4ZYGA

Crystal structure of methylated sulfolobus solfataricus o6-methylguanine methyltransferase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
150
Chain Sequence
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 44
structure length 150
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zygA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zygA01
2HKOA 3IKVA 1YYVA 4XSZF 5J8FA 4KMUX 2QWWA 4L0YB 1TLHB 2QBYB 2DT5A 1FC3A 2IJLA 4BH9A 4R79A 1CF7B 2GXBA 4KMFA 2MC3A 3EDPA 1ZRFA 3L00A 2WWYA 4Q48A 3C3WA 3MEXA 2CWEA 2M1BA 2RV8A 4HYEA 2HTSA 3BPXA 5BMZA 1HW5A 3HRSA 3NRVA 3IRRA 4KIBA 3ULQB 4I0BA 5CLSA 3O2PE 2P7CB 1LDDA 2YPRA 1QGPA 4HDUA 3FWEA 2EWNA 3DP7A 4KN4X 5LEKA 1ODDA 3TQNA 5HDGA 3KP2A 3F6VA 1STZA 2Y48A 2EK5A 4LFUA 5IT3A 4G7HF 1SAXA 1LB2A 5FFXA 2OA4A 4HW0A 1ZG3A 2GIVA 3MFKA 2KJCA 1RNLA 4XBFA 5HS8A 1YQAA 3I71A 2D1HA 4XLPF 1IAWA 3I0TA 4PGHA 3COAC 1HKQA 1U2WA 2NNYA 5E1ZB 3WG9A 4KA4A 2A3SA 3QRFF 1DP7P 3F6OA 4I7HA 4GGGA 2V9VA 3LQQA 2L4AA 5AIQA 3NQOA 5ICGA 1YO5C 4IVNA 5DV5A 2OAZA 4QWQA 1XSDA 2JRTA 5CVRA 3E97A 2FMYA 1SMTA 4N0BA 2W24A 3K0LA 1T38A 1FX7A 1B9NA 1SFXA 4GXOA 4FT8A 4OIPF 3KFWX 1JHFA 2ZNZA 1QPMA 2XAGA 1ZRDA 1P92A 1O57A 3G73A 2A6EF 4S05A 3KP7A 2M8EA 4KNYA 1HQCA 4XRFA 2FMLA 3QU3A 2O8XA 2EV0A 2D45A 3WODF 2CYYA 5D6EA 4OINF 4LLNA 2DQRA 5CVVA 2Q2EA 2P6TA 2FBKA 2HKXA 4HLYA 1J0RA 1SD6A 3W6KB 3K2ZA 2Z99A 2QQAA 1LNWA 3KETA 5BPDA 2PLYA 1ZHFA 3RDIA 4L9VA 1HKSA 2IP2A 4A0YA 5F1RA 3PQKA 1TTYA 4UV9A 3T0YA 4U0WA 2P5VA 5K1YA 5BOXA 5DD4A 2ZXJA 1JE8A 5ILVA 4EM1A 2HYGD 4CO8A 5L3BA 1KU9A 1V4RA 1S29A 2O3FA 3KZYA 1BIAA 1T6SA 1LQ1A 2EA4A 3FX3A 4ZH4F 3V8LA 2DTRA 2DQLA 1U5TC 3FHZA 4Y15A 2V1DA 4N9IA 4LG0B 5LEJA 3I53A 1UHWA 4BNCA 1F5TA 2HFHA 4ZYEA 1FLIA 1FSEA 2H6BA 5D6FA 3LA2A 1U5TA 3GXOA 2HQRA 3DXJF 1H9TA 1OYWA 4LJZF 3J81K 3CTAA 2ESHA 1OMIA 4WK8F 1O3QA 5A2QZ 1R22A 4M73A 1R23A 1YS6A 1XCVA 2V79A 1JGSA 2G9WA 3E5QA 2L01A 3C1DA 3WGIA 3BZ6A 3BOQA 1ZYRF 1Z91A 2ISYA 3FM3A 4ZYGA 5DCMA 4BXUA 3ML6A 2PMUA 2NRAC 2F2EA 2FRHA 2DLLA 1PDNC 2R7DA 4EQQA 4EM2A 2FE3A 3OOPA 5F6FA 1OR7A 3TO7A 1UFMA 2NAZA 3RPUA 1JHHA 1ZH5A 1U78A 1XDSA 2NS0A 1P4AA 4LB6B 2DK8A 3K1PA 1U6GA 3WTVC 1FP2A 1ONVA 2P5KA 1Z9CA 3KCCA 5BS6A 1W7PB 2IRFG 4LK1F 4ENJA 1FY7A 1YLFA 2BV6A 3I5UA 1Q1HA 2ETHA 3BY6A 2ZMEB 4WWCA 3S2WA 3WTSC 3WGGA 1GHCA 2EFQA 3ZQ7A 2VXZA 2RVCA 1TQIA 1KQ8A 2LF8A 4RGSA 4FX4A 1TBXA 2XASA 3ECOA 4ON0A 2P4WA 3RYPA 1BI1A 3F8MA 3O6BB 2LDUA 1DPRA 1SFEA 1VTNC 1V3FA 2MBFA 3KZZA 4PDKA 5EEHA 2CW0F 2GXGA 3FXQA 2G7HA 4P55A 1R5HA 1XGSA 3WE2A 3D0SA 1UHMA 1E17A 3QP5A 2E1CA 3T8RA 2FBIA 4O3MA 5FB2A 1O3TA 2GAUA 5HS9A 3V7SA 4ESBA 3E6BA 1L3LA 1WKMA 1MKMA 1P2FA 3K69A 5K5RA 1XDUA 4CDGA 3VOEA 3WTWC 1W5SA 1XN7A 4M74A 2R3SA 1SMYF 2MLGA 2Z33A 1EH6A 1O7LA 3J80K 1ZGJA 3R4KA 3HTUA 1H0MA 2IA1A 1R1TA 3WTXC 1G3WA 2XGXA 4I02A 1XD7A 3C18A 4Q5SF 1QBJA 1H9GA 2QQBA 1J2XA 1Z7UA 1W5TA 1HXDA 1R36A 4GYGA 1DUXC 1G6NA 3H92A 2ADUA 3Q5FA 5AIPA 4JK1X 1Z6RA 3VB2A 1XGNA 2K7LA 2XKOA 1BN5A 3IL2A 2PBIA 2IT0A 2V1XA 3KEQA 3MZYA 3GLXA 3BROA 3RYRA 2B0LA 1FT9A 1B6AA 2L54A 3FXUA 3IWZA 2CQKA 1ZRCA 4P9UA 5HDNA 2RDPA 2VT2A 1KQ9A 3EQLF 3I64A 3CUOA 5HS7A 1MJ9A 1EH7A 4ENNA 3VODA 4G7ZF 4OMZA 1IF1A 2FOKA 5LGUA 4G6QA 1ZN2A 1RI7A 4KIFA 2GZWA 1FBSA 4MTDA 3WU1B 2IVMA 3Q9SA 4CICA 2BE5F 1I1SA 2HZTA 4L5JA 4B8XA 1G3SA 4I0AA 1FYMA 2FXAA 4WCGA 3I4PA 3J81Z 5D4RA 2F5CA 3L9FA 1O3SA 5CVUA 2EB7A 3IHUA 3TOAA 2AS5F 3HOTA 3RIRA 5KK1A 4JQFA 4EJUA 1QNTA 3B73A 4CZZA 4IF4A 3K1NA 4CHUA 4EJWA 2RGVA 1IN7A 5DUIA 5HLGA 5E1XA 2W25A 2M30A 3V7CA 3IKTA 4AIJA 3OV8A 4IPAA 3JTHA 4YG2F 2KIUA 2EFWA 3ZMTA 3E6CC 2FEZA 2MH2A 4UVAA 1I5ZA 2KRFA 2VODA 1K79A 5L3CA 2HGCA 5D8LB 4UHTA 4FHTA 5LHGA 4RAZA 2JPBA 5TJJA 1XGOA 3QOPA 4U0VA 1IN8A 4N9HA 4GCVA 2O61A 4EM0B 3ZN1A 3GFJA 4UV8A 2BYVE 2EFPA 5DD8A 4HF0A 4HOBA 4FX0A 2A6HF 4EV0A 1IUYA 2G7UA 3Q9VA 4EGYA 2CO5A 2QYOA 5CVJA 2ISZA 5ICEA 3V7RA 4ZZDA 2OQRA 1EV7A 4B09A 3RI4A 1UCRA 3LQRA 3E5XA 2EA2A 3CLOA 1U3EM 3RJPA 3M7GA 3M8FA 1LEAA 4M72A 3V8KA 2HS5A 3GZ5A 1ON2A 1Z6TA 3I59A 1TW3A 4PGGA 1KYZA 4RB0A 2JSCA 1HKTA 1YS7A 5DCFA 3SXYA 1S7AA 1WWXA 1C0WA 2E1NA 4A2UA 2A69F 2RKHA 4HQMA 4XLNF 1J9IA 2Y75A 2YU3A 3T8TA 4A12A 2FBHA 3MWMA 2WV0A 3QU6A 4EGZA 4IRHA 3CO6C 5ICCA 1TW2A 1IXSB 4JBAA 2LSOA 2FNAA 1BBYA 1S6LA 4HV6A 3L2CA 4LK0F 2FU4A 2KKOA 4S04A 2QQ9A 3GUDA 1ZG1A 1MDMB 4MGRA 3FZVA 1BIBA 1NHAA 4UNOA 2M5WA 2XROA 4ETSA 3T1BA 1U8RA 3H3UA 3QP6A 4BHCA 4G8XA 2HOEA 4A6EA 5ILUA 3BDDA 4H0EA 3TDUC 3N4MA 2O03A 4RGUA 2JPCA 3D5LA 3J80Z 3LWFA 2KIFA 4BAYA 1J75A 2RNJA 2HR3A 3JW4A 2K27A 1IW7F 2UZKA 3V8JA 2IPQX 1FSHA 1CGPA 3WTUC 1ZAOA 4ESFA 1BJAA 5K5QA 4IRGA 2DAOA 2LF7A 5H20A 3P9KA 4U88A 4IHTA 1HW2A 4BHBA 1U5TB 1G3TA 5FGMA 4EJVA 1FNNA 2MH9A 3GFIA 1RUNA 2IA0A 1SD4A 5LHIA 2RQPA 2PEXA 4KT5C 1R1VA 5LRRA 3HYIA 1AWCA 2J5PA 5E20A 4EVIA 5JHUA 4EJTA 3KP6A 5L3GA 1T2KA 3M8EA 2DBBA 4YFKF 3ERED 1QQIA 2LKPA 1IZ1A 1ZLKA 5DCMB 3GYHX 2COMA 3DF8A 4L18B 2XRNA 4OIQF 2XKPA 1KA8A 2VE8A 4HA8A 2F5FA 3SFZA 5L3EA 2DW4A 5E17F 4IXAA 1MD0A 1J7KA 5D5VB 1PP8F 3ISPA 2CFXA 1LVAA 3BP8A 1E2XA 2FNPA 4RGXA 1IXRC 4K2EA 2PN6A 1L0OC 2VBZA 2O0YA 2DFIA 3CUQC 4OIRF 2FSWA 3WTZA 3FXRA 3KEOA 1G4DA 2XAQA 3BJAA 4AIKA 2P6SA 2STTA 1XSXA 1GXQA 3HIFA 4KDPA 1B9MA 4YFNF 4PZJA 3CUQA 4IHSA 3LSTA 4P96A 4GYIA 3PQJA 4NB5A 3ZPLA 2PMHA 2KIMA 2MA3A 1R5GA 5F64A 1BI3A 3MZHA 2XAJA 3RKYA 3EYIA 3ROUA 3O3KA 4YIFA 1B4AA 4HF2A 3E3VA 2C6YA 3DKWA 2Y0MA 5HDKA 5EEGA 3V4GA 1D8KA 3H3ZA 4KUMA 2UXXA 3R61A 3WU0A 3RPQA 2VBXA 4OMYA 5E8GA 1RZ4A 5HOOA 5D5UB 3HOSA 4BYYA 3ECHA 1GXPA 2R7FA 3GFMA 2DO7A 3WGHA 3AAFA 4AD9A 2X0LA 1XSVA 2PQ8A 4TV7A 4A5NA 3VFZA 4G7OF 2CGPA 3DPLC 5ED4A 4A5MA 4KIGA 5ILSA 5LGTA 3K9TA 4I09A 4MEYF 2ZMEA 1FOKA 3F8NA 1KU2A 1XB4A 2JTVA 1SD5A 2ZCWA 1FZPB 1BI2A 3HSEA 4KN7X 1W7PD 3KLNA 3TO6A 2V6CA 4ZYDA 5TRDA 1MJBA 3JSOA 3HRMA 2WC2A 2RC4A 2VE9A 4Q4ZF 2Z5UA 2PI0A 4A6DA 2P8TA 1R1UA 4UVBA 1Z1DA 3LAJA 1IN4A 1LEBA 1T0FA 3GVAA 3ELKA 1OPCA 5LBQA 2ZNYA 2L3DA 2OZ6A 5J8CA 5CYVA 1MGTA 1PP7U 1K78B 3FF5A 2M45A 2ZJ2A 2GWRA 4YFXF 3ZMVA 5FD6A 2XVCA 4M6YA 3ZMSA 3ZMUA 3K1MA 3SZTA 1BI0A 2BEOA 2YSRA 1BC8C 5LLQA 1XCBA 2K4JA 2A61A 2EV5A 1ZREA 4L9NA 1YW9A 3HSFA 1KQ0A 4M9ZA 5FLXK 5IT9K 4EMSA 5BQTA 4U0YA 4M71A 4RB3C 4HBLA 1TQPA 3BWGA 1XMAA 1T98A 4PCQA 3I54A 2VC1A 3F21A 2H09A 2H27A 4DQ2A 2NYXA 5HLHA 2QM3A 2H6CA 2TDXA 4UVCA 2OBPA 1ULYA 1K6OA 2V1UA 2DPDA 2HTJA 2HDCA 2OQGA 3MQ0A 3CDHA 3W6JB 1J59A 4AIHA 3WTYC 3L09A 3U2RA 1ZLJA 4L9TA 3F8CA 4I98B 3PFIA 1SFUA 4U7DA 5D5XB 3E6DA 1GVJA 2YR2A 2L4MA 2ZKZA 5L3FA 5DEQA 3U9GA 3M1EA 5AONA 1RUOA 3B02A 1ZGAA 2KJBA 3DV8A 2RN7A 5CVIA 1XGMA 2CG4A 3T5XA 4RS8A 4Q47A 1KYWA 2QBYA 3LA3A 3LA7A 1LDJA 2EFNA 1CF7A 3M9AA 4XSXF 1OYYA 1R00A 3G3ZA 2VBYA 1EH8A 2F5EA 1T39A 4OU0A 1MZBA 1FBQA 4LGWA 5FD5A 3KLOA 1USTA 4EJOA 3MCZA 1TQMA 3SQNA 4R1HA 3FMQA 2VBWA 1F4KA 2ZO4A 4LMYA 1HSTA 3DPTA 2IA2A 4CGZA 2DI3A 4DNCA 4OIOF 2ZBKA 1IN6A 4HX8A 1ON1A 4CXFA 1FPQA 2XAFA 3JAMK 2A07F 1LDKB 3IRQA 4HLXA 3C7JA 5L3DA 3U1DA 5H6QA 3ZN0A 5FFZA 2MD5A 3CJNA 3RKWA 3I59B 3EETA 3FMRA 2XV4S 4D0PA 3F8BA 4U7BA 1G3YA 3RKXA 4HZFA 3ZP5A 2UXNA 4LD5A 2XAHA 2AXLA 1S8NA 3QPTA 1J5YA 1JXSA 2YX7A 2D1VA 3TKYA 1REPC 4AWXB 4WXDA 1RIOH 2A68F 3CO7C 1YG2A 2K02A 5JVTA 5HLIA 1YW8A 1P4WA 1QO0D 3GZ6A 1OKRA 4UUVA 1TNSA 6PAXA 2HEOA 4G6DA 3GX4X 5DDGA 1QZYA 3GO5A 4QLCU 3FMSA 3GFLA 3RTRA 3WTTC 2QLZA 3J7AO 1KU3A 2LNBA 5BPIA 3F23A 1FYKA 3SHFA 2QVOA 2E7XA 4MTEA 4HX7A 2D2WA 1IRGA 1WQ2A 4Y13A 3DFGA 4ENMA 4L0ZB 3I58A 1YTYA 4BQAA 1B1BA 1HSJA 2STWA 2L02A 3R60A 3QAHA 3SZPA 5DYMA 2DU9A 1QZZA 3HSRA 1O3RA 2VT3A 2FF4A 2EJRA 1X3UA 3NEUA 3TGNA 3IC7A 2ESNA 3BJ6A 1R58A 1AOYA 2OD5A 2MLKA 4A0ZA 1MDMA 1OYIA 4WXHA 4ENKA 2J5OA 1F1ZA 3BJOA 1YW7A 3HRTA 2GA2A 5J6XA 4MEXF 5JR3A 1HW1A 1BOAA 1S7OA 5FLXZ 3JSPA 5IT9Z 4P5OA 2UWMA 4E70A 3TDZC 1I6XA 3TO9A 5JI6A 2P7VB 2YX4A 2CSOA 2VOOA 1DDNA 3LAPA 5JFRA 1P4XA 1FBUA 3ZMZA 2A5YB 2VONA 4BHPA 3L7WA 1HBXG 2O6GE 1D8JA 4F7ZA 2BGCA 4LG0A 2JT1A 3E6MA 4G9YA 3HRUA 5KVRA 4OOIA 5LGNA 2W85A 2DK5A 2GQQA 4LLGF 1USSA 4UXNA 2FQ3A 3CUQB 2W84A 1FP1D 3JTGA 1O7FA 5H6RA 3GF2A 3HTSB 2Z9OA 2Q8KA 2QUFA 4IJAA 4L9JA 2XIGA 1TNTA 3F8FA 4MNUA 1I1GA 2NNNA 3R0AA 3F3XA 3P9CA 4MHGA 1FYLA 2FA5A 3REOA 1IXCA 3DEUA 1WSUA 3MAJA 2EV6A 2OZUA 4RAYA 3GW2A 4A0XA 1DPUA 2PJPA 3WE3A 2ZFWA 2W57A 5E1WA 1A04A 4CYDA 4KYWA 3ABUA 4AVPA 2XHKA 4ZYHA 2HQNA 1K7AA 1KU7A 3R0JA 4RGRA 4ESJA 2E7WA 5D8KB 2VOPA 4Z2YA 2ACJA 4R8HA 2GA1A 1Z05A 4HDVA 4YIIA 4WF2A 2OU2A 3KP4A 1LJ9A 2EFOA 3HUGA 2ELHA 2QENA 1IRFA 4KFCA 3GEZA 3ABTA 4IRIA 2M87A 4WX9A 1P6RA 2F5DA 3BPVA 5LRSA 3JAMZ 4NHJA 3QPHA 4O5VA 1UB9A 2P5LC 1BC7C 4G94A 1IN5A 3GWZA 2HWVA 4NQWA 1ZARA 1W7PA 3EYYA 2QZ8A 1FWZA 5K5OA 1W4MA 4I01A 4M9SA 3F72A 3KP5A 3EUHA 4ZZLA 2Z3YA 2VC0A 1B59A 1Y0UA 4LB5A 5ERIA 2XUBA 2PFBA 2BBYA 4O6JA 1PUEE 1SD7A 3TOBA 3ZMDA 3F22A 3LFKA 4I2OA 3P9IA 3N97A 4HAMA 4ASNA 2JZYA 5E18F 3KP3A 4HV5A 5E8IA 4WXCA 4HX4A 1ZG5A 1MJAA 4RB1A 3HHHA 3R6SA 1R7JA 4L5IA 2Q0OA 4LLLA 3P7NA 2VN2A 3HHGA 5HVQC 3IWFA 1WI9A 5CJ9A 5D5WB 1S3JA 4M6XA 3FM5A 4KICA 2H94A 1F9NA 1YFHA 4HQEA 1XMKA 1D3YA 2DPUA 1K78A 5LHHA 1D5VA 1I27A 4Y17A 1WRJA 5FO5A 4GO1A 2PG4A 4MQ9F 1YIOA 5ICFA 4MQVA 4RB2C 2K86A 2WTEA 3KE2A 4P9FA 2K4BA 4M9XA 5D4SA 3VEPA 5DUKA 4HF1A 3E5UA 5A2QK 1BM9A 2X4HA 2HYFA 3DQVC 1KGSA 2IW5A
chains in the Genus database with same CATH superfamily
2HKOA 3CESA 3IKVA 3S8PA 1YYVA 3KIOA 1JUSA 4CCNA 2LTPA 4XSZF 5J8FA 2V9KA 2DFEA 4BUPA 3DLLF 2V1NA 2YRHA 4Y3OA 2FX0A 4KMUX 1WJ5A 2QWWA 4A3FJ 4L0YB 1Q1VA 1TLHB 2ID3A 2DT5A 3HC7A 4CCOA 1FC3A 3BQZA 2IAIA 4E7JA 3Q3SA 2IJLA 4C2TA 4BH9A 2JR1A 4R79A 1CF7B 2GXBA 4KMFA 1A6QA 2MC3A 1A35A 2HC5A 4M6VA 3EDPA 2HVRA 1N75A 4BCAA 3OYAA 1ZRFA 2EM4A 1ETKA 3H0GJ 3L00A 1NK2P 2VL8A 2WWYA 1I3QJ 4Q48A 1MW7A 4DJAA 3C3WA 2NUFA 3MEXA 1VZ0A 4A3JJ 3QODA 2CWEA 2M1BA 3LSIA 3BLYA 4D1QA 2RV8A 3HZJA 1E3PA 2HTSA 3BPXA 4HYEA 4LF8E 2A5WA 2F5VA 1ZAAC 5BMZA 3H0DA 5CPRB 4I99C 3QG5C 2VKDA 4CYCB 4GKKE 2DYSH 3MVPA 2HDWA 1HW5A 3HRSA 3TBIA 3NRVA 3IRRA 4KIBA 2MKNA 3ULQB 3X2QH 4I0BA 5CLSA 3A01A 3O2PE 4ZTFA 1LDDA 2P7CB 4NBQA 2DMNA 1LE8B 3C4TA 2IHR1 2YPRA 1QGPA 3A03A 4HDUA 3FWEA 4JX4A 2NVXJ 2EWNA 2LBFB 3LLHA 2DODA 3DP7A 2LREA 1VFCA 4CA0A 4KN4X 1NK3P 4Y52J 5LEKA 1ODDA 2D9HA 4CUGA 3TQNA 2F4IA 5ADZA 5HDGA 4J00A 3KP2A 3E1SA 3F6VA 5M5WJ 1POGA 2L9SA 1MMSA 1STZA 2Y48A 2EK5A 1O4XA 2E34A 2V89A 4LFUA 4TUGA 5IT3A 3ADLA 4G7HF 1YJ9I 4A3BJ 4CCJA 4DIQA 2WBMA 1SAXA 1LB2A 5FFXA 2Q8UA 3LSMA 3KEYA 2DFHA 2OA4A 1YJWI 1IV6A 4IL6C 4HW0A 1E3OC 4CSWA 1ZG3A 2GIVA 3QYFA 3MFKA 3H9GA 4BXXJ 2KJCA 1JK1A 3KYDB 4X1EA 4F9BB 1RNLA 3BG9A 4XBFA 5HS8A 1YQAA 2EN8A 2O7OA 3I71A 1Z3YA 3SYTA 1XTAA 2CT1A 2D1HA 3BG5A 5CKTA 4XLPF 4B48A 1IAWA 3I0TA 1IQSA 1F2IG 4PGHA 3COAC 1HKQA 1U2WA 1WHUA 5EGOB 2DFFA 2NNYA 2W7NA 5E1ZB 4PUSA 3WG9A 5HNHA 1W1WE 4E7HA 4KA4A 2A3SA 3FHNA 3M1CA 3PSIA 4OAYA 1UJ8A 5JLWA 3QRFF 1JK2A 2LRSA 1MNMC 1DP7P 3ZOQB 3F6OA 1YX3A 2V88A 4I7HA 4GGGA 2V9VA 3LQQA 2L4AA 2JUCA 3VYUB 5AIQA 2K7IA 5M3FJ 3NQOA 3CCEI 4E7ZA 5ICGA 1D1BA 1YO5C 2XRLA 2X1EA 1TT5B 2MD0A 4CCMA 2KLOA 2OF7A 5LFAA 2KL4A 2JQ7A 2EMZA 3NWSA 1FOYA 2EPAA 2E1MC 3DWLE 4IVNA 4A3IJ 1OCOH 2W00A 2OAZA 4QWQA 5DV5A 2JRTA 1XSDA 1JJ6C 3OWTA 2EMBA 4JI7E 5CVRA 3E97A 3EQ1A 5GP9A 1X4OA 2FMYA 1SMTA 4N0BA 2DCEA 2VKEA 3B6CA 4E7SA 2W24A 2YU9J 3K0LA 2M4IA 1T38A 3K10A 4FE4A 1FX7A 1B9NA 1SFXA 4RLQA 4GXOA 3UK3C 4BBSJ 2PJRB 2E1MA 4FT8A 4JYAE 4OIPF 1YI2I 3DKYA 3KFWX 2BY0A 1JHFA 2WB1A 4Q35B 2ZNZA 1QPMA 2XAGA 3JRHA 1ZRDA 2WAQA 1OCCH 4AVZA 1P92A 5KAFC 1O57A 3VSKA 1QHGA 4XLEA 3G73A 3KWRA 2A6EF 4S05A 1OJLA 3KP7A 2EPLX 2M8EA 4KNYA 3PJRA 3ABMH 1Y1VJ 5A6AA 2UV1A 2EOOA 1HQCA 4XRFA 3EPLA 1MMAA 2AQFA 4W97A 3S2HJ 3THNA 3FBNB 5A6JA 2I10A 2FMLA 2FTXB 2F4VE 3QU3A 1X1CA 2O8XA 1AHDP 2HVSA 2E71A 2EV0A 2BHYA 2D45A 1LLMC 2YTQA 5IXMB 3WODF 2AO9A 4A3LJ 3GTPJ 2CYYA 2KISA 5D6EA 4OINF 4BJ6C 4ZDLA 4CH7A 2QSHX 1V5GA 2FD5A 3LSRA 4LLNA 2DQRA 5CVVA 2CS3A 2Q2EA 3HTXA 2P6TA 2FBKA 3E7LA 1E0EA 5JVGF 3OTOE 3O8GA 1E3HA 5IP7J 4DYCA 4YHHE 2HKXA 4HLYA 4EEFG 4HRIA 2IGKA 1J0RA 3F0CA 3A0BC 4XLCA 2CQ7A 1IUFA 2NVYJ 2VI6A 1SD6A 4AU7A 3W6KB 2JWTA 3K2ZA 5A6KA 2Z99A 4V19K 2LBSB 1Y8RB 4N4RB 2QQAA 2ELZA 4E7LA 1LFBA 4KZSA 1LNWA 1LKXA 2KP6A 3GTJJ 4MFEA 3JRGA 3KETA 2JMWA 2XSJC 3H36A 5BPDA 2E5ZA 1ZR2A 2A05A 2PLYA 2EMLA 1ZHFA 2EWLA 3RDIA 4L9VA 1AAYA 2QKMB 4JI2E 1HKSA 3C2HA 3HQ1A 2IP2A 3GTKJ 4BBRJ 4A0YA 5F1RA 3PQKA 4BACA 4TUIA 1GDTA 2KPMA 3GMEA 1TWAJ 1BW6A 1TTYA 4UV9A 3VYSB 3OS1A 3T0YA 2NVQJ 4U0WA 1DQUA 2IS4A 2EM0A 1RC9A 2P5VA 5K1YA 5BOXA 5DS9A 1HLVA 5DD4A 2ZXJA 3GCMA 1XNRE 1JE8A 2M7BA 3U1KA 4EM1A 5ILVA 2HYGD 4CO8A 1EJ9A 4IX7A 2V86A 5L3BA 1KU9A 2EIMH 1V4RA 2G0EA 3FIGA 3OYBA 1S29A 3D5RC 2O3FA 2L92A 3KZYA 1BIAA 1T6SA 2ME0A 3WG7H 5TGTA 2L7FP 1LQ1A 2EA4A 2DA6A 1BOBA 3LOCA 3FX3A 1VQ4I 1S7EA 4XLFA 1FMWA 2V85A 4ZH4F 3V8LA 1X1PA 2DTRA 3KYLA 2DQLA 1U5TC 1JTXA 3FHZA 2RS7A 4DUZE 2N8GA 1MBHA 2L2NA 4Y15A 2ZJQF 2V1DA 4N9IA 4LG0B 1T08B 5LEJA 2LO3A 3DBRB 3I53A 1UHWA 4PJ0C 3FDYA 4WSPA 4BNCA 4B3RE 1F5TA 2HFHA 2XPWA 1MH4A 4ZYEA 4A93J 4E6KG 1FLIA 1IRZA 1FSEA 3FKJA 2H6BA 5D6FA 1Z21A 1WJCA 3OIOA 3LA2A 1U5TA 3FXKA 3GXOA 3A2KA 2HQRA 4MLVA 2KDOA 3DXJF 4DYRA 2ECBA 1H9TA 1OYWA 3A1YA 4LJZF 1OCZH 2BY2A 3HOYJ 1PJSA 4IOAF 3J81K 3CTAA 4CCLA 2YSPA 3K6QA 1K83J 4I76A 4AYBN 5C4JJ 3OYFA 2ESHA 1OMIA 4WK8F 3AL0C 3G2BA 1O3QA 3ZGKA 3I9V2 1A31A 2QSGX 2DN0A 5A2QZ 1R22A 2EPZA 1IQOA 4M73A 1R23A 3CP8A 1YS6A 1XCVA 1T33A 2V79A 4R2AA 4M9VC 1X2NA 2CQQA 1LFUP 1R4NB 5HLTA 2EN3A 3LL7A 2DB2A 3OYNA 2Y2ZA 4C2MJ 2QEXI 1JGSA 3P5JA 1LPQA 2G9WA 1EKZA 3BTIA 3E5QA 3UR3C 2L01A 3A0HC 3C1DA 5FKNA 3GTOJ 3WGIA 5B66C 1DI2A 3BZ6A 3BOQA 1ZYRF 1OR7C 4RLFA 1Z91A 2ISYA 1W36C 2K9SA 2DXIA 3FM3A 4ZYGA 5DCMA 4BXUA 3H3VK 3ML6A 2PMUA 2WBTA 2NRAC 1JTYA 2F2EA 4DGWB 1X6FA 2LK2A 2LOOA 1R9TJ 2WZOA 1V54H 2FRHA 2BZTA 2EZLA 1VQKI 2DLLA 1X48A 1H8AC 2E1OA 2P81A 1PDNC 3BC8A 2R7DA 4X0GA 1PYVA 2XGEA 3CLQA 3HB9A 3SFIA 4EQQA 3OL4A 5GAEJ 4EM2A 5EZHA 3L2UA 2EPXA 2FE3A 3OOPA 3PFYA 5F6FA 5E3MA 4A3MJ 1OR7A 2CUZA 3TO7A 2EQ3A 2H36X 1UFMA 3VYTB 3DU5A 2N3HA 2NAZA 2EMKA 3RPUA 2LUPB 1N33E 4XL9A 1JHHA 4F52A 3S16J 2CV1A 1L4SA 4XR6A 2Y0SA 3HM5A 2JYAA 3FXJA 1ZH5A 2ZJRF 3HUGB 4PSXA 2R5YA 1H89C 1U78A 1XDSA 5EEAA 1BR2A 2NS0A 4FQGA 1I50J 1RR7A 1P4AA 4LB6B 2LRDA 4I6ZA 2DK8A 3K1PA 1U6GA 2YTDA 3MHSC 1W36D 1SVOA 1T56A 3WTVC 1XMOE 2JPAA 2EPFA 1VQPI 1FP2A 2XC7A 3RPUD 5BR8E 1WVRA 3FIWA 3W2VA 2EPPA 1ONVA 2P5KA 1TF6A 1Z9CA 3RMPA 3KCCA 2LTRA 5BS6A 2IS6A 1W7PB 4R2QA 2IRFG 4LK1F 4ENJA 5IV8B 1FY7A 2R5ZA 1U9NA 1YLFA 3ECRA 2B7EA 2BV6A 2GOXB 2FUG2 3I5UA 1Q1HA 3K7AJ 2X51A 2ETHA 3BY6A 1JKRC 4WFTA 2L3CA 2ZMEB 4WWCA 3S2WA 2OTLI 3WTSC 2NABA 3WGGA 3W2WA 5AASA 4BDYA 1GHCA 2IGMA 2CRGA 2EFQA 3ZQ7A 2EOJA 2MKDA 2VXZA 2M0MA 1N34E 1A1HA 2VIXA 2RVCA 3RZDJ 1TQIA 2XPUA 2DMYA 3C4BA 1KQ8A 2NS8A 2LF8A 4RGSA 3EUHC 4FX4A 2DOAA 2JOXA 1TBXA 4NUBA 2XASA 4AC0A 3ECOA 3ZOBA 2X9DA 3PNVA 4ON0A 2P4WA 3OYDA 3HOZJ 1G8XA 4F9CB 3RYPA 1BI1A 3F8MA 3O6BB 2LDUA 2HHHE 5EG0B 3Q0WA 3P1XA 2QCOA 4U87A 2EQ0A 1DPRA 1SFEA 1VTNC 1V3FA 3CMYA 3CF5F 1T4OA 2MBFA 3KZZA 4PDKA 4A3GJ 5EEHA 3VHTB 2CW0F 2GXGA 3CJQB 3FXQA 1Y8QB 2G7HA 3CP2A 2HYJA 4P55A 2ELJA 2EM3A 4X65E 1D0YA 5FLXC 5GPCA 2K3PA 5IT9C 1R5HA 1XGSA 2D5VA 3CCUI 3BBGA 2X1DA 3WE2A 4DR7E 2KRCA 3D0SA 1UHMA 3Q0UA 5JLXA 1ACIA 1E17A 1NEIA 3QP5A 2DTZA 2E1CA 1KZHA 4YY3E 3MD2A 2DMTA 2Z16A 2FBIA 3T8RA 3CC2I 4O3MA 5FB2A 4M2ZA 1O3TA 1ETVA 2UUAE 2GAUA 5HS9A 5J1RA 4LF7E 3V7SA 4ESBA 2EMFA 5HODA 3E6BA 3PNTA 1L3LA 2ODRD 1IMUA 2WAEA 5CQGA 2M7AA 1WKMA 1R4MB 1MKMA 2ZXWH 1ITYA 3OYLA 3TL4X 1P2FA 3E0JB 3K69A 5K5RA 1GV2A 3VYYA 1XDUA 1PUFB 3I4MJ 3EUKL 2F4MB 2H1KA 3TW7A 4PFPA 1X3CA 1UELB 2EM6A 2ZXHA 2X6OA 4CDGA 3VOEA 3BZCA 2IS1A 2EOXA 3S3NA 2EMHA 5LL6R 3WTWC 4M0VA 1W5SA 1WJAA 1XN7A 4M74A 2R3SA 3VK6A 1XX5A 2GBYA 2MW8A 2IEKA 4V2GA 1SMYF 4J01A 1YJNI 2FOWA 2MLGA 2KIQA 4PJMA 2Z33A 2HVQA 1UZCA 1EH6A 1O7LA 3J80K 1ZGJA 3R4KA 4LIUA 4QTRA 1XS9A 2MC5A 3JU0A 1RMDA 2R93J 3HTUA 3DLAA 5F3WA 5IOYA 1H0MA 1DU6A 1MBFA 3BCAA 2IA1A 1R1TA 1RETA 5FKLA 5A6BA 4JI4E 3WTXC 1G3WA 2XGXA 4F3QA 4I02A 1XD7A 3C18A 4D9JA 1VQNI 4XRSG 5EJCA 1ZU1A 2NVTJ 1QRYA 1GT0C 4Q5SF 1QBJA 1H9GA 2QQBA 3DPUA 1NH3A 4Z6YA 4BE1A 5FKOA 1J2XA 2HZDA 1Z7UA 2YTGA 4GEQB 1W5TA 1IO2A 1HXDA 1R36A 3AG2H 4GYGA 4GRIA 1DUXC 2M7QA 5A6BD 1G6NA 1MBKA 2ADUA 3FISA 3H92A 3KZIC 1PJQA 2DA2A 3Q5FA 1H88C 3K4JA 5AIPA 4JI3E 3CCLI 1SAUA 1Z6RA 4JK1X 3VB2A 2L2MA 4DV3E 1XGNA 1SVMA 4KJZA 2UXCE 2K7LA 1ZR9A 2R7SA 2XKOA 1BN5A 2DYRH 3IL2A 2PBIA 2IT0A 2DOFA 2V1XA 3OYCA 3KEQA 1OISA 3TP3A 3MZYA 2ELKA 2I13A 1RKWA 3GLXA 3BROA 3RYRA 4J8ZA 2B0LA 2PX9A 4DR2E 4E7KA 1FT9A 1B6AA 2L54A 3OMLA 2DJNA 2VRDA 4AQYE 1ETXA 3EUAA 3FXUA 3IWZA 2VKVA 1YRNB 1AH5A 3HKZA 3CCVI 2CQKA 1ZRCA 1X1DA 5K7ZA 2WADA 3PNYA 4G12A 3RQ4A 2IGNA 4P9UA 3H5AA 2OCCH 5HDNA 2F48A 2OC6A 2RDPA 1X58A 1ZGWA 2RAEA 4JI0E 2VT2A 1KQ9A 5C3EJ 3EQLF 3H9JA 3CUOA 3I64A 5HS7A 1MJ9A 1EH7A 4R2SA 4ENNA 1IDZA 2BHZA 2LT7A 2HOSA 5JHFA 3VODA 2FGGA 2Y9ZA 4G7ZF 2EIJH 4LFBE 4OMZA 1IF1A 2KDZA 2FOKA 1LUJB 5LGUA 2E19A 3LSJA 4G6QA 4ZC3A 3EPZA 2LJUA 1ZN2A 1RI7A 4DV0E 4R8OA 5J40A 3MN2A 4KIFA 3BR3A 2GZWA 4UUSA 2ECCA 5DTDA 1FBSA 2YSOA 1Z7LA 4MTDA 3WU1B 1P7JA 2IVMA 3Q9SA 4CICA 4BE2A 3FBIB 2VQLA 4M3BA 3MZ8A 4B43A 2BE5F 1I1SA 3JAMC 2HZTA 3CCRI 2V8QB 1IBME 4L5JA 2YU8A 3ADGA 5J4VA 4B8XA 4UB6C 1G3SA 4I0AA 1FYMA 1HDPA 1VQLI 2QSFX 3C6MA 2FXAA 4WCGA 2EZIA 2Z1DA 1CQTA 4OX9E 3QWLA 3BR0A 3I4PA 3J81Z 5D4RA 2F5CA 3L9FA 5IYCJ 4ZJZA 1O3SA 5CVUA 4XNFA 2PMZA 3TP0A 2EB7A 4DBRA 2EL6A 3IHUA 1UMQA 4IHXA 3TOAA 2AS5F 4XRSA 3HOTA 2K85A 1YPNA 3RIRA 5KK1A 3THOB 4JQFA 5B5EC 3ZQQA 3KPHA 3K4CA 4EJUA 2WBSA 2R92J 2YTEA 4A3EJ 1QNTA 1MBEA 3B73A 4X64E 2ZFUA 2EBIA 4CZZA 4IF4A 4DV6E 3K1NA 4CHUA 4AM3A 2F6CA 4EJWA 5AC5A 1WJDA 4IKFA 2RGVA 1IN7A 5DUIA 3FXMA 2BW3A 2W82A 2R7ZJ 2WV1A 5HLGA 5E1XA 2W25A 3HJEA 2M30A 2BXZA 3V7CA 2B7VA 2CUJA 4W1UA 2HQ5A 3DKXA 3IKTA 2EJ4A 1MBGA 1JT6A 4AIJA 3OV8A 4XLAA 2LV2A 2VQEE 4IPAA 2DDAA 3JTHA 4YG2F 2KIUA 2EFWA 3ZMTA 3E6CC 2FEZA 3QYEA 4F9AB 2MH2A 1I39A 4UVAA 1I5ZA 1TWHJ 2KRFA 2HU9A 2VODA 2Y30A 3ABKH 2CU7A 2HXIA 4XONA 1K79A 2DMUA 2LMZA 1HF0A 1SR9A 3K4NA 5GADJ 1G2DC 1N32E 3CC4I 1KONA 2YPNA 1YYKA 5L3CA 3GBGA 2HGCA 3EPHA 1FMVA 2W48A 3LSKA 4DR4E 1PVEA 5D8LB 4UHTA 1TT0A 3ESWB 4CYCA 4FHTA 5LHGA 4BKXA 4RAZA 2JPBA 4B3TE 5TJJA 1XGOA 3QOPA 1VQ9I 4A3CJ 1YYWA 5FRNA 4U0VA 2MC6A 1IN8A 4N9HA 4QSHA 4GCVA 2O61A 5FRMA 4EM0B 3ZN1A 1LE8A 3GFJA 4XORA 3OIQA 4UV8A 2BYVE 2EFPA 5DD8A 4HF0A 4HOBA 4BQNA 4IOCF 1OCRH 2NXNB 4DV5E 3HBLA 4FX0A 2LBFA 4C3HJ 2A6HF 4EV0A 5HNFA 2EORA 3G4SI 1IUYA 2Q1ZB 3MMYB 2AXTC 4R2EA 2R0QC 3WU2C 2VPLA 2G7UA 3Q9VA 2LVSA 2E1MB 1YSAC 4EGYA 2CO5A 2NOGA 2QYOA 5CVJA 2ISZA 2B63J 3CC7I 5KL7A 5ICEA 3QOEA 3V7RA 4ZZDA 2DT7B 2OQRA 1EV7A 4HEA2 2QGUA 3VSLA 2EQRA 1UCRA 3LQRA 4B09A 3RI4A 4BMJA 3E5XA 2EA2A 1ETQA 3CLOA 1U3EM 2EN1A 3RJPA 3M7GA 4BS9A 4A3DJ 2EOQA 3M8FA 2JSPA 1LEAA 1X49A 4RH8A 3CQZJ 4C3IJ 1MH3A 4M72A 1SEUA 4B3AA 3V8KA 2HS5A 3GZ5A 4F91B 2XAUA 1ON2A 1Z6TA 2MC4A 3S1RJ 5E3OA 4GFBA 1STUA 2R7OA 3I59A 3M8JA 3M07A 4N4NB 1TW3A 3F9KA 4UY8I 3ZQHA 5EGOA 4PGGA 4BXFA 1KYZA 1X1AA 4RB0A 2JSCA 5GPAA 1HKTA 1YS7A 2Q2EB 5DCFA 3SXYA 1WCMJ 1S7AA 1X6HA 1WWXA 4IO9F 1C0WA 2EOYA 1BBOA 2E1NA 1GLNA 4JI8E 4A2UA 2A69F 2RKHA 1R49A 4HQMA 4XLNF 1J9IA 5KL5A 3ADIA 2Y75A 2YU3A 3L2WA 3T8TA 4A12A 2FBHA 3MWMA 2JA7J 2WV0A 1B8IA 3QU6A 4EGZA 2XB5A 4IRHA 2H8WA 3CO6C 5ICCA 1IDYA 1TW2A 2X1CA 3CCJI 3DBHB 1IXSB 5B1BH 4JBAA 3ZQGA 2RPCA 4II3A 2LSOA 2FNAA 3JRIA 4Y4RA 1ZKGA 1BBYA 1O0WA 4LF9E 1S6LA 4HV6A 3L2CA 2JVGA 4LK0F 2XF7A 3TMOA 2ZC2A 3DTIA 2FU4A 2KKOA 4BEHB 4S04A 2OPTA 4O24A 3HPGA 2EPNA 2QQ9A 3GUDA 1ZG1A 3HOXJ 1MDMB 4MGRA 3FZVA 1X3WB 1BIBA 1NHAA 4II2A 2BB8A 1GZ6A 2GPIA 2PJRA 1N3GA 3CMAI 4UNOA 2M5WA 2K3FA 2XROA 3PO2J 4JI6E 4ETSA 1FJLA 3T1BA 1U8RA 3H3UA 4L8NA 3QP6A 4BHCA 4G8XA 2HOEA 4A6EA 5ILUA 3BDDA 4H0EA 1MEYC 4PJLA 4UB8C 2EM2A 2YU5A 3IUOA 3BR5A 2YT4A 1T4NA 4DV1E 3IH3A 4X62E 3TDUC 1WPKA 4XMYA 1IBKE 3N4MA 2O03A 4RGUA 2EMIA 4LFCE 2JPCA 2RREA 3D5LA 3J80Z 5FJ8J 3MKZA 3SDGA 2V83A 3LWFA 3AV0A 4OAZA 2KIFA 4BAYA 1J75A 4O4KA 1NG6A 1HCRA 3S15J 2RNJA 2HR3A 3JW4A 2EOHA 2K27A 4I8OA 1IW7F 2UZKA 1LVKA 2DGCA 3V8JA 2R7XA 3ZXSA 2IPQX 1MNDA 1FSHA 3OL3A 1WJBA 1XMXA 3OS2A 1CGPA 4NXNE 5M5YJ 1OLTA 1RC7A 3WTUC 1ZAOA 4ESFA 3H09A 3BF2A 1BJAA 5K5QA 2ADRA 4IRGA 2DAOA 2LF7A 5H20A 3P9KA 4U88A 1U9OA 4IHTA 2X85A 1XG1A 1HW2A 4BHBA 1U5TB 1G3TA 3OYJA 1V5EA 2IBDA 4LF5E 5FGMA 1N78A 2GHFA 4BY1J 5BNGA 2YTOA 4EJVA 4BU2A 4NZVA 1YUIA 1FNNA 2CFOA 1D1CA 4XICA 2MH9A 3IP4B 1OFCX 4BC7A 3GFIA 1DQ3A 1RUNA 5AE3A 2IA0A 3GTLJ 1IC8A 2MFZA 1SD4A 2VASA 3O8HA 2L9NA 4PJNA 5LHIA 2ZSIB 4WYQB 2DMPA 2RQPA 1A6IA 2PEXA 2XSDC 4KT5C 5H2FC 4R03A 1R1VA 3HL2A 2ICWG 2GLIA 5LRRA 2ZJPF 1GUUA 3HYIA 1AWCA 2J5PA 2VJ5A 3ONQA 5E20A 4EVIA 5K7FA 5JHUA 3AL0B 4BQQA 2M2EA 5IWAE 4EJTA 3KP6A 5L3GA 2YZTA 1T2KA 5A69A 3FXLA 4F6NA 1QVTA 3HOVJ 1MSFC 3M8EA 2DBBA 4YFKF 2RQLA 3JREA 3ERED 3OYMA 1JUPA 2ENAA 1QQIA 2LKPA 1IZ1A 1ZLKA 4RHBB 5DCMB 3GYHX 2COMA 2LLKA 3DF8A 4L18B 2KT0A 3SJMA 1J09A 2XRNA 3IAS2 3VDXA 4OIQF 2XKPA 4X66E 1KA8A 2YTJA 2VE8A 1QHHD 5CQEA 4HA8A 2F5FA 3SFZA 4RMNA 5L3EA 1HNZE 2DW4A 2EP3A 4OWRB 1Z0XA 5E17F 4IXAA 4H4KC 3G71I 1MD0A 4S0HB 1J7KA 1QZEA 2DOEA 5D5VB 3ISPA 1PP8F 2CFXA 1BW5A 1LVAA 3BR1A 3BP8A 1E2XA 3BTCA 1HNXE 1APLC 2F8BA 2WAFA 2FNPA 4RGXA 2J7JA 2LCEA 3ASNH 1IXRC 4K2EA 4BJ5C 2PN6A 1UBDC 1L0OC 2VBZA 2O0YA 4MLQA 4OOGC 2R5YB 1QPIA 2DFIA 3WHCA 3DU6A 3CUQC 4OIRF 1SFKA 2FSWA 3WTZA 4NDLA 3FXRA 3KEOA 1B8IB 1G4DA 4XKBA 3FXOA 2XAQA 1XPXA 3OYIA 2V6EA 3BJAA 4AIKA 4NXME 2P6SA 4KWYA 2STTA 2OUMA 5AC4A 2HXOA 4B3ME 4FETA 1XSXA 1GXQA 3HOWJ 3HIFA 4HSTA 4KDPA 1B9MA 3ZRGA 4PZJA 4YFNF 4HNUA 2KQRA 3BGHA 2LY9A 5FKMA 3CUQA 3IAM2 4IHSA 3LSTA 4P96A 2R5ZB 4M30A 1WI3A 5F08A 3ADJA 1UG0A 1U8BA 3PIOF 2E60A 4GYIA 4LITA 1BB8A 4JI5E 4KISA 3PQJA 2X6YA 4NB5A 2M4KA 3JRCA 4ZTJA 1SVLA 4AYBA 2PMHA 3ZPLA 1FEXA 3MHHC 2WBUA 2MA3A 2KIMA 1R5GA 5F64A 1JI8A 2OJED 1BI3A 3RQIA 1IRXA 4B4CA 4NQWB 4DBQA 3MZHA 3GTQJ 2XAJA 2X48A 3QYBA 4AUXA 2L9VA 3K70D 1G2FC 2XGDA 5KL3A 2JK3A 3RKYA 3EYIA 2V87A 1BR4A 3ROUA 3O3KA 4YIFA 4V2FA 1YIJI 1B4AA 3ERMA 1RPWA 4HF2A 3E3VA 2EM7A 2XF6A 2C6YA 2CTDA 3HOUJ 3DKWA 1EF4A 2CH0A 1Y56A 3LSHA 2Y0MA 5HDKA 5EEGA 3V4GA 1D8KA 2BXYA 3QPSA 1JKQC 3DEWA 3H3ZA 1X5WA 4KUMA 2UXXA 3L2RA 3ABLH 1WJFA 1WFXA 4XOPA 2B7TA 2EPRA 3R61A 2B3TB 2ODRC 4MFDA 3WU0A 2RTXA 2M4GA 3RPQA 2VBXA 4M3FA 4OMYA 3GLLA 5E8GA 2DA1A 2K4VA 1RZ4A 5KCMA 2ZM6E 5HOOA 2ZXIA 5D5UB 3HOSA 4BYYA 3ECHA 4XKCA 2JA5J 1GXPA 2R7FA 3GFMA 2DO7A 3WGHA 3AAFA 4YRVA 4AD9A 2LG4A 2X0LA 1EA3A 1XSVA 2PQ8A 2VQGA 3QQAA 3M4OJ 4TV7A 2JXPA 3BG6A 4A5NA 4ZDOA 3VFZA 2R7UA 3ZR8X 1A5JA 2JVHA 2DSYA 4G7OF 2FQ4A 4AIDA 2CGPA 3DJWA 3DPLC 3C6KA 5ED4A 2IGOA 2JJ7A 2EE8A 2DDBA 5EF6A 3HG9A 1YX5A 4QPQA 4A5MA 4KIGA 5ILSA 5LGTA 2YTFA 4DUYE 4QIWN 3K9TA 4I09A 3WHBA 4MEYF 1QU6A 2ZMEA 1I3AA 1FOKA 3CMEI 3F8NA 1KU2A 3RKQA 3L2VA 2HOAA 4DV7E 1XB4A 2JTVA 2LE2A 3UNGC 2ENCA 1SD5A 2ZCWA 2FV4B 1FZPB 3ZQIA 1DU0A 3S1QJ 1FKAE 2DA4A 4FE7A 1HC8A 1BI2A 3HSEA 4KN7X 2R7VA 1W7PD 3KLNA 3LMMA 1T0FC 2LMDA 3TO6A 2V6CA 2NVUB 4ZYDA 4LU9A 4DR1E 3J7Yp 2XGCA 3MSWA 5TRDA 1MJBA 2WY7Q 1IGNA 1A36A 3M99B 4PFOA 4K0KE 3JSOA 3HRMA 2UU9E 2WC2A 3HPHA 2HQAA 2RC4A 2RQQA 2VE9A 4L5EA 3PL8A 4Q4ZF 5K7HA 2Z5UA 2PI0A 2TRTA 2VPRA 2CV2A 1MSEC 4A6DA 2P8TA 1R1UA 4D7NA 3CCQI 4UVBA 1Z1DA 3CZ6A 2A25A 3LAJA 1IN4A 1LEBA 2EPCA 2RSMA 1T0FA 2R7WA 2GIZA 5A2QC 2N3GA 3GVAA 1WH7A 2JWOA 3G1LA 4DR6E 3ELKA 1OPCA 5LBQA 2R7RA 2M3AA 4F2JC 2ZNYA 2L3DA 2FJ1A 2CSHA 1B72B 1T4LB 2OZ6A 5J8CA 3IWCA 1UILA 2RSIA 4O5GA 5CYVA 1MGTA 4LG3A 1PP7U 4FCYA 1Y1WJ 2EMXA 1XMQE 3JRAA 1K78B 2EMWA 2HPMA 4XLHA 3FF5A 1G59A 2L8TA 3FK6A 2NS7A 2M45A 2ZJ2A 1W5CC 2GWRA 3KYCB 4HPQA 2UUBE 4YFXF 2O9LA 1HA8A 3ZMVA 4D5FA 5FD6A 1KYQA 2L7MP 2XVCA 3CJRB 4M6YA 3ZMSA 3ZMUA 1DGWY 2VQCA 3K1MA 2JA6J 3SZTA 1BI0A 2BEOA 1PUFA 2TCTA 2EM9A 3OSFA 1WJEA 4C3JJ 1VQ8I 3OR2C 2YSRA 2EMCA 1BC8C 4IHVA 1Y39A 5LLQA 3BTJA 3C2BA 1XCBA 3AG3H 3K2AA 1JJ8C 2W4SA 1AKHA 1IG7A 2K4JA 2R1FA 2A61A 2EV5A 1ZREA 2JA2A 4L9NA 1YW9A 1FJGE 1Y0NA 1ETYA 3HSFA 1KQ0A 2JVAA 4M9ZA 5FLXK 2MDRA 4O43A 1NTCA 5IT9K 4WSGA 4EMSA 1GTKA 3AKZA 5BQTA 5M3MJ 3W2AA 4U0YA 4M71A 3PIPF 4RB3C 4RM3A 4HBLA 2JY9A 4RAFA 1IJWC 4UUSB 2HGHA 1TQPA 3BWGA 1LFPA 1XMAA 2XDVA 4CZCA 1T98A 2CUEA 4P1WA 5FROA 2I9IA 4PCQA 3I54A 2V4JC 2BVMA 2KHMA 1RRJA 2VC1A 3F21A 4GKJE 2Y9YA 2EOIA 2H09A 2H27A 4DQ2A 2NYXA 4D7MA 4XKVA 2QM3A 5HLHA 2L3JA 1IV8A 4BJTA 2DJIA 5C4XJ 2H6CA 2TDXA 5KL4A 3LFUA 4UVCA 1BL0A 2OBPA 1TWFJ 4B3SE 2VJ4A 5CFFE 2W1OA 1ULYA 3OMYA 1K6OA 5F0FA 1MBJA 1W0TA 2V1UA 2EMAA 1N77A 3MKYB 2DPDA 3OOUA 4CCKA 1R5ID 2HTJA 2HDCA 3BTLA 2OQGA 3DF6A 3MQ0A 3CDHA 2ZB9A 3W6JB 2YRMA 1J59A 2GOMA 3D1NI 1G2HA 4AIHA 3WTYC 4YIRX 2GM4A 1X4PA 4LFAE 3L09A 1J26A 3U2RA 1ZLJA 4L9TA 4UUTA 1PJRA 3OIPA 4ZDPA 4F92B 5IP6A 3J7AG 3F8CA 4I98B 4IEJA 3PFIA 3A01B 1SFUA 4DZJA 2ENHA 1TZLA 4U7DA 3HPZA 5D5XB 3E6DA 1GVJA 1FTZA 1Z3XA 2YR2A 2L4MA 3PSFA 2BW3B 2ZKZA 1YE9A 5L3FA 5DEQA 2EM8A 1K4SA 3BG7A 3U9GA 3M1EA 5AONA 1RUOA 3B02A 3RSNA 3AFHA 1ZGAA 3H9QA 2KJBA 2BOLA 3DV8A 2RN7A 5CVIA 3TEDA 3W3CA 1XGMA 2UUZA 2IS2A 2EOFA 2YTPA 4EATA 1A1LA 2CG4A 2JUGA 5GTHC 1MNEA 3T5XA 1Z67A 4L5NC 1ZTRA 2VUMJ 4RS8A 4LIVA 4XM3A 4DKKA 4ANJA 1OCTC 2CUFA 3S14J 3IWDA 4RM2A 3C2GA 2XB0X 4Q47A 1KYWA 2QBYA 2EN2A 2L6MA 3LA3A 3LA7A 1LDJA 2EFNA 4MLOA 1CF7A 3PUBA 3M9AA 1QVUA 1OYYA 4XSXF 2HOTA 1R00A 3G3ZA 2VBYA 1EH8A 2F5EA 5KNLA 1ZR4A 2DLQA 3I3LA 1T39A 4OU0A 1FTTA 2DIXA 2DLKA 1GQEA 1RKTA 5T6JA 5J3LA 1MZBA 3H1CA 1TP4A 1FBQA 4F6MA 4LGWA 5FD5A 3KLOA 4DV4E 5IYBJ 1USTA 4EJOA 1RESA 2E72A 2EN4A 3MCZA 3CCYA 2M9HA 1TQMA 1WZ2A 4FTHA 3SQNA 1WJPA 3JRBA 2K9LA 4R1HA 2VKHA 1RR8C 3FMQA 3NWTA 4C9YA 5F27A 2YTNA 3SDBA 4E4HA 2VBWA 1DP3A 4ABZA 2ZO4A 2YUSA 1F4KA 1QU3A 1FOXA 2LP0A 2QF7A 4LMYA 1HSTA 2EOEA 2LH9A 3IH2A 2NA2A 3CCSI 3DPTA 2IA2A 4CGZA 4X9JA 1YHQI 1K61A 2DI3A 2H8RA 5M5XJ 2WB1N 3RCOA 2LUQA 2NUEA 2EINH 4DNCA 1BA5A 1RQ0A 1N25A 4OIOF 1KJKA 4DR3E 2KRHA 4JP0A 2WAQN 2ZBKA 4B47A 2K40A 1IN6A 4IQ4A 2EM5A 1OQYA 4HX8A 2DA5A 1ON1A 2EQ1A 4CXFA 1FPQA 1WXRA 2LTSA 2XAFA 3JAMK 2A07F 4JX5A 3ZCOA 1WHQA 4Q28A 1YUJA 3CF2A 1LDKB 3OY9A 3IRQA 4HLXA 3C7JA 1ZELA 5L3DA 3U1DA 2ME6A 2R7TA 5H6QA 2COBA 5J1YA 3ZN0A 4IJDA 3AG1H 5FFZA 2MD5A 3CJNA 3S1MJ 3RKWA 3I59B 3EETA 1VQ7I 1XNQE 1TWCJ 2LY1A 2E35A 2JRMA 3FMRA 1UN6B 2XV4S 1HNWE 3KX2A 4NC6A 1M1EB 1V5FA 4D0PA 2MYSA 2Z2SB 5EDNA 3AG4H 2E2JJ 3F8BA 2KFDA 4U7BA 1G3YA 3RKXA 1VF9A 2V26A 4HZFA 2A6TA 4GDFA 3ZP5A 1I6HJ 4D5CA 1P9QC 2UXNA 3BIDA 1D1AA 4LD5A 2XAHA 4P7DA 5IPAA 3CDLA 2L2KB 4F93B 2AXLA 1S8NA 5E3LA 3QPTA 1J5YA 3A4CA 3DTEA 1JXSA 4JOMA 2O5RA 5FLMJ 1HOMA 2YX7A 3DBLB 2D1VA 2EPMX 4R2CA 2XF5A 3TKYA 1REPC 4AWXB 2K9MA 4BY7J 1Z1BA 2KMUA 4WXDA 5EZGA 3DCFA 4XN0A 1RIOH 2LKXA 2A68F 3QPLA 3BT9A 3CO7C 1YG2A 2K02A 2CPNA 3CD6I 2N8XA 5E79C 1TL8A 3NARA 5JVTA 2X6WA 2O8KA 1PDAA 5HLIA 4IS1C 2NUGA 1YW8A 1QA6A 1P4WA 4KITB 3ZQLA 3HPSA 1QO0D 3I55I 2DMQA 1OKRA 3GZ6A 1HDDC 4UUVA 1TNSA 3H5NA 6PAXA 2EOZA 2HEOA 3FK7A 2K9NA 4G6DA 2LVHA 3GX4X 5DDGA 1QZYA 3GO5A 1V55H 4QLCU 3FMSA 4M3DA 3GFLA 3SEZA 3HDDA 3RTRA 4M3GA 4NC8A 3WTTC 1X3ZB 1S9HA 2HJJA 2QLZA 1VI0A 3J7AO 1KU3A 2EMGA 2LNBA 2E2IJ 5BPIA 3F23A 1FYKA 3SHFA 2QVOA 3B6AA 3PO3J 3IH4A 4DZPA 2E7XA 3VWBA 2CJJA 3OYKA 3J81C 5IOZA 5KAIC 4MTEA 1YITI 1S72I 4HX7A 3N05A 4MIMA 1NG7A 2D2WA 1IRGA 3K6GA 2Y31A 1WQ2A 4JX6A 4Y13A 3I4NJ 3DFGA 4ENMA 4IHYA 3I58A 4L0ZB 2L9RA 3TQMA 3G1OA 1YTYA 1BR1A 5C44J 3JR9A 1VQ5I 4J19A 4BQAA 3ZQFA 1B1BA 1HSJA 4KT6A 2STWA 2L02A 3R60A 3S2DJ 3QAHA 1MMGA 2GLOA 3EPJA 3VYXA 4B1RA 4RAGA 3SZPA 5DYMA 2DU9A 1QZZA 2PRTA 3HSRA 1O3RA 1ZBTA 2VT3A 2FF4A 2EJRA 1X3UA 2EILH 1ZK8A 3NEUA 3TGNA 3IC7A 2ESNA 3BJ6A 2WCC3 2ID6A 1R58A 1AOYA 2OD5A 4BEHA 4LF6E 3S3OA 2MLKA 1ERDA 4NC7A 4M3EA 4A0ZA 4HSRA 1MDMA 2EPKX 1Y6IA 3OS0A 1X1BA 1OYIA 4JI1E 4WXHA 2M9AA 4ENKA 2J5OA 4BBYA 2HDDA 1GVDA 4RDUA 2UXBE 4KHPE 3Q0VA 3J7AY 3T1YE 1FIPA 5KHDA 1F1ZA 3K4LA 3JRDA 3BJOA 1YW7A 3HRTA 2GA2A 2MGQA 5J6XA 1X47A 5J4YA 4MEXF 4XIDA 4B44A 5JR3A 1HW1A 2V9PA 1BOAA 2EMYA 2VJJA 1U0JA 1S7OA 2DT6A 5DNYA 1I94E 1D5YA 5FLXZ 3L1PA 3K4KA 2CQXA 3JSPA 1A1JA 3K4MA 5IT9Z 4P5OA 2UWMA 4E70A 2VQFE 3TDZC 1A1GA 1I6XA 4NNJA 4YEJA 3TO9A 3LSGA 5JI6A 2P7VB 2HNHA 2B9SA 2YX4A 3SEQA 4RBOA 2CSOA 1YZ9A 4A69C 2VOOA 3MKLA 4Y33A 1DDNA 4HG2A 4B3XA 3LAPA 4XKWA 2Y0SN 5JFRA 3GTMJ 2LKSA 3IWBA 2DMIA 1P4XA 1FBUA 3ZMZA 4NHRA 2A5YB 1IBLE 2JN6A 2VONA 1YYOA 2VXDA 1N36E 2YWQA 3U21A 4HTGA 3HGGA 4BHPA 4BL0B 2GXAA 1JUMA 5GAGJ 3L7WA 1HBXG 1ZQ3P 4DOZA 2O6GE 1D8JA 4F7ZA 1JGGA 2BGCA 4LG0A 2JT1A 3E6MA 4G9YA 3HRUA 5KVRA 1R6RA 2LD5A 1D0ZA 3AUZA 4OOIA 5LGNA 4FK5C 3DTKA 2W85A 1A1IA 2DK5A 1MMNA 4XN3A 2GQQA 2LC2A 1ZBQA 4LLGF 1USSA 4MO7A 4R2RA 4UXNA 2FQ3A 3CUQB 2W84A 4R2DA 3K4BA 1FP1D 1BJZA 4DMIA 3JTGA 1K6YA 1O7FA 3MKWB 1J5EE 1VQMI 5H6RA 3K70C 1WHNA 3GF2A 3HTSB 2Z9OA 3T1HE 3G6EI 2EN6A 2Q8KA 4IHWA 2QUFA 4IJAA 2IXSA 2R4GA 3PUFA 4L9JA 2XIGA 5J47A 1A1FA 1TNTA 3F8FA 4MNUA 1JKOC 1I1GA 2NNNA 3R0AA 4C30A 3F3XA 3P9CA 3G1MA 2LJHA 2QKLB 4MHGA 4C2UA 1FYLA 2FA5A 3GTGJ 1A1KA 5F0CA 2UUCE 3CDIA 2M0CA 2F4OB 4XRMA 3REOA 1IXCA 3DEUA 2VB6A 1WSUA 2QQ8A 5B1AH 1T8IA 3MAJA 4XOTA 3BQYA 2EV6A 2OZUA 3D5SC 4RAYA 2L5QA 3GW2A 3LSPA 4X8WA 4A0XA 4X6AJ 2KONA 4E7IA 1DPUA 2PJPA 4PJJA 2L2OA 3WE3A 2E36A 2ZFWA 1ENHA 2EL5A 2EL4A 2CMPA 2W57A 5E1WA 4PSWA 1FIAA 1A04A 3S1NJ 1ETOA 4CYDA 1MIJA 3TW6A 4BC9A 1AA7A 4DW6A 4BE0A 1TN9A 2OCEA 2VJIA 2LFBA 4KYWA 2L7ZA 1DGRM 2E2HJ 3ABUA 4AVPA 2JA8J 1AU7A 2XHKA 3DEEA 1VQ6I 4ZYHA 2EOSA 2YS9A 2HQNA 9ANTA 1K7AA 1KU7A 2CQNA 3R0JA 4RGRA 4ESJA 2E7WA 5D8KB 4F54A 2VOPA 4Z2YA 2ACJA 4HNTA 2YRKA 4R8HA 1XC5A 2GA1A 2KHXA 1Z05A 5TISC 5IY5H 5E3NA 3J7ZI 2VE7C 4FISA 3BR2A 4LTYA 2EPOA 4HDVA 4YIIA 4WF2A 3H5RA 2BBGA 2OU2A 2YTIA 3KP4A 1PJTA 2EZHA 1W0UA 1LJ9A 2EFOA 2Y69H 3J80C 3HUGA 2ELHA 2QENA 3BR6A 2P0WA 3L2QA 3S17J 4HEIA 2UXDE 1IRFA 4KFCA 3GEZA 4XK4A 3ABTA 4IRIA 3HEFA 2M87A 4WX9A 1P6RA 2F5DA 3BPVA 5LRSA 3NAUA 1DGCA 4JV5E 3JAMZ 2AQEA 2CW7A 2L0KA 2K9QA 4WPYA 2ZMEC 2OV7A 4NHJA 3QPHA 1TC3C 4O5VA 1UB9A 1X2MA 1VQOI 2P5LC 5F1JA 2JOBA 1BC7C 5IP9J 5AE2A 4G94A 1IN5A 3GWZA 2HWVA 4BGDA 4NQWA 2VQHA 5AE1A 2NOJB 1ZARA 5DM6F 4P78A 5IYDJ 2EZ6A 2DA3A 2L33A 1W7PA 3EYYA 1SANA 3VYRB 1P47A 1K4TA 2QZ8A 4DYQA 1FWZA 5K5OA 2I5UA 3M3YJ 2MSYA 1W4MA 4I01A 3OYHA 4M9SA 2M8GX 3OR1C 4F55A 4N4OB 2LY2A 3F72A 3EUHA 2ZSHB 3KP5A 4ZZLA 3W6VA 4YELA 4G6TB 4GZNC 1P7IA 2BVLA 1ETWA 2Z3YA 4ITVA 5EYRA 5F04A 3S32A 2VC0A 5GAHJ 1B59A 3S93A 1Y0UA 2EPUA 2I8DA 1X6EA 4LB5A 5ERIA 2XUBA 2WY8Q 2PFBA 2AHQA 2BBYA 5EG0A 4O6JA 1HR0E 3FKIJ 3CCMI 2EZKA 1PUEE 1S5LC 2BY3A 3LMLA 3UKGA 5LMUE 1SD7A 3TOBA 1EKEA 3HXLA 3ZMDA 3F22A 2R7QA 3LFKA 2X6XA 3HKZN 4I2OA 1MMDA 3P9IA 2QBYB 3N97A 4Y7NJ 1UHSA 2KOUA 5LMNE 1D0XA 4HAMA 4ASNA 2JZYA 5E18F 3F6HA 4BQOA 4IQJA 2LR8A 1VNDA 1BBGA 5J1UA 3KP3A 1AKHB 4LOCA 2DA7A 3BG3A 1JKPC 4HV5A 1X19A 2HI3A 2M34A 4WXCA 5E8IA 2R76A 4DV2E 4HX4A 2OTJI 1ZG5A 3EPKA 1MJAA 4RB1A 5TSEA 3J7YJ 3HHHA 1ORKA 4FASD 3R6SA 3JRFA 2EIKH 3JCUC 1R7JA 3GZNB 3VPRA 2JP9A 1YOVB 4L5IA 2Q0OA 3H35A 2CW8A 4HNVA 3LNQA 2RS6A 1WGXA 4LLLA 1TWGJ 2EN7A 3P7NA 2VN2A 3A02A 3OSGA 3OYGA 3I56I 3HHGA 1UAAA 2ELYA 5GTIC 5HVQC 4R2PA 4DR5E 3S3MA 3IWFA 1WI9A 3ZQCA 2XPVA 5CJ9A 5KL6A 2K5CA 2MABA 5D5WB 1OCPA 3CMMA 4PK4A 2VLAA 2QA4I 1WH5A 1S3JA 4M6XA 2BY1A 2E5NA 3FM5A 4KICA 5LD2C 4A3KJ 2H94A 1JT0A 3F6GA 1F9NA 1YFHA 3JTZA 1T95A 2KZVA 1B69A 2VF1A 3BCBA 3ASOH 4HQEA 1B72A 2E5LE 2M1SA 2PMZN 1F43A 1XMKA 2MG4A 1D3YA 2DPUA 4RA2A 1K78A 5LHHA 1D5VA 1I27A 2KZGA 3CJTB 4Y17A 3V42A 1WRJA 5FO5A 1UHZA 2MDGA 2LYCA 1GV5A 1FOWA 4GO1A 4ZYAA 1SFOJ 5FLVA 2PG4A 4MQ9F 1Z77A 1SC7A 1YIOA 5ICFA 4XQFA 4MQVA 4JYKA 4RB2C 1F36A 2K86A 2WTEA 3KE2A 3SZGA 2B9DA 4QPOA 4LF4E 4IZZA 2CV0A 4P9FA 2K4BA 5B3SH 1R71A 1NCSA 1PKPA 2L7KA 4M9XA 2EH3A 5FKKA 3IV5A 5D4SA 5KL2A 2HPIA 2V7FA 3VEPA 1UG2A 5DUKA 2H1LA 4HF1A 3E5UA 1TF3A 5A2QK 3RZOJ 3BZKA 1BM9A 2WA0A 2X4HA 3HGYA 2EOMA 5DM7F 5F0HA 4BDZA 2HYFA 2RNGA 3DQVC 2DRPA 1KGSA 3PM1A 1YRNA 2IW5A 3OYEA
chains in the Genus database with same CATH topology
2HKOA 3IKVA 1YYVA 4XSZF 5J8FA 4KMUX 2QWWA 4L0YB 1TLHB 2QBYB 2DT5A 1FC3A 2IJLA 4BH9A 4R79A 1CF7B 2GXBA 4KMFA 2MC3A 3EDPA 1ZRFA 3L00A 2WWYA 4Q48A 3C3WA 3MEXA 2CWEA 2M1BA 2RV8A 4HYEA 2HTSA 3BPXA 5BMZA 1HW5A 3HRSA 3NRVA 3IRRA 4KIBA 3ULQB 4I0BA 5CLSA 3O2PE 2P7CB 1LDDA 2YPRA 1QGPA 4HDUA 3FWEA 2EWNA 3DP7A 4KN4X 5LEKA 1ODDA 3TQNA 5HDGA 3KP2A 3F6VA 1STZA 2Y48A 2EK5A 4LFUA 5IT3A 4G7HF 1SAXA 1LB2A 5FFXA 2OA4A 4HW0A 1ZG3A 2GIVA 3MFKA 2KJCA 1RNLA 4XBFA 5HS8A 1YQAA 3I71A 2D1HA 4XLPF 1IAWA 3I0TA 4PGHA 3COAC 1HKQA 1U2WA 2NNYA 5E1ZB 3WG9A 4KA4A 2A3SA 3QRFF 1DP7P 3F6OA 4I7HA 4GGGA 2V9VA 3LQQA 2L4AA 5AIQA 3NQOA 5ICGA 1YO5C 4IVNA 5DV5A 2OAZA 4QWQA 1XSDA 2JRTA 5CVRA 3E97A 2FMYA 1SMTA 4N0BA 2W24A 3K0LA 1T38A 1FX7A 1B9NA 1SFXA 4GXOA 4FT8A 4OIPF 3KFWX 1JHFA 2ZNZA 1QPMA 2XAGA 1ZRDA 1P92A 1O57A 3G73A 2A6EF 4S05A 3KP7A 2M8EA 4KNYA 1HQCA 4XRFA 2FMLA 3QU3A 2O8XA 2EV0A 2D45A 3WODF 2CYYA 5D6EA 4OINF 4LLNA 2DQRA 5CVVA 2Q2EA 2P6TA 2FBKA 2HKXA 4HLYA 1J0RA 1SD6A 3W6KB 3K2ZA 2Z99A 2QQAA 1LNWA 3KETA 5BPDA 2PLYA 1ZHFA 3RDIA 4L9VA 1HKSA 2IP2A 4A0YA 5F1RA 3PQKA 1TTYA 4UV9A 3T0YA 4U0WA 2P5VA 5K1YA 5BOXA 5DD4A 2ZXJA 1JE8A 5ILVA 4EM1A 2HYGD 4CO8A 5L3BA 1KU9A 1V4RA 1S29A 2O3FA 3KZYA 1BIAA 1T6SA 1LQ1A 2EA4A 3FX3A 4ZH4F 3V8LA 2DTRA 2DQLA 1U5TC 3FHZA 4Y15A 2V1DA 4N9IA 4LG0B 5LEJA 3I53A 1UHWA 4BNCA 1F5TA 2HFHA 4ZYEA 1FLIA 1FSEA 2H6BA 5D6FA 3LA2A 1U5TA 3GXOA 2HQRA 3DXJF 1H9TA 1OYWA 4LJZF 3J81K 3CTAA 2ESHA 1OMIA 4WK8F 1O3QA 5A2QZ 1R22A 4M73A 1R23A 1YS6A 1XCVA 2V79A 1JGSA 2G9WA 3E5QA 2L01A 3C1DA 3WGIA 3BZ6A 3BOQA 1ZYRF 1Z91A 2ISYA 3FM3A 4ZYGA 5DCMA 4BXUA 3ML6A 2PMUA 2NRAC 2F2EA 2FRHA 2DLLA 1PDNC 2R7DA 4EQQA 4EM2A 2FE3A 3OOPA 5F6FA 1OR7A 3TO7A 1UFMA 2NAZA 3RPUA 1JHHA 1ZH5A 1U78A 1XDSA 2NS0A 1P4AA 4LB6B 2DK8A 3K1PA 1U6GA 3WTVC 1FP2A 1ONVA 2P5KA 1Z9CA 3KCCA 5BS6A 1W7PB 2IRFG 4LK1F 4ENJA 1FY7A 1YLFA 2BV6A 3I5UA 1Q1HA 2ETHA 3BY6A 2ZMEB 4WWCA 3S2WA 3WTSC 3WGGA 1GHCA 2EFQA 3ZQ7A 2VXZA 2RVCA 1TQIA 1KQ8A 2LF8A 4RGSA 4FX4A 1TBXA 2XASA 3ECOA 4ON0A 2P4WA 3RYPA 1BI1A 3F8MA 3O6BB 2LDUA 1DPRA 1SFEA 1VTNC 1V3FA 2MBFA 3KZZA 4PDKA 5EEHA 2CW0F 2GXGA 3FXQA 2G7HA 4P55A 1R5HA 1XGSA 3WE2A 3D0SA 1UHMA 1E17A 3QP5A 2E1CA 3T8RA 2FBIA 4O3MA 5FB2A 1O3TA 2GAUA 5HS9A 3V7SA 4ESBA 3E6BA 1L3LA 1WKMA 1MKMA 1P2FA 3K69A 5K5RA 1XDUA 4CDGA 3VOEA 3WTWC 1W5SA 1XN7A 4M74A 2R3SA 1SMYF 2MLGA 2Z33A 1EH6A 1O7LA 3J80K 1ZGJA 3R4KA 3HTUA 1H0MA 2IA1A 1R1TA 3WTXC 1G3WA 2XGXA 4I02A 1XD7A 3C18A 4Q5SF 1QBJA 1H9GA 2QQBA 1J2XA 1Z7UA 1W5TA 1HXDA 1R36A 4GYGA 1DUXC 1G6NA 3H92A 2ADUA 3Q5FA 5AIPA 4JK1X 1Z6RA 3VB2A 1XGNA 2K7LA 2XKOA 1BN5A 3IL2A 2PBIA 2IT0A 2V1XA 3KEQA 3MZYA 3GLXA 3BROA 3RYRA 2B0LA 1FT9A 1B6AA 2L54A 3FXUA 3IWZA 2CQKA 1ZRCA 4P9UA 5HDNA 2RDPA 2VT2A 1KQ9A 3EQLF 3I64A 3CUOA 5HS7A 1MJ9A 1EH7A 4ENNA 3VODA 4G7ZF 4OMZA 1IF1A 2FOKA 5LGUA 4G6QA 1ZN2A 1RI7A 4KIFA 2GZWA 1FBSA 4MTDA 3WU1B 2IVMA 3Q9SA 4CICA 2BE5F 1I1SA 2HZTA 4L5JA 4B8XA 1G3SA 4I0AA 1FYMA 2FXAA 4WCGA 3I4PA 3J81Z 5D4RA 2F5CA 3L9FA 1O3SA 5CVUA 2EB7A 3IHUA 3TOAA 2AS5F 3HOTA 3RIRA 5KK1A 4JQFA 4EJUA 1QNTA 3B73A 4CZZA 4IF4A 3K1NA 4CHUA 4EJWA 2RGVA 1IN7A 5DUIA 5HLGA 5E1XA 2W25A 2M30A 3V7CA 3IKTA 4AIJA 3OV8A 4IPAA 3JTHA 4YG2F 2KIUA 2EFWA 3ZMTA 3E6CC 2FEZA 2MH2A 4UVAA 1I5ZA 2KRFA 2VODA 1K79A 5L3CA 2HGCA 5D8LB 4UHTA 4FHTA 5LHGA 4RAZA 2JPBA 5TJJA 1XGOA 3QOPA 4U0VA 1IN8A 4N9HA 4GCVA 2O61A 4EM0B 3ZN1A 3GFJA 4UV8A 2BYVE 2EFPA 5DD8A 4HF0A 4HOBA 4FX0A 2A6HF 4EV0A 1IUYA 2G7UA 3Q9VA 4EGYA 2CO5A 2QYOA 5CVJA 2ISZA 5ICEA 3V7RA 4ZZDA 2OQRA 1EV7A 4B09A 3RI4A 1UCRA 3LQRA 3E5XA 2EA2A 3CLOA 1U3EM 3RJPA 3M7GA 3M8FA 1LEAA 4M72A 3V8KA 2HS5A 3GZ5A 1ON2A 1Z6TA 3I59A 1TW3A 4PGGA 1KYZA 4RB0A 2JSCA 1HKTA 1YS7A 5DCFA 3SXYA 1S7AA 1WWXA 1C0WA 2E1NA 4A2UA 2A69F 2RKHA 4HQMA 4XLNF 1J9IA 2Y75A 2YU3A 3T8TA 4A12A 2FBHA 3MWMA 2WV0A 3QU6A 4EGZA 4IRHA 3CO6C 5ICCA 1TW2A 1IXSB 4JBAA 2LSOA 2FNAA 1BBYA 1S6LA 4HV6A 3L2CA 4LK0F 2FU4A 2KKOA 4S04A 2QQ9A 3GUDA 1ZG1A 1MDMB 4MGRA 3FZVA 1BIBA 1NHAA 4UNOA 2M5WA 2XROA 4ETSA 3T1BA 1U8RA 3H3UA 3QP6A 4BHCA 4G8XA 2HOEA 4A6EA 5ILUA 3BDDA 4H0EA 3TDUC 3N4MA 2O03A 4RGUA 2JPCA 3D5LA 3J80Z 3LWFA 2KIFA 4BAYA 1J75A 2RNJA 2HR3A 3JW4A 2K27A 1IW7F 2UZKA 3V8JA 2IPQX 1FSHA 1CGPA 3WTUC 1ZAOA 4ESFA 1BJAA 5K5QA 4IRGA 2DAOA 2LF7A 5H20A 3P9KA 4U88A 4IHTA 1HW2A 4BHBA 1U5TB 1G3TA 5FGMA 4EJVA 1FNNA 2MH9A 3GFIA 1RUNA 2IA0A 1SD4A 5LHIA 2RQPA 2PEXA 4KT5C 1R1VA 5LRRA 3HYIA 1AWCA 2J5PA 5E20A 4EVIA 5JHUA 4EJTA 3KP6A 5L3GA 1T2KA 3M8EA 2DBBA 4YFKF 3ERED 1QQIA 2LKPA 1IZ1A 1ZLKA 5DCMB 3GYHX 2COMA 3DF8A 4L18B 2XRNA 4OIQF 2XKPA 1KA8A 2VE8A 4HA8A 2F5FA 3SFZA 5L3EA 2DW4A 5E17F 4IXAA 1MD0A 1J7KA 5D5VB 1PP8F 3ISPA 2CFXA 1LVAA 3BP8A 1E2XA 2FNPA 4RGXA 1IXRC 4K2EA 2PN6A 1L0OC 2VBZA 2O0YA 2DFIA 3CUQC 4OIRF 2FSWA 3WTZA 3FXRA 3KEOA 1G4DA 2XAQA 3BJAA 4AIKA 2P6SA 2STTA 1XSXA 1GXQA 3HIFA 4KDPA 1B9MA 4YFNF 4PZJA 3CUQA 4IHSA 3LSTA 4P96A 4GYIA 3PQJA 4NB5A 3ZPLA 2PMHA 2KIMA 2MA3A 1R5GA 5F64A 1BI3A 3MZHA 2XAJA 3RKYA 3EYIA 3ROUA 3O3KA 4YIFA 1B4AA 4HF2A 3E3VA 2C6YA 3DKWA 2Y0MA 5HDKA 5EEGA 3V4GA 1D8KA 3H3ZA 4KUMA 2UXXA 3R61A 3WU0A 3RPQA 2VBXA 4OMYA 5E8GA 1RZ4A 5HOOA 5D5UB 3HOSA 4BYYA 3ECHA 1GXPA 2R7FA 3GFMA 2DO7A 3WGHA 3AAFA 4AD9A 2X0LA 1XSVA 2PQ8A 4TV7A 4A5NA 3VFZA 4G7OF 2CGPA 3DPLC 5ED4A 4A5MA 4KIGA 5ILSA 5LGTA 3K9TA 4I09A 4MEYF 2ZMEA 1FOKA 3F8NA 1KU2A 1XB4A 2JTVA 1SD5A 2ZCWA 1FZPB 1BI2A 3HSEA 4KN7X 1W7PD 3KLNA 3TO6A 2V6CA 4ZYDA 5TRDA 1MJBA 3JSOA 3HRMA 2WC2A 2RC4A 2VE9A 4Q4ZF 2Z5UA 2PI0A 4A6DA 2P8TA 1R1UA 4UVBA 1Z1DA 3LAJA 1IN4A 1LEBA 1T0FA 3GVAA 3ELKA 1OPCA 5LBQA 2ZNYA 2L3DA 2OZ6A 5J8CA 5CYVA 1MGTA 1PP7U 1K78B 3FF5A 2M45A 2ZJ2A 2GWRA 4YFXF 3ZMVA 5FD6A 2XVCA 4M6YA 3ZMSA 3ZMUA 3K1MA 3SZTA 1BI0A 2BEOA 2YSRA 1BC8C 5LLQA 1XCBA 2K4JA 2A61A 2EV5A 1ZREA 4L9NA 1YW9A 3HSFA 1KQ0A 4M9ZA 5FLXK 5IT9K 4EMSA 5BQTA 4U0YA 4M71A 4RB3C 4HBLA 1TQPA 3BWGA 1XMAA 1T98A 4PCQA 3I54A 2VC1A 3F21A 2H09A 2H27A 4DQ2A 2NYXA 5HLHA 2QM3A 2H6CA 2TDXA 4UVCA 2OBPA 1ULYA 1K6OA 2V1UA 2DPDA 2HTJA 2HDCA 2OQGA 3MQ0A 3CDHA 3W6JB 1J59A 4AIHA 3WTYC 3L09A 3U2RA 1ZLJA 4L9TA 3F8CA 4I98B 3PFIA 1SFUA 4U7DA 5D5XB 3E6DA 1GVJA 2YR2A 2L4MA 2ZKZA 5L3FA 5DEQA 3U9GA 3M1EA 5AONA 1RUOA 3B02A 1ZGAA 2KJBA 3DV8A 2RN7A 5CVIA 1XGMA 2CG4A 3T5XA 4RS8A 4Q47A 1KYWA 2QBYA 3LA3A 3LA7A 1LDJA 2EFNA 1CF7A 3M9AA 4XSXF 1OYYA 1R00A 3G3ZA 2VBYA 1EH8A 2F5EA 1T39A 4OU0A 1MZBA 1FBQA 4LGWA 5FD5A 3KLOA 1USTA 4EJOA 3MCZA 1TQMA 3SQNA 4R1HA 3FMQA 2VBWA 1F4KA 2ZO4A 4LMYA 1HSTA 3DPTA 2IA2A 4CGZA 2DI3A 4DNCA 4OIOF 2ZBKA 1IN6A 4HX8A 1ON1A 4CXFA 1FPQA 2XAFA 3JAMK 2A07F 1LDKB 3IRQA 4HLXA 3C7JA 5L3DA 3U1DA 5H6QA 3ZN0A 5FFZA 2MD5A 3CJNA 3RKWA 3I59B 3EETA 3FMRA 2XV4S 4D0PA 3F8BA 4U7BA 1G3YA 3RKXA 4HZFA 3ZP5A 2UXNA 4LD5A 2XAHA 2AXLA 1S8NA 3QPTA 1J5YA 1JXSA 2YX7A 2D1VA 3TKYA 1REPC 4AWXB 4WXDA 1RIOH 2A68F 3CO7C 1YG2A 2K02A 5JVTA 5HLIA 1YW8A 1P4WA 1QO0D 3GZ6A 1OKRA 4UUVA 1TNSA 6PAXA 2HEOA 4G6DA 3GX4X 5DDGA 1QZYA 3GO5A 4QLCU 3FMSA 3GFLA 3RTRA 3WTTC 2QLZA 3J7AO 1KU3A 2LNBA 5BPIA 3F23A 1FYKA 3SHFA 2QVOA 2E7XA 4MTEA 4HX7A 2D2WA 1IRGA 1WQ2A 4Y13A 3DFGA 4ENMA 4L0ZB 3I58A 1YTYA 4BQAA 1B1BA 1HSJA 2STWA 2L02A 3R60A 3QAHA 3SZPA 5DYMA 2DU9A 1QZZA 3HSRA 1O3RA 2VT3A 2FF4A 2EJRA 1X3UA 3NEUA 3TGNA 3IC7A 2ESNA 3BJ6A 1R58A 1AOYA 2OD5A 2MLKA 4A0ZA 1MDMA 1OYIA 4WXHA 4ENKA 2J5OA 1F1ZA 3BJOA 1YW7A 3HRTA 2GA2A 5J6XA 4MEXF 5JR3A 1HW1A 1BOAA 1S7OA 5FLXZ 3JSPA 5IT9Z 4P5OA 2UWMA 4E70A 3TDZC 1I6XA 3TO9A 5JI6A 2P7VB 2YX4A 2CSOA 2VOOA 1DDNA 3LAPA 5JFRA 1P4XA 1FBUA 3ZMZA 2A5YB 2VONA 4BHPA 3L7WA 1HBXG 2O6GE 1D8JA 4F7ZA 2BGCA 4LG0A 2JT1A 3E6MA 4G9YA 3HRUA 5KVRA 4OOIA 5LGNA 2W85A 2DK5A 2GQQA 4LLGF 1USSA 4UXNA 2FQ3A 3CUQB 2W84A 1FP1D 3JTGA 1O7FA 5H6RA 3GF2A 3HTSB 2Z9OA 2Q8KA 2QUFA 4IJAA 4L9JA 2XIGA 1TNTA 3F8FA 4MNUA 1I1GA 2NNNA 3R0AA 3F3XA 3P9CA 4MHGA 1FYLA 2FA5A 3REOA 1IXCA 3DEUA 1WSUA 3MAJA 2EV6A 2OZUA 4RAYA 3GW2A 4A0XA 1DPUA 2PJPA 3WE3A 2ZFWA 2W57A 5E1WA 1A04A 4CYDA 4KYWA 3ABUA 4AVPA 2XHKA 4ZYHA 2HQNA 1K7AA 1KU7A 3R0JA 4RGRA 4ESJA 2E7WA 5D8KB 2VOPA 4Z2YA 2ACJA 4R8HA 2GA1A 1Z05A 4HDVA 4YIIA 4WF2A 2OU2A 3KP4A 1LJ9A 2EFOA 3HUGA 2ELHA 2QENA 1IRFA 4KFCA 3GEZA 3ABTA 4IRIA 2M87A 4WX9A 1P6RA 2F5DA 3BPVA 5LRSA 3JAMZ 4NHJA 3QPHA 4O5VA 1UB9A 2P5LC 1BC7C 4G94A 1IN5A 3GWZA 2HWVA 4NQWA 1ZARA 1W7PA 3EYYA 2QZ8A 1FWZA 5K5OA 1W4MA 4I01A 4M9SA 3F72A 3KP5A 3EUHA 4ZZLA 2Z3YA 2VC0A 1B59A 1Y0UA 4LB5A 5ERIA 2XUBA 2PFBA 2BBYA 4O6JA 1PUEE 1SD7A 3TOBA 3ZMDA 3F22A 3LFKA 4I2OA 3P9IA 3N97A 4HAMA 4ASNA 2JZYA 5E18F 3KP3A 4HV5A 5E8IA 4WXCA 4HX4A 1ZG5A 1MJAA 4RB1A 3HHHA 3R6SA 1R7JA 4L5IA 2Q0OA 4LLLA 3P7NA 2VN2A 3HHGA 5HVQC 3IWFA 1WI9A