG9A 3DCFA 5EEHA 3SEZA 2ME0A 1HSJA 4QTRA 2YRMA 4OOIA 2W1OA 4BACA 4OMZA 4WXCA 2DI3A 3QOPA 4NXME 2EZLA 4M3EA 5M5YJ 4S04A 3HOTA 2Y30A 3QQAA 5KL5A 1B8IB 2EPXA 1MKMA 2IT0A 1SD4A 3S2DJ 2R76A 3QPSA 1AKHA 2QENA 2EOQA 3WTUC 3GZNB 2BV6A 5FKMA 2MH2A 4DW6A 2RQQA 4B4CA 2COBA 3CC2I 3J80Z 3RQ4A 2EMIA 4YY3E 4R2QA 5LHIA 2NOGA 2STWA 5A6BD 2LD5A 3LA3A 1AOYA 2L6MA 4Y33A 4D7MA 4RGXA 1ZGJA 4BBSJ 2QQ9A 4QPQA 1GZ6A 5KHDA 4KISA 2YTIA 1J5EE 2MFZA 3T8TA 3DKXA 3EQLF 1A31A 2JA2A 1U5TC 1W5CC 5ED4A 1DU0A 2WAFA 3BBGA 2Q0OA 3RMPA 5LEJA 2DGCA 2L0KA 1HSTA 4X6AJ 1K78A 2OAZA 2F4VE 2O0YA 5IP9J 2R93J 3I9V2 2HYJA 2AQEA 3OL3A 1YITI 2EPNA 4MIMA 5JHUA 2JVAA 3C6KA 2HGCA 5ICCA 1V5FA 2VT2A 2LUPB 3IH3A 1YHQI 5IT9Z 4UUSB 2CS3A 3MHHC 2FQ3A 5CVRA 4ZDLA 3RQIA 5GAGJ 1SFEA 2DK5A 2E1MC 1N25A 1EA3A 3OIOA 2ENHA 1A1HA 2IGNA 1WXRA 3KYLA 3AAFA 4R2PA 4HDVA 2EMZA 2V9PA 3K9TA 1P4WA 1S7EA 4D5CA 5LGNA 2EM9A 2LV2A 4TUGA 1O3TA 4PJJA 4LD5A 3WE2A 4L9TA 5DYMA 5DTDA 1D5YA 2E1OA 1XPXA 1XTAA 2Q1ZB 1FYKA 3HRSA 1F2IG 2E1MA 3HRUA 3OV8A 3QU6A 5CJ9A 2QZ8A 4AVPA 1M1EB 2QUFA 3JREA 1N36E 1ETKA 2LTSA 2E19A 2CV0A 4E7KA 1MNMC 2D2WA 4S0HB 1WJFA 2A68F 4LG0B 1ZBTA 2F5EA 4UV9A 4X1EA 4AWXB 2EOFA 4P9UA 2KISA 2FBKA 1YYOA 1P47A 3SZTA 3PNYA 5A6BA 3HSRA 3K4MA 3DEEA 2BY3A 4XQFA 1GUUA 3WTTC 3GZ6A 2K9SA 3RTRA 2VUMJ 3I4NJ 5F64A 3H3VK 5L3EA 4LITA 2YRHA 4A3JJ 2CRGA 3GVAA 1A5JA 2KIUA 4RS8A 1REPC 2M30A 2EA4A 2EPZA 1ZG1A 3F6OA 4G7HF 4F54A 2XGDA 3CMMA 4FQGA 5E3OA 1O0WA 2NAZA 4JYAE 2W24A 1D3YA 4YIFA 5IPAA 1UHZA 3M7GA 4UV8A 2XASA 1IRGA 1HCRA 3AG2H 1B8IA 1NHAA 2BYVE 3GLXA 4BH9A 3L2QA 2LUQA 4A3DJ 1FJLA 1Z3YA 3GBGA 2L3CA 1JT6A 3R60A 1ZG5A 3LFKA 5D4RA 3ABUA 2VBWA 3HYIA 3PSFA 2HFHA 4V2FA 2YRKA 3CTAA 1FPQA 3FXOA 1W36D 1X48A 2K4JA 1VQ5I 1F1ZA 3ECOA 4A69C 1HDDC 4GYGA 2J7JA 1XN7A 2ZNYA 1MEYC 1QZEA 1TWCJ 1PJRA 3MKZA 3IKVA 3E5QA 3LSRA 4IJDA 5H2FC 1BI3A 5K5OA 1TQPA 5IT3A 4B43A 3I56I 1Y6IA 2VKHA 2G9WA 1ULYA 4D9JA 5L3BA 4FETA 1TWFJ 4O24A 3TO7A 3FXQA 4M74A 3OSGA 1RESA 2QA4I 4L18B 4EJUA 1KYWA 3CJNA 3H0DA 3G1LA 1X2MA 4MQVA 2GHFA 1G8XA 2HZDA 1WVRA 4TV7A 1DQ3A 2A3SA 2WBTA 2XPVA 1IN6A 2HYGD 1EJ9A 4NDLA 2I8DA 3HKZN 2EWLA 3G1MA 1ETXA 2EIMH 3ZMUA 3JTZA 1S5LC 2UZKA 1LEBA 1ZLJA 5AASA 1Y1WJ 2XF5A 3KLOA 1IZ1A 4I7HA 1YO5C 2Z1DA 1QNTA 4I01A 1ZR9A 4H0EA 1I6HJ 2BY0A 2NS7A 4RAZA 4RGSA 4B48A 3IL2A 1SMYF 5F0FA 1XSDA 1KU9A 3C4BA 5T6JA 3F0CA 2FSWA 4TUIA 4B3ME 1IQOA 3K4LA 2EL5A 1FBUA 3DF8A 3ML6A 2IAIA 3DPUA 3FISA 2LJHA 3K4NA 3I59A 1UHWA 4BCAA 1YJ9I 2YZTA 3C2HA 1Y56A 2EM8A 4DYQA 3C4TA 4IHTA 3PL8A 4B3RE 3M1EA 3FF5A 4HA8A 2XC7A 4F9CB 3CJTB 4ZYDA 2E1MB 2XRNA 4JI8E 2JUCA 4HNTA 2HOTA 4L9JA 1STZA 3K69A 2YTPA 1MGTA 4UVCA 1G2DC 2K9NA 3TW7A 4BL0B 5IXMB 1IXCA 2ZM6E 4LF7E 4Y3OA 2QGUA 2LMDA 3QAHA 2IGOA 3CUOA 4NZVA 5KL4A 3HTXA 1HDPA 2XUBA 1BW6A 2K3PA 4J8ZA 2LRDA 1VZ0A 1R6RA 1R1VA 2G7UA 4EM0B 2ADUA 4I0AA 1JKOC 2MBFA 2VKVA 4GGGA 4G7ZF 4JI3E 2P4WA 3KP5A 1ZARA 4ASNA 1ZU1A 4YEJA 3BJAA 3DPLC 2VE7C 2DYSH 4II2A 3L00A 1SANA 2A5YB 3E5UA 3F8FA 4LB5A 1UG2A 4LGWA 1U5TB 3DFGA 4JX4A 1FOYA 2JTVA 2X6YA 2JUGA 3CJQB 3OIQA 4XSZF 3CQZJ 4CUGA 2WBSA 4P9FA 2ZFWA 2R7XA 4BGDA 2UUBE 1ORKA 3F23A 1IO2A 2VONA 3GTJJ 2ODRC 4XMYA 1YQAA 2D9HA 1MW7A 3VYSB 5BPDA 3BTJA 1UILA 2RGVA 1JUMA 3FK7A 3LOCA 2QBYA 2V83A 5HDNA 5LMNE 2FMLA 4JI7E 4W1UA 1OYWA 2XKOA 4P55A 2EV6A 3S3OA 1KYQA 2LCEA 2EZHA 3QRFF 2YTJA 3VWBA 1FWZA 2BHZA 3ABMH 2EMAA 2VC0A 4NB5A 2ZBKA 1PUFB 2ESNA 2ICWG 1I5ZA 2P5LC 3VSLA 2LC2A 5BOXA 4DR7E 2L9SA 5LEKA 1X2NA 2OCEA 1WJPA 3HIFA 4PGGA 3TQNA 1PP8F 4ESFA 4ZYHA 3BZKA 1R5ID 1R7JA 4L0ZB 4X66E 1Z6TA 3U21A 3HUGA 4CICA 2WY8Q 5LHGA 1NTCA 3LSJA 4DV6E 2HQAA 1A6IA 3N4MA 5H6QA 4G9YA 5BPIA 2EK5A 3SZPA 1GV2A 1Z91A 4ANJA 4KIFA 2NXNB 3W6KB 2PG4A 3BCAA 3QP6A 4EMSA 2CSHA 4KWYA 3RCOA 3KEYA 2W57A 3V42A 2ETHA 4F2JC 3FXJA 3G3ZA 5IY5H 4UUVA 1XDUA 1YG2A 2X1EA 3K1MA 3NQOA 5K5QA 2MSYA 3L2VA 1BC8C 1D8KA 4HBLA 5EZGA 1YS7A 4A12A 2DJNA 1FTTA 1N77A 3C2GA 2R5ZB 1ETQA 4XLAA 4BC9A 3GEZA 2MGQA 5HS7A 4ABZA 3KEQA 3SZGA 2Z99A 2M0MA 2VN2A 2HDCA 1QU6A 2EBIA 2IXSA 3OYKA 2EM6A 1HR0E 1RPWA 4UY8I 1NG6A 2N3GA 1IUYA 1WHUA 2B0LA 4AUXA 4ZYAA 4HAMA 3CCLI 3GTLJ 3S14J 4WSPA 3ECHA 3WG7H 1IG7A 1OCRH 3RZOJ 3R61A 4ENJA 2UXBE 2HOEA 2QLZA 3B73A 3A01B 4X8WA 4I8OA 4L5EA 5LHHA 2XVCA 3ZQLA 3DKWA 3HM5A 4CYCB 4HLXA 1APLC 2A61A 4QIWN 2KT0A 2ZMEC 1DGRM 5HDGA 5D6FA 2EL4A 2EPAA 2QSFX 3K6QA 5LRSA 2DA4A 2YPRA 2QQ8A 4IJAA 2QKMB 5KVRA 4CO8A 2EOOA 2K9LA 3R0AA 3WTXC 1FZPB 4LIUA 5EF6A 1LE8B 2KDOA 1JKQC 5ILVA 1MMAA 2MA3A 1FC3A 3CUQB 1GT0C 1HOMA 1OQYA 1WJAA 2ODRD 1UCRA 2DMQA 5FROA 3OYIA 2RSIA 5IV8B 1MH3A 3M8EA 3K70C 5CQGA 4C30A 1SFXA 2R1FA 3HDDA 3P5JA 3OY9A 3S1QJ 5ICFA 2WB1N 3P7NA 2WZOA 2Z33A 2KKOA 1JJ8C 1PUEE 2KL4A 5E20A 5D5WB 1ZK8A 1MIJA 2DTRA 4RGRA 4HNUA 4F93B 2R7WA 3G4SI 3O8GA 3ZXSA 3NWTA 3MWMA 5K1YA 3ZN1A 4MNUA 2XV4S 5HLTA 3LNQA 4CCOA 4MEXF 3DQVC 2Y9ZA 1ZRDA 2L2MA 1X3UA 2EIKH 2XDVA 4DV4E 2ISZA 1ODDA 2VJJA 3ULQB 3K10A 2VQEE 4KITB 1MBHA 3EUAA 2EM4A 2DIXA 3TBIA 2ELKA 1OFCX 2LF7A 4A0XA 5D8LB 4Y15A 4YIIA 4RHBB 4Y4RA 2NUEA 4M6VA 4HEA2 2ZJRF 3TP3A 1ZQ3P 2P8TA 2PMZN 4HZFA 5E8IA 1F36A 1B69A 3DXJF 2DJIA 2YTGA 4BQOA 2OTJI 1MJ9A 4UUTA 4D5FA 2K7LA 3DU5A 4WCGA 4XN3A 1D8JA 2M4IA 4AU7A 2W85A 2R4GA 3E1SA 4RAFA 3ZMZA 4BKXA 2STTA 4E6KG 2LVHA 2VB6A 1O4XA 3G73A 2GA1A 2EQ0A 1UZCA 3U2RA 5IP6A 1Y0UA 1NEIA 2MC4A 2UXXA 5K7FA 1JK2A 2WWYA 1YIJI 2L01A 4CZCA 3AFHA 3BG3A 1RETA 2Z5UA 3RYRA 2NVQJ 1WH5A 4CSWA 4RB1A 3GUDA 2HDDA 5BMZA 2EPKX 2OCCH 4DR3E 4RB0A 2F5FA 3HSEA 1E3PA 2L7FP 4E7JA 5LLQA 1UBDC 1LB2A 1IN5A 4HF0A 3WTVC 5BNGA 2FOWA 3J80K 1SD7A 4M72A 3CESA 3C2BA 4DZJA 1X58A 2PX9A 3ESWB 3TDZC 1MMSA 2K7IA 2KFDA 2NA2A 2UXCE 2EN3A 5TRDA 1WRJA 4BDYA 5DD8A 2EPCA 2MG4A 1XDSA 2Y2ZA 4XKVA 5DM6F 3ONQA 1SVOA 1IBME 3H5RA 2DU9A 4OIRF 1EF4A 2R7RA 1QRYA 2JP9A 2DO7A 2AQFA 2VPLA 5LGTA 1YW8A 3TP0A 2DN0A 1X3WB 4JV5E 2GPIA 2H36X 2L4AA 2FUG2 5DUIA 2X6WA 3ZRGA 5FD6A 2MC5A 1IRZA 4X0GA 2NVTJ 2W00A 2B7VA 2I9IA 5LD2C 4U0WA 1W36C 3FM5A 2WV1A 3BPVA 4A93J 4IRHA 2DQRA 3FWEA 5F1RA 4Y7NJ 3GFMA 2MABA 3GXOA 3FMSA 5E18F 2CMPA 3WU1B 1R00A 2V6EA 2VJ4A 4M73A 1FBQA 4I76A 3FXRA 2V89A 2ZXIA 2A6EF 2HZTA 2XPUA 3B02A 3SHFA 1LQ1A 1DP7P 2LBSB 3HZJA 4OAZA 1LUJB 4U88A 2PLYA 1XSVA 5LL6R 1OLTA 3I59B 2XPWA 2AXLA 4E7ZA 2VODA 1UG0A 2EN7A 2VKDA 1U0JA 4P5OA 1XGMA 2GXBA 3I4PA 3OOPA 5AC5A 4U0VA 3R4KA 2ID6A 1W5SA 3BJ6A 3TL4X 2JQ7A 4DV3E 3IV5A 1X1BA 3IAS2 2DOAA 4HTGA 2Y69H 3HKZA 3OYHA 5JHFA 1OR7C 2HS5A 2F5DA 4LJZF 3OL4A 1BW5A 1GHCA 2LY9A 4HLYA 3AV0A 1KU7A 1XCBA 3KP4A 3HTSB 5ERIA 1WGXA 4M30A 3E97A 4XLPF 3HOVJ 2ZXJA 2EN6A 3TO9A 2OD5A 4HX7A 4HQEA 2LDUA 4FX4A 3V4GA 3P9KA 4R79A 4LF8E 3AG4H 2FJ1A 2LBFA 3W3CA 2VXDA 1TN9A 1YZ9A 5KL3A 3EUKL 5E3NA 4HSRA 3VODA 1K78B 1X1DA 2X0LA 4C9YA 4XK4A 3RPUA 3OYDA 1MJAA 4XKCA 4OAYA 3DP7A 2R5YB 2LG4A 3T1HE 2LO3A 1OPCA 2NNNA 2V86A 3ZQHA 5DDGA 4RA2A 3Q0WA 3Q5FA 4AIKA 1D0ZA 4LTYA 2JVHA 4E7IA 4DZPA 1PJSA 2CYYA 1DI2A 4RBOA 3BQZA 3ZCOA 3VK6A 4XRSA 4C2UA 2HTJA 3D5RC 2J5PA 3CCEI 1POGA 1B72A 4PJNA 1WSUA 4LOCA 4XLHA 4X9JA 4DR2E 2FOKA 3TGNA 4BHBA 3HSFA 2EPUA 1O3SA 1CF7A 3F3XA 4AD9A 2OPTA 5D5XB 2R5ZA 1XG1A 1VTNC 4KN4X 5C3EJ 3JAMZ 4KIGA 1MDMA 4RLQA 2Z16A 2ZJQF 1GVDA 3ADJA 3WU0A 1HA8A 1X5WA 4FASD 1I94E 5A6JA 3GZ5A 1U9OA 3T1BA 1VQKI 3QU3A 5IOZA 2K86A 2IA0A 3OYBA 2LOOA 1DPRA 2LBFB 3JU0A 3JRFA 3QYFA 1JTYA 1L0OC 3PNVA 4JP0A 4C2TA 4IQJA 1JUPA 1LDJA 4BU2A 1JGGA 3ZGKA 2D1VA 3ROUA 2E7XA 1LEAA 5CVIA 5F6FA 3BZ6A 3GTKJ 1HC8A 3DPTA 4B1RA 1RNLA 4KZSA 1ETOA 2NS8A 1PJQA 3UNGC 3LMMA 1WFXA 3J81K 2BW3B 2ZNZA 3GTMJ 1T38A 4NUBA 4F3QA 3E6MA 3AL0B 4EJWA 2IA2A 3SQNA 5IT9K 1TF3A 4M3FA 2V1XA 1H9TA 4LK0F 5A2QZ 3B6CA 2NS0A 2M2EA 5B1AH 2MC3A 2C6YA 3M9AA 2EMXA 1QO0D 3DEUA 3JRHA 4HV6A 3THNA 3JRDA 1ZG3A 2W82A 5KAIC 4P7DA 5IYBJ 4I2OA 5IYCJ 1IDYA 3LSMA 5EDNA 1RKWA 3F9KA 3PFIA 4H4KC 3V8JA 1FOWA 3WHBA 3PIOF 1K61A 4KYWA 3F8NA 2M7QA 2LYCA 1SD5A 2JA8J 2BVLA 4EJVA 3EYIA 2ZC2A 2MLKA 4IHWA 4HF1A 2ZJ2A 4KA4A 2WAEA 5DCFA 4CDGA 1QHHD 3H36A 2EH3A 1SFUA 4GEQB 3L7WA 2EJRA 1BA5A 5CLSA 2UUAE 3KCCA 1KONA 4FE7A 2DT5A 4HF2A 4R2CA 5AC4A 4QSHA 1X4PA 2F5CA 4BXUA 2EMGA 5GPCA 2ME6A 5KL7A 3DBHB 4DBRA 1A1LA 2TCTA 4PSWA 2ACJA 4R2SA 1FNNA 5EZHA 3LMLA 1MD0A 2PMHA 3SJMA 2PMZA 5GAHJ 1FLIA 3HC7A 4PFOA 2ADRA 4A0ZA 2OV7A 3OWTA 1YSAC 1ITYA 4V19K 1TNTA 3H09A 5FLXC 4HYEA 1SVLA 1IRXA 3OR2C 4Q35B 1WJEA 5B5EC 3EETA 2M9AA 2NUGA 1LVKA 4A3IJ 2X6XA 3S15J 3BWGA 3QYEA 3RPUD 2E60A 4CCNA 1WHNA 4DBQA 1D1AA 2DMYA 4WXDA 1W0UA 2JPAA 1F4KA 4Z6YA 1HW5A 2CJJA 1WKMA 3F8MA 3GLLA 2YTFA 3CDLA 4Y52J 1VQMI 2CU7A 3MFKA 2LR8A 4M9XA 2DT6A 2GWRA 1PYVA 1QGPA 2A6TA 4AIDA 3BZCA 1ZLKA 2EFPA 3CCJI 2HXIA 4IOAF 3JTGA 5D8KB 3CZ6A 1IV6A 4WK8F 2NNYA 2MH9A 1I27A 3CMEI 3ZN0A 3N05A 3DWLE 3BCBA 4BHPA 1IBLE 1T4NA 4MTDA 2CPNA 2X1DA 1BM9A 3D0SA 3QODA 2CQXA 4WWCA 4GRIA 4MFDA 2RN7A 1TP4A 3J80C 3WTZA 1KGSA 1NK2P 4JX5A 3IWDA 2FX0A 4AC0A 2V85A 1AHDP 3H9QA 3AKZA 3PO3J 1KQ0A 3RYPA 3JTHA 1MMNA 2EPOA 4IEJA 1Z1BA 1MBEA 1IBKE 2JN6A 2BW3A 2L2OA 4PJMA 3CCVI 2YTDA 4JI5E 1V4RA 3L1PA 2YR2A 4IS1C 3HBLA 1QPMA 1CQTA 2XGEA 4WFTA 4BEHB 1CGPA 1VQNI 4YFXF 4WYQB 3GTOJ 4A3LJ 1BOAA 4A3MJ 3JSPA 4BQQA 4OIQF 4LG3A 1K4TA 3K7AJ 3HGYA 1USSA 1Y0NA 1G59A 3OS1A 2QM3A 5KAFC 3J7ZI 1O3QA 4NC7A 2IGMA 1GV5A 2RVCA 4CYDA 1JUSA 4BE1A 1F43A 2EPFA 1Y39A 3F8CA 3A03A 2HVQA 1SAUA 3C1DA 2DW4A 1H8AC 3BIDA 2CFOA 3OMYA 1XX5A 4JQFA 3HOXJ 4HNVA 2R7UA 1Z21A 1XMKA 1Z7LA 2E5NA 4O6JA 5FJ8J 2PEXA 1BR4A 2HQRA 3KE2A 3ZMTA 1VQPI 4IHVA 1BI0A 1XMAA 1Y8RB 4ZDOA 3CP2A 1D0YA 2Z3YA 2EM7A 4FCYA 4LB6B 4DV7E 4JI1E 3LSIA 4K2EA 2O3FA 3ZOQB 5GP9A 3W6VA 1D0XA 1GXPA 4Q47A 1YYKA 5IT9C 1SC7A 4IHXA 3LAJA 2Y0SA 4WPYA 3Q3SA 2A07F 1FYMA 1ONVA 5DNYA 3CC4I 4M9VC 2I13A 3JRGA 2UXNA 2CQKA 1S6LA 2XAGA 4BAYA 3AG1H 2ELYA 4C3HJ 1YLFA 2HPIA 3LQQA 4I0BA 3BLYA 4NNJA 4BXXJ 1J59A 4N0BA 4BS9A 4JI0E 2KHMA 4KN7X 1K4SA 3GW2A 2WV0A 1S9HA 2GXAA 2MC6A 5A69A 3M8JA 2EFOA 2YX4A 4J19A 1BJZA 2COMA 1O7FA 4CZZA 2MDGA 1OCTC 2VQCA 4LG0A 2CUJA 1FY7A 3PSIA 5FKLA 2R5YA 3E6CC 1R36A 1P2FA 2DOFA 2M8EA 2ZB9A 1L4SA 4KUMA 3BC8A 3CCRI 2E72A 3H5NA 2QF7A 3P9CA 1HNWE 4NC6A 4L9NA 4AIJA 2D5VA 5GAEJ 4KICA 4JX6A 2EZKA 1X4OA 2RV8A 3A4CA 3HOUJ 4DV2E 1S72I 3QP5A 4HSTA 1F5TA 1WWXA 3ZR8X 2XF6A 2YX7A 2DTZA 1LVAA 1LDKB 2W25A 4GXOA 2MW8A 3PNTA 1KQ8A 5FLXZ 1JHFA 1TC3C 2XGCA 5CQEA 2XAJA 4KMUX 2P5VA 1X47A 3UKGA 3ADIA 2KQRA 5LFAA 1U2WA 4EQQA 1R4NB 4LFAE 3JRIA 1U3EM 4F6MA 3JSOA 2EPLX 3SFIA 1RR7A 3K4KA 5KL2A 1P4AA 4A3BJ 2EN2A 2MKDA 2EOSA 4G6DA 3C18A 1Y1VJ 3ZPLA 2DA2A 2JVGA 1N75A 2HWVA 2PN6A 1Z77A 2GIVA 5GTHC 1DPUA 4EVIA 3FHZA 1YUIA 4MO7A 1FSEA 3V8KA 2IS6A 1V54H 2EPPA 2LT7A 2R0QC 4W97A 3F8BA 3K6GA 3ASNH 3G6EI 5DCMA 5J47A 1T0FA 4ZZDA 2DQLA 4ENKA 2NVXJ 2KJBA 5B1BH 3ECRA 2Z2SB 3T8RA 3GFJA 2F6CA 2DMNA 1SD6A 3C6MA 1U8BA 2AO9A 5L3GA 5L3FA 2WB1A 3I58A 4V2GA 2OA4A 4NHJA 2EZIA 4LMYA 2UUCE 2B9DA 2CW0F 1QPIA 1MNDA 2L3JA 2ZMEA 5DS9A 2GIZA 4XKWA 4HRIA 2NVUB 1JXSA 2X9DA 1KZHA 2VJIA 3OTOE 2HU9A 2EINH 4DGWB 2J5OA 4ENMA 2M1BA 1UFMA 4JOMA 5KCMA 2RPCA 4J00A 2A05A 2GLIA 2K5CA 3ERMA 5K7HA 2FTXB 3F22A 2PBIA 4DUYE 2LKXA 1TQIA 4IX7A 2E35A 5FKOA 4B09A 5FLXK 1TF6A 1G3WA 3BJOA 1S7OA 2H8WA 1WZ2A 5F08A 5D4SA 2VBZA 2LY1A 2H6BA 4M3GA 1EKZA 1PP7U 1P6RA 3E6DA 2EZ6A 2TDXA 4B8XA 2IJLA 4XLNF 4I6ZA 3F72A 2O7OA 1J75A 3PIPF 1ETYA 2CUFA 5CVJA 2WC2A 2BGCA 5KK1A 1AWCA 2L7ZA 3GYHX 3GTQJ 2B7EA 4OWRB 4MQ9F 2UV1A 2H94A 1YUJA 2M9HA 1JI8A 5FLVA 1YRNA 4ZJZA 2R92J 2HYFA 2ENCA 2EOZA 4UXNA 5L3CA 3FBIB 1J7KA 5FGMA 1FTZA 1B9MA 1X1CA 3S16J 3G2BA 3WGHA 4CXFA 4YELA 4LFCE 2ID3A 4XN0A 2VXZA 1OKRA 4KHPE 3Q9SA 4N4OB 5KNLA 2YTOA 3ELKA 3M8FA 3L09A 2BE5F 2HJJA 4RMNA 4LK1F 1ACIA 2VL8A 5K5RA 2NOJB 5GPAA 1F9NA 3CD6I 3FZVA 1R1UA 2GOXB 3G1OA 3KP6A 1HXDA 2EQ1A 2DRPA 4A3CJ 2Q2EA 4PZJA 4ZH4F 2LE2A 2YT4A 2A5WA 5HVQC 4JI4E 1U8RA 2CFXA 3E6BA 3ZQIA 4RAYA 1K6YA 2FU4A 2DAOA 4CCMA 1KQ9A 3FXKA 1ZH5A 1EH6A 1MMDA 1RZ4A 2GA2A 3A0BC 4Y13A 1H89C 2HI3A 1X6EA 2Q8UA 3S1RJ 1EH7A 4HDUA 4XLFA 4F52A 3J81C 3L2CA 2L33A 4F9AB 4ITVA 2EOHA 1Z05A 4XBFA 2A6HF 1KU2A 3EPZA 4BHCA 2OQGA 2Y9YA 2R7OA 5HNFA 5JVGF 2MD5A 1JKPC 2JT1A 1UN6B 1IAWA 3DTIA 2N3HA 1FX7A 1I39A 4MGRA 5TSEA 2KJCA 1G2HA 2MLGA 1E3HA 4RGUA 4CCKA 2B9SA 4EM2A 3BTLA 4XRFA 1ZN2A 2AXTC 3BPXA 4DV0E 1SMTA 3CUQA 3SFZA 4EGZA 4MTEA 1R49A 5J3LA 3S3MA 1YTYA 2RSMA 3CO7C 1BIBA 4NBQA 2ELHA 4GKKE 3OS2A 3W2VA 1ON2A 4E7SA 1NK3P 2M8GX 4LF4E 3WHCA 5DV5A 2V4JC 2FBHA 1PDAA 1B9NA 3BR2A 3S3NA 1RR8C 3CCYA 4OOGC 5KL6A 3KP2A 5C4XJ 4LLLA 2RQLA 1T0FC 1CF7B 4A2UA 1R22A 2KPMA 2RKHA 3BDDA 2LJUA 2ZFUA 4U87A 2Q2EB 2FBIA 2HOAA 3NARA 2FEZA 4D0PA 5IP7J 3FMRA 4J01A 3KYDB 3HQ1A 4YIRX 3HOYJ 3SDBA 1X6FA 2ZSIB 3MZYA 1X6HA 1BJAA 5C44J 3CF2A 3OYFA 3LWFA 2DA3A 3RPQA 4F91B 3ZP5A 3K2ZA 1TZLA 2EJ4A 5LRRA 2JYAA 4BE0A 2BHYA 2IS2A 3H1CA 3ZQ7A 4I02A 1GXQA 4A3KJ 3LA2A 3Q0VA 4M2ZA 2ZSHB 1YX5A 2M7AA 2P0WA 1HW2A 1P4XA 3EPJA 3GCMA 3LSPA 1E3OC 2M45A 1I50J 3BTIA 5CPRB 4R2DA 2HGHA 2LFBA 3CO6C 3GFLA 1BBOA 4E4HA 2XSDC 1L3LA 1SR9A 2CGPA 5K7ZA 1FIPA 3HTUA 2NRAC 3M99B 4L8NA 4EATA 2KZGA 3CMYA 3ZMSA 4CHUA 1WCMJ 2BBGA 4F6NA 4IRIA 4OMYA 2Y0MA 3FX3A 2JPCA 4D7NA 2HQNA 2V1UA 2EMFA 2CG4A 2OJED 1RRJA 4RLFA 4B3AA 1YIOA 1G4DA 3WE3A 2EOYA 1OCOH 3EDPA 2HVSA 3FHNA 2H6CA 3KEOA 5CVUA 1QA6A 4E70A 2EN4A 4DV5E 3KP7A 3OR1C 4R1HA 1FT9A 2DMTA 5F1JA 2VIXA 2AHQA 3LAPA 1O3RA 3QWLA 2KIMA 2FQ4A 2P6SA 1R23A 4UVBA 1XGOA 2QBYB 1IN8A 1PVEA 3AG3H 2LREA 5FRMA 1EKEA 3H5AA 4PDKA 4UB8C 4XONA 4EV0A 4AQYE 2O9LA 4II3A 2LRSA 4BYYA 3O6BB 1IXRC 2LY2A 5E3MA 2XAUA 2Y0SN 2YSPA 4A3FJ 1PUFA 1ZBQA 5B66C 1T8IA 4L0YB 4BMJA 4OX9E 2EMCA 1DU6A 4BQNA 3ADGA 2DA6A 3VFZA 3I64A 4R2AA 4IXAA 3EPHA 3W6JB 2E2JJ 3BP8A 3T0YA 3R0JA 2OU2A 3HG9A 3BR1A 4MFEA 3JAMC 1DQUA 4KT5C 2G0EA 2FRHA 4RDUA 1OCCH 4BQAA 5ILSA 4PUSA 3U9GA 4MLOA 2LSOA 3L9FA 4DV1E 2F4OB 2XGXA 4R03A 3I55I 1P9QC 6PAXA 3FXLA 2LLKA 4IHYA 1LKXA 4PJ0C 4L9VA 3T5XA 2CSOA 4FT8A 2GXGA 1ZR2A 3TMOA 4BJTA 1JK1A 5JR3A 2QEXI 4ZYGA 1VQ9I 1R5HA 1TTYA 2UXDE 2EMHA 5DM7F 2JWOA 3OYJA 2KONA 1H88C 4ETSA 1HF0A 2E36A 2QVOA 3PFYA 4RM2A 3WODF 2LK2A 3M4OJ 3K1NA 1W7PB 2DFIA 3QOEA 1VQ7I 2AS5F 3DBLB 2A69F 4CCJA 4E7HA 3S2HJ 2M1SA 2OZUA 2VBXA 4IPAA 1P7JA 2XHKA 3I71A 1AAYA 1IDZA 3KZZA 5FFZA 4XLEA 2EMWA 1TBXA 2B3TB 4IRGA 2F5VA 2V87A 2XAHA 2YU8A 4IQ4A 4M9ZA 1S29A 4M9SA 5GADJ 2XAQA 1SAXA 3CCMI 1UB9A 2K9MA 1R58A 2GOMA 2GZWA 3GTPJ 3DTEA 4N4NB 4ZDPA 1TWGJ 2VKEA 4Z2YA 5BQTA 1H0MA 4HV5A 4D1QA 1W7PD 2Q8KA 3KYCB 2K4VA 3JW4A 1ZKGA 3HB9A 2IBDA 5JVTA 2KP6A 4XRMA 2HC5A 3DLLF 4EGYA 3F6HA 2E71A 1QZYA 1Z1DA 5CVVA 4YRVA 1V55H 4X65E 5EG0B 5TGTA 3HOSA 4PGHA 4KNYA 4QPOA 1UJ8A 2F48A 2NYXA 4RB3C 2KRHA 3C3WA 3IUOA 3RKWA 5E3LA 2EFNA 1JT0A 1IN4A 2DMPA 4XRSG 4LU9A 2ELJA 3CCSI 1AKHB 3RJPA 4JBAA 2EMKA 2V8QB 1OMIA 1S3JA 3JCUC 4B3XA 4LF5E 4BEHA 2JRMA 3FK6A 1FMWA 3DF6A 5J6XA 1O57A 1RC9A 4A3EJ 3ABKH 2OZ6A 3OYMA 1FSHA 3H9GA 2PJRB 4MLVA 2WBMA 1Z6RA 2OC6A 3LLHA 3H35A 4DJAA 3IHUA 4FTHA 2E34A 3DLAA 1OJLA 3L2WA 4UHTA 2XIGA 1Z67A 1YW7A 5HDKA 2RNGA 1AU7A 1ON1A 1S7AA 1VNDA 3ZQFA 2XROA 1Q1VA 4ON0A 1OYYA 2ZCWA 5FFXA 4BBRJ 1KU3A 2EMBA 1V5GA 3EPKA 2O6GE 1ZGWA 2L7KA 1LFBA 3PQKA 5M5WJ 4ENNA 1NCSA 2V7FA 1KJKA 5EGOA 2DDBA 1VQ6I 4E7LA 4A6DA 4ESJA 1A36A 3EQ1A 2TRTA 2QQBA 3E7LA 1OCPA 1N3GA 2R7ZJ 3H92A 4DOZA 3V7SA 3MQ0A 2V26A 1FIAA 3J7AO 2EE8A 4QWQA 4Y17A 2ZJPF 4O3MA 2PJPA 3LSHA 1YJWI 3RI4A 2GM4A 4CGZA 1D1CA 4O4KA 4DKKA 3HPHA 1VF9A 4DNCA 1IW7F 4S05A 2M5WA 3I5UA 3IKTA 1XS9A 1IC8A 2R7VA 2R3SA 2FGGA 1YJNI 1YE9A 5J1RA 4LIVA 2DDAA 1T08B 1SVMA 3EUHC 1UMQA 4XM3A 3M1CA 3PJRA 4EJTA 2CQ7A 4L5NC 5JLXA 1BBYA 3CDIA 1ZREA 1JHHA 4LF6E 4XOTA 1HKTA 4B3SE 3J7AG 2EWNA 4RM3A 4M0VA 4PSXA 4FISA 2LH9A 2YTQA 2NABA 1BBGA 2MDRA 1RQ0A 2KMUA 5F0HA 5ILUA 3DBRB 2CTDA 2FXAA 3VB2A 4HW0A 2EFQA 3KETA 2L8TA 1MZBA 2IP2A 4BJ6C 4XORA 4P1WA 1T39A 2OUMA 3AL0C 3HRMA 3FKIJ 3PQJA 2EOJA 5J8FA 3OYGA 3SEQA 1UAAA 4A0YA 1P7IA 1ERDA 5CFFE 1YPNA 2L02A 1X1AA 1BOBA 1J0RA 2MD0A 3FDYA 4BUPA 3QPTA 1D5VA 3U1DA 4IL6C 1KA8A 2L92A 3IRRA 3RKYA 3W2WA 3FMQA 2LKPA 2VC1A 3DEWA 1K79A 4IOCF 2QQAA 2JWTA 4A6EA 2EM5A 2YTEA 1ZHFA 1X49A 2O8XA 1T6SA 2DOEA 1KYZA 2HTSA 1BL0A 2LP0A 5IOYA 2BXZA 3WTWC 4BJ5C 2K3FA 2V79A 3ERED 2BOLA 1OISA 2VE8A 1HQCA 4BE2A 1G3SA 2MYSA 2DSYA 2YWQA 4GFBA 4X64E 4N4RB 2GQQA 4O5GA 2P5KA 2E2IJ 1N78A 1ENHA 1ZYRF 5J40A 5HOOA 1HKQA 2JOXA 2JJ7A 1QHGA 4MEYF 3NAUA 2RS7A 3JRCA 1LNWA 2IGKA 4CCLA 1E17A 4JK1X 1NH3A 5F27A 1ETVA 2R7SA 3TQMA 4ZTJA 2HEOA 4KMFA 4HEIA 2YU3A 3QYBA 3A2KA 2RS6A 3A01A 1IF1A 1MJBA 2B7TA 3THOB 1LFPA 1GTKA 3VDXA 3HHHA 3H3UA 3MVPA 4G94A 3LQRA 4B47A 1E2XA 2CQQA 3VYUB 4G7OF 2JPBA 1IN7A 4BY7J 2XAFA 2OBPA 1G3TA 3VYTB 5AE3A 2PRTA 3JRBA 3P9IA 2EM3A 2EPRA 5AE2A 2V1DA 2O5RA 2M4GA 3E5XA 4L5JA 3OOUA 3V7RA 3HPSA 2L2KB 3WU2C 1HNXE 2WTEA 5E1WA 1FP2A 2E1CA 5A2QC 2VOPA 1LJ9A 2X48A 4F9BB 5HLGA 3BGHA 2R7DA 2EOXA 3P1XA 4YHHE 2XSJC 5FLMJ 3Q0UA 3JAMK 2WAQN 1FP1D 1V3FA 2W7NA 1ZTRA 4OIOF 4LFBE 2P6TA 2ZKZA 3EUHA 1GVJA 2ZO4A 2VE9A 4M3DA 3S17J 3ASOH 3TOAA 1LFUP 4UNOA 2EFWA 2VOOA 3ABTA 2UWMA 1N34E 3CP8A 4EM1A 2EORA 1WJBA 2M3AA 4RB2C 1SEUA 2D45A 3VOEA 4Q4ZF 2DPUA 2O61A 3OS0A 2N8XA 1WI9A 4KT6A 3RSNA 1YRNB 2JY9A 5HNHA 3WTSC 2LMZA 4XLCA 1DUXC 2W84A 3PO2J 3LFUA 4WXHA 3T1YE 4I99C 2L3DA 2FA5A 2RDPA 3H9JA 4R8HA 3GX4X 1JKRC 2F4MB 3TKYA 3OYEA 2DLKA 3S1NJ 1E0EA 1TNSA 2FNPA 2DFHA 4HOBA 3RIRA 3K0LA 1STUA 3NEUA 2YSRA 3LSKA 5J4YA 1LE8A 5J4VA 2DA7A 1X3CA 2UU9E 5FKKA 4NXNE 3QG5C
chains in the Genus database with same CATH topology
1BI2A 4GCVA 4GYIA 1W4MA 1EH8A 2G7HA 3LA7A 2FE3A 5HLHA 3MCZA 2QYOA 2O03A 1FYLA 5DD4A 2RQPA 3IRQA 4GO1A 4QLCU 3O3KA 4M6XA 4YFKF 1Z9CA 1XGNA 1XD7A 2HR3A 4ZZLA 5A2QK 3V7CA 3C7JA 3F6VA 3EYYA 5H6RA 1DDNA 2ESHA 3TOBA 1HW1A 2PMUA 3BROA 2RC4A 1LDDA 2P7CB 4I98B 4M6YA 5D5UB 1ZAOA 3MAJA 1U5TA 1RI7A 4IF4A 1K7AA 5HS9A 3WG9A 3GO5A 3WGGA 2GAUA 4IVNA 5CYVA 4FHTA 5H20A 3BY6A 4N9IA 1B59A 2PI0A 1I1SA 4UVAA 4ZYEA 1U78A 1G3YA 3GF2A 1T98A 2EB7A 2BEOA 2Y48A 5JFRA 5E1XA 3LSTA 1TLHB 1I6XA 4HQMA 3FXUA 1XGSA 2ZMEB 5TJJA 2L4MA 1G6NA 2IRFG 1QZZA 3GWZA 4OINF 2EV5A 4LFUA 2D1HA 5FB2A 3COAC 1J5YA 1JE8A 1WQ2A 3K1PA 5AIPA 2FF4A 2CWEA 3ZMDA 1HBXG 3RKXA 4LLNA 1RIOH 4O5VA 4WX9A 4LLGF 2F2EA 3MZHA 4U7BA 2KIFA 4A5MA 2EA2A 3Q9VA 5DCMB 1W7PA 3TO6A 1I1GA 4Q5SF 1B6AA 3MEXA 3BOQA 3F21A 1TQMA 3SXYA 2E1NA 1R1TA 2DBBA 3QPHA 5FD5A 1ZRCA 1B4AA 1A04A 1Z7UA 3IWFA 1YS6A 3WGIA 5J8CA 2ISYA 2FNAA 3IWZA 1EV7A 4KIBA 3D5LA 2V9VA 2E7WA 2OQRA 3DV8A 5AONA 4HX4A 4L5IA 4F7ZA 4FX0A 1FBSA 1U6GA 4N9HA 2X4HA 2IA1A 4IHSA 3ZMVA 5E1ZB 1BIAA 3H3ZA 1ZGAA 4XSXF 4U7DA 3VEPA 1JGSA 3CLOA 5ICEA 4HX8A 1HKSA 3S2WA 5FO5A 3GFIA 4ESBA 2PQ8A 2VT3A 1TW2A 4KDPA 4YFNF 2K4BA 3R6SA 3I53A 2IVMA 1YFHA 2DLLA 2M87A 1XSXA 5EEGA 3REOA 5ICGA 1IRFA 2K02A 3RDIA 4BNCA 5E17F 4MHGA 3E3VA 2FMYA 3HHGA 5BS6A 1YYVA 3I54A 2EV0A 4EJOA 4YG2F 2JSCA 2HKXA 1OR7A 1QQIA 2CO5A 2R7FA 2P7VB 2H27A 5LBQA 4KFCA 1TW3A 2IPQX 1OYIA 2HKOA 1BI1A 2QWWA 3HRTA 2VBYA 1ZRFA 2L54A 2Z9OA 1FOKA 1S8NA 2KRFA 3J81Z 1W5TA 1BC7C 2DK8A 1YW9A 5D5VB 1USTA 3V8LA 4PCQA 1J2XA 2V6CA 3KLNA 4I09A 1XB4A 4U0YA 3N97A 1QBJA 3KFWX 3FM3A 5HLIA 5LGUA 3TDUC 1C0WA 2BBYA 5DEQA 2LNBA 4G6QA 5JI6A 3O2PE 2PFBA 4G8XA 5AIQA 2LF8A 1MDMB 3ISPA 2IW5A 3CUQC 3NRVA 1UHMA 5DUKA 2H09A 2JRTA 4DQ2A 1O7LA 1K6OA 1BN5A 3I0TA 4WF2A 1RUNA 3KZYA 2JZYA 3CDHA 1PDNC 4OIPF 4NQWA 1Q1HA 2DPDA 5E8GA 1IXSB 2Y75A 3KP3A 1P92A 4P96A 1XCVA 4Q48A 2K27A 4M71A 2XKPA 4OU0A 1RUOA 1J9IA 2RNJA 3IC7A 4AIHA 1H9GA 1B1BA 1R5GA 4A5NA 5L3DA 5D6EA 5HS8A 3WTYC 1T2KA 5EEHA 1HSJA 4OOIA 4OMZA 4WXCA 2DI3A 3QOPA 4S04A 3HOTA 1MKMA 2IT0A 1SD4A 2QENA 3WTUC 2BV6A 2MH2A 3J80Z 5LHIA 2STWA 3LA3A 1AOYA 4RGXA 1ZGJA 2QQ9A 3T8TA 3EQLF 1U5TC 5ED4A 2Q0OA 5LEJA 1HSTA 1K78A 2OAZA 2O0YA 5JHUA 2HGCA 5ICCA 2VT2A 5IT9Z 2FQ3A 5CVRA 1SFEA 2DK5A 3AAFA 4HDVA 3K9TA 1P4WA 5LGNA 1O3TA 4LD5A 3WE2A 4L9TA 5DYMA 1FYKA 3HRSA 3HRUA 3OV8A 3QU6A 5CJ9A 2QZ8A 4AVPA 2QUFA 2D2WA 2A68F 4LG0B 2F5EA 4UV9A 4AWXB 4P9UA 2FBKA 3SZTA 3HSRA 3WTTC 3GZ6A 3RTRA 5F64A 5L3EA 3GVAA 2KIUA 4RS8A 1REPC 2M30A 2EA4A 1ZG1A 3F6OA 4G7HF 2NAZA 2W24A 1D3YA 4YIFA 3M7GA 4UV8A 2XASA 1IRGA 1NHAA 2BYVE 3GLXA 4BH9A 3R60A 1ZG5A 3LFKA 5D4RA 3ABUA 2VBWA 3HYIA 2HFHA 3CTAA 1FPQA 2K4JA 1F1ZA 3ECOA 4GYGA 1XN7A 2ZNYA 3IKVA 3E5QA 1BI3A 5K5OA 1TQPA 5IT3A 2G9WA 1ULYA 5L3BA 3TO7A 3FXQA 4M74A 4L18B 4EJUA 1KYWA 3CJNA 4MQVA 4TV7A 2A3SA 1IN6A 2HYGD 3ZMUA 2UZKA 1LEBA 1ZLJA 3KLOA 1IZ1A 4I7HA 1YO5C 1QNTA 4I01A 4H0EA 1XSDA 4RAZA 3IL2A 4RGSA 1SMYF 1KU9A 2FSWA 1FBUA 3DF8A 3ML6A 3I59A 1UHWA 4IHTA 3M1EA 3FF5A 4HA8A 4ZYDA 2XRNA 4L9JA 1STZA 3K69A 1MGTA 4UVCA 1IXCA 3QAHA 3CUOA 2XUBA 1R1VA 2G7UA 4EM0B 2ADUA 4I0AA 2MBFA 4GGGA 4G7ZF 2P4WA 3KP5A 1ZARA 4ASNA 3BJAA 3DPLC 3L00A 3E5UA 2A5YB 3F8FA 4LB5A 4LGWA 1U5TB 3DFGA 2JTVA 4XSZF 4P9FA 2ZFWA 3F23A 2VONA 1YQAA 5BPDA 2RGVA 2QBYA 5HDNA 2FMLA 1OYWA 2XKOA 4P55A 2EV6A 3QRFF 1FWZA 2VC0A 4NB5A 2ZBKA 2ESNA 1I5ZA 2P5LC 5BOXA 5LEKA 3HIFA 4PGGA 3TQNA 1PP8F 4ESFA 4ZYHA 1R7JA 4L0ZB 1Z6TA 3HUGA 4CICA 5LHGA 3N4MA 5H6QA 4G9YA 5BPIA 2EK5A 3SZPA 1Z91A 4KIFA 3W6KB 2PG4A 4EMSA 3QP6A 2W57A 2ETHA 3G3ZA 4UUVA 1XDUA 1YG2A 3NQOA 3K1MA 5K5QA 1BC8C 1D8KA 4HBLA 1YS7A 4A12A 3GEZA 5HS7A 3KEQA 2Z99A 2VN2A 2HDCA 1IUYA 2B0LA 4HAMA 3ECHA 3R61A 4ENJA 2HOEA 2QLZA 3B73A 5LHHA 2XVCA 3DKWA 4HLXA 2A61A 5HDGA 5D6FA 5LRSA 2YPRA 4IJAA 5KVRA 4CO8A 3R0AA 3WTXC 1FZPB 5ILVA 2MA3A 1FC3A 3CUQB 1UCRA 3M8EA 1SFXA 5ICFA 3P7NA 2Z33A 2KKOA 1PUEE 5E20A 5D5WB 2DTRA 4RGRA 5K1YA 3MWMA 3ZN1A 4MNUA 2XV4S 4MEXF 3DQVC 1ZRDA 1X3UA 2ISZA 1ODDA 3ULQB 2LF7A 4A0XA 5D8LB 4Y15A 4YIIA 2P8TA 4HZFA 5E8IA 3DXJF 1MJ9A 2K7LA 4WCGA 1D8JA 2W85A 3ZMZA 2STTA 3G73A 2GA1A 3U2RA 1Y0UA 2UXXA 2WWYA 2L01A 2Z5UA 3RYRA 4RB1A 3GUDA 5BMZA 4RB0A 2F5FA 3HSEA 5LLQA 1LB2A 1IN5A 4HF0A 3WTVC 3J80K 1SD7A 4M72A 3TDZC 5TRDA 1WRJA 5DD8A 1XDSA 2DU9A 4OIRF 2DO7A 5LGTA 1YW8A 2L4AA 5DUIA 5FD6A 4U0WA 3FM5A 3BPVA 4IRHA 2DQRA 3FWEA 5F1RA 3GFMA 3GXOA 3FMSA 5E18F 3WU1B 1R00A 4M73A 1FBQA 3FXRA 1LQ1A 2A6EF 2HZTA 3B02A 3SHFA 1DP7P 4U88A 2PLYA 1XSVA 3I59B 2AXLA 2VODA 4P5OA 1XGMA 2GXBA 3I4PA 3OOPA 4U0VA 3R4KA 3BJ6A 1W5SA 1GHCA 2HS5A 2F5DA 4LJZF 4HLYA 1KU7A 1XCBA 3KP4A 3HTSB 5ERIA 3E97A 4XLPF 2ZXJA 3TO9A 2OD5A 4HX7A 4HQEA 2LDUA 4FX4A 3V4GA 3P9KA 4R79A 3VODA 1K78B 2X0LA 3RPUA 1MJAA 3DP7A 1OPCA 2NNNA 5DDGA 3Q5FA 4AIKA 2CYYA 2HTJA 2J5PA 1WSUA 2FOKA 3TGNA 4BHBA 3HSFA 1O3SA 1CF7A 3F3XA 4AD9A 5D5XB 1VTNC 4KN4X 3JAMZ 4KIGA 1MDMA 3WU0A 3GZ5A 3T1BA 3QU3A 2K86A 2IA0A 1DPRA 1L0OC 1LDJA 2D1VA 3ROUA 2E7XA 1LEAA 5CVIA 5F6FA 3BZ6A 3DPTA 1RNLA 3J81K 2ZNZA 1T38A 3E6MA 5IT9K 4EJWA 2IA2A 3SQNA 2V1XA 1H9TA 4LK0F 5A2QZ 2NS0A 2C6YA 2MC3A 3M9AA 1QO0D 3DEUA 4HV6A 1ZG3A 4I2OA 3PFIA 3V8JA 4KYWA 3F8NA 1SD5A 4EJVA 3EYIA 2MLKA 4HF1A 2ZJ2A 4KA4A 5DCFA 4CDGA 1SFUA 3L7WA 2EJRA 5CLSA 3KCCA 2DT5A 4HF2A 4BXUA 2F5CA 2ACJA 1FNNA 1MD0A 2PMHA 1FLIA 4A0ZA 1TNTA 4HYEA 3EETA 3BWGA 4WXDA 1F4KA 1HW5A 3F8MA 1WKMA 3MFKA 4M9XA 2GWRA 1QGPA 1ZLKA 2EFPA 3JTGA 5D8KB 4WK8F 2NNYA 2MH9A 1I27A 3ZN0A 4BHPA 4MTDA 1BM9A 3D0SA 4WWCA 2RN7A 3WTZA 1KGSA 1KQ0A 3RYPA 3JTHA 1V4RA 2YR2A 1QPMA 1CGPA 4YFXF 1BOAA 3JSPA 4OIQF 1USSA 2QM3A 1O3QA 4CYDA 2RVCA 3F8CA 3C1DA 2DW4A 4JQFA 1XMKA 4O6JA 2PEXA 2HQRA 3KE2A 3ZMTA 1BI0A 1XMAA 2Z3YA 4LB6B 4K2EA 2O3FA 1GXPA 4Q47A 3LAJA 2A07F 1FYMA 1ONVA 2UXNA 2CQKA 1S6LA 2XAGA 4BAYA 1YLFA 3LQQA 4I0BA 1J59A 4N0BA 4KN7X 3GW2A 2WV0A 2EFOA 2YX4A 2COMA 1O7FA 4CZZA 4LG0A 1FY7A 3E6CC 1R36A 1P2FA 2M8EA 4KUMA 3P9CA 4L9NA 4AIJA 4KICA 2RV8A 3QP5A 1F5TA 1WWXA 2YX7A 4GXOA 1LVAA 1LDKB 2W25A 1KQ8A 5FLXZ 1JHFA 2XAJA 4KMUX 2P5VA 1U2WA 4EQQA 1U3EM 3JSOA 1P4AA 4G6DA 3C18A 3ZPLA 2PN6A 2HWVA 2GIVA 1DPUA 4EVIA 3FHZA 1FSEA 3V8KA 3F8BA 5DCMA 1T0FA 4ZZDA 2DQLA 4ENKA 2KJBA 3T8RA 3GFJA 1SD6A 5L3GA 5L3FA 3I58A 2OA4A 4NHJA 4LMYA 2CW0F 2ZMEA 1JXSA 2J5OA 4ENMA 2M1BA 1UFMA 3F22A 2PBIA 1TQIA 4B09A 5FLXK 1G3WA 3BJOA 1S7OA 5D4SA 2VBZA 2H6BA 1PP7U 1P6RA 3E6DA 2TDXA 4B8XA 2IJLA 4XLNF 3F72A 1J75A 5CVJA 2WC2A 2BGCA 5KK1A 1AWCA 3GYHX 4MQ9F 2H94A 2HYFA 4UXNA 5L3CA 1J7KA 5FGMA 1B9MA 3WGHA 4CXFA 2VXZA 1OKRA 3Q9SA 3ELKA 3M8FA 3L09A 2BE5F 4LK1F 5K5RA 1F9NA 3FZVA 1R1UA 3KP6A 1HXDA 2Q2EA 4PZJA 4ZH4F 5HVQC 1U8RA 2CFXA 3E6BA 4RAYA 2FU4A 2DAOA 1KQ9A 1ZH5A 1EH6A 4Y13A 1RZ4A 2GA2A 1EH7A 4HDUA 3L2CA 1Z05A 4XBFA 2A6HF 1KU2A 4BHCA 2OQGA 2MD5A 2JT1A 1IAWA 1FX7A 4MGRA 2KJCA 2MLGA 4RGUA 4EM2A 4XRFA 1ZN2A 3BPXA 1SMTA 3CUQA 3SFZA 4EGZA 4MTEA 1YTYA 3CO7C 1BIBA 2ELHA 1ON2A 5DV5A 2FBHA 1B9NA 3KP2A 4LLLA 1CF7B 4A2UA 1R22A 2RKHA 3BDDA 2FBIA 2FEZA 4D0PA 3FMRA 3MZYA 1BJAA 3LWFA 3RPQA 3ZP5A 3K2ZA 5LRRA 3ZQ7A 4I02A 1GXQA 3LA2A 1HW2A 1P4XA 2M45A 3CO6C 3GFLA 1L3LA 2CGPA 2NRAC 3HTUA 3ZMSA 4CHUA 4IRIA 4OMYA 2Y0MA 3FX3A 2JPCA 2V1UA 2HQNA 2CG4A 1G4DA 1YIOA 3WE3A 3EDPA 3KEOA 2H6CA 5CVUA 4E70A 3KP7A 4R1HA 1FT9A 3LAPA 1O3RA 2KIMA 2QBYB 2P6SA 1R23A 4UVBA 1XGOA 1IN8A 4PDKA 4EV0A 4BYYA 3O6BB 1IXRC 4L0YB 3VFZA 3I64A 4IXAA 3W6JB 3BP8A 3T0YA 3R0JA 2OU2A 4KT5C 4BQAA 2FRHA 5ILSA 3U9GA 2LSOA 3L9FA 2XGXA 6PAXA 4L9VA 3T5XA 2CSOA 4FT8A 2GXGA 5JR3A 4ZYGA 1R5HA 1TTYA 4ETSA 2QVOA 3WODF 3K1NA 1W7PB 2DFIA 2AS5F 2A69F 2OZUA 2VBXA 4IPAA 2XHKA 3I71A 3KZZA 5FFZA 1TBXA 4IRGA 2XAHA 4M9ZA 1S29A 4M9SA 2XAQA 1SAXA 1UB9A 1R58A 2GZWA 4Z2YA 5BQTA 1H0MA 4HV5A 1W7PD 2Q8KA 3JW4A 5JVTA 4EGYA 1QZYA 1Z1DA 5CVVA 3HOSA 4PGHA 4KNYA 2NYXA 4RB3C 3C3WA 3RKWA 2EFNA 1IN4A 3RJPA 4JBAA 1OMIA 1S3JA 5J6XA 1O57A 2OZ6A 1FSHA 1Z6RA 3IHUA 4UHTA 2XIGA 1YW7A 5HDKA 1ON1A 1S7AA 2XROA 4ON0A 1OYYA 2ZCWA 5FFXA 1KU3A 2O6GE 3PQKA 4ENNA 4A6DA 4ESJA 2QQBA 3H92A 3V7SA 3MQ0A 3J7AO 4QWQA 4Y17A 4O3MA 2PJPA 3RI4A 4CGZA 4DNCA 1IW7F 4S05A 2M5WA 3I5UA 3IKTA 2R3SA 4EJTA 1BBYA 1ZREA 1JHHA 1HKTA 2EWNA 5ILUA 2FXAA 3VB2A 4HW0A 2EFQA 3KETA 1MZBA 2IP2A 1T39A 3HRMA 3PQJA 5J8FA 4A0YA 2L02A 1D5VA 1J0RA 3QPTA 3U1DA 1KA8A 3IRRA 3RKYA 3FMQA 2LKPA 2VC1A 1K79A 2QQAA 4A6EA 1ZHFA 2O8XA 1T6SA 1KYZA 2HTSA 3WTWC 2V79A 3ERED 2VE8A 1HQCA 1G3SA 2GQQA 2P5KA 1ZYRF 5HOOA 1HKQA 4MEYF 1LNWA 1E17A 4JK1X 2HEOA 4KMFA 2YU3A 1IF1A 1MJBA 3HHHA 3H3UA 4G94A 3LQRA 1E2XA 4G7OF 2JPBA 1IN7A 2XAFA 2OBPA 1G3TA 3P9IA 2V1DA 3E5XA 4L5JA 3V7RA 2WTEA 5E1WA 1FP2A 2E1CA