4ZYDA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
LVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPAHRVIAENGIGGYSRGVKLKRALLELEGVKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 38
structure length 149
sequence length 149
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zydA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zydA01
1G4DA 2O03A 5L3GA 1FP2A 5HS7A 3ZQ7A 3E97A 3V4GA 4L9TA 3VOEA 3NQOA 3JTHA 2DO7A 3V8LA 3QAHA 4P96A 3WGHA 4LGWA 3GZ5A 1ZHFA 3IRQA 4BHCA 3L7WA 3KP4A 1AWCA 3KEQA 1ZARA 1D8JA 2BE5F 2FU4A 3ROUA 3K1MA 1HXDA 1SD4A 4IHSA 2K4BA 3J81Z 1LDJA 2W25A 1TW2A 1F9NA 4ON0A 2JSCA 2HTSA 3BJ6A 2RC4A 4P5OA 3ZP5A 1J9IA 2EFPA 4LG0B 2W57A 1ZN2A 2E1CA 2MC3A 3F23A 4A0ZA 3D0SA 2VOOA 2JTVA 3ZN1A 4IHTA 2VBZA 2BBYA 2GQQA 2WWYA 3M8EA 4LK0F 4KUMA 1P4AA 1SMTA 1P2FA 2O6GE 1T6SA 5E1ZB 3ZMTA 1HKQA 1GVJA 1W5SA 1PUEE 4M6YA 2H6BA 3I53A 2K4JA 2FMLA 4Y13A 3U2RA 3LA3A 3HOSA 2NS0A 1IAWA 3RJPA 5L3BA 1FT9A 4FT8A 4N9HA 1V4RA 3V8JA 1LQ1A 1ZRFA 4Q47A 1KU3A 3B02A 1LEBA 5E18F 1P4XA 2D1HA 4RB3C 3DQVC 3RYRA 1MJBA 4GYGA 2W24A 1YG2A 1QQIA 3HHHA 4HLYA 2XRNA 2XVCA 1MDMB 3I54A 5K5RA 2A61A 4A5NA 3E6DA 3HTUA 5HDGA 1W4MA 4CO8A 3GFJA 2P5LC 5L3CA 2V1XA 2IT0A 5DV5A 2HDCA 4M9XA 3QPTA 3FX3A 4TV7A 3E5UA 3FWEA 4ZYDA 1S29A 5K5OA 4U7BA 2XUBA 3WTYC 4GYIA 4WX9A 1ZGAA 2BV6A 2L3DA 1FZPB 2CGPA 1H9TA 2STWA 4ENMA 3JTGA 2D2WA 5CLSA 2E1NA 3KEOA 2L02A 1FBSA 4KN4X 4EVIA 3H92A 4ZYHA 1RUNA 1SFEA 2UXNA 1U3EM 3D5LA 3KETA 2PN6A 2FA5A 4I01A 5D8KB 1DPRA 1ZLKA 4OOIA 3J80K 3KLNA 5D6FA 1IXSB 5E1XA 4OIRF 5E8IA 5JFRA 3BP8A 2K7LA 3REOA 2FRHA 1B4AA 3R61A 3TOAA 2KKOA 3WTXC 4P9UA 1ZG1A 3GX4X 4OMYA 2DBBA 2VBXA 1KA8A 3ZMSA 5LEKA 1LVAA 1LJ9A 1FX7A 3KP7A 2P6TA 4EM1A 1DP7P 4BAYA 4ESBA 1L3LA 4KICA 4P55A 5JI6A 2QWWA 1IN7A 3IHUA 4GXOA 4CICA 1YFHA 3KZYA 2GXGA 3CJNA 1XB4A 3TO7A 2ZJ2A 5DD4A 5EEGA 1HW5A 3DKWA 2A6HF 4EM2A 5DD8A 3FXUA 5K1YA 4L9JA 2NNNA 2EJRA 2CG4A 2FBKA 2EFNA 4AVPA 3GFMA 2Q8KA 2E7WA 1USSA 3ECHA 1B6AA 2OZUA 4UV9A 2R7FA 3OV8A 1U6GA 4OINF 3ML6A 2OBPA 5LGNA 2ZMEB 3J81K 1I6XA 5D8LB 4MTDA 5ILVA 3LA2A 1R1TA 1V3FA 1O57A 1J59A 1SD6A 4YIFA 3FXQA 3QU3A 1BI0A 2ZNZA 3CO7C 4G7ZF 1Y0UA 3EUHA 3WTZA 3SQNA 1RUOA 4A5MA 1HSJA 1O7LA 2HEOA 2RGVA 4AWXB 4FHTA 3O2PE 1GXQA 1Z6TA 2OA4A 3IKVA 1JE8A 3E5XA 3FMQA 1SD5A 1F5TA 2NRAC 1TBXA 3MQ0A 4UUVA 2O8XA 1KYWA 1JHFA 1HW1A 4L9NA 2ISZA 1ZRCA 3ZPLA 2EA2A 4RS8A 3JSOA 4XSXF 4YFKF 1YIOA 3SHFA 3IWFA 2DU9A 3C1DA 2FEZA 4WXHA 1YQAA 3I59A 2J5OA 6PAXA 5HDKA 2DI3A 1XGNA 3K2ZA 1DUXC 5ILSA 5D5XB 3HRTA 3W6JB 2STTA 2JZYA 3F8CA 2P7VB 4MEXF 4ESFA 1PP8F 5F1RA 1WKMA 1U5TC 1TTYA 4M74A 2LF8A 4ZZDA 3BY6A 4IPAA 3QRFF 1DDNA 2M87A 1O3RA 4XRFA 1S6LA 3P7NA 1KYZA 2ZO4A 3CTAA 5E1WA 1QNTA 3RTRA 4U0YA 4RB1A 2ESNA 3JAMK 2HZTA 5ILUA 1BC7C 2ESHA 1IN8A 1ZREA 4A2UA 4HX4A 3F8NA 1D5VA 3PFIA 1Z6RA 2G9WA 4YIIA 1ZYRF 3K69A 4B8XA 2F2EA 3F6VA 3WG9A 3SZTA 5IT9Z 1MGTA 5BQTA 2DFIA 2WV0A 4D0PA 5L3EA 1P6RA 1R58A 5K5QA 2GWRA 3S2WA 5CYVA 4MQVA 1ULYA 1XCBA 2ZBKA 4UVCA 1FYLA 1P4WA 2BGCA 3K1PA 3WU1B 4RGSA 4ZZLA 4JQFA 4HQMA 4ESJA 1OMIA 2UZKA 2OU2A 4U88A 5D4RA 1TNTA 3OOPA 1XSXA 4CZZA 4LB5A 3HUGA 4NHJA 4UVAA 5E20A 2K27A 2OQGA 2QQ9A 2FSWA 4EJWA 2P6SA 1PP7U 1KU2A 1ON2A 2KIUA 2LDUA 4ENKA 2MLGA 2LSOA 2EV0A 3R0AA 3V8KA 4U7DA 3TQNA 4G7OF 3SXYA 5CJ9A 4M71A 3HHGA 1MKMA 1W5TA 2MLKA 3EDPA 4N0BA 4HBLA 3KCCA 4OIPF 1K6OA 2DAOA 2OD5A 1R5GA 3GW2A 4RGXA 1CF7B 1QZYA 5FLXZ 4EGZA 1T0FA 1YYVA 5L3FA 5LLQA 1FYKA 4HF1A 1USTA 1RZ4A 1LEAA 2TDXA 2DK8A 1IN5A 2IRFG 4GCVA 1B9NA 3F72A 4UV8A 2M8EA 2A07F 1HBXG 4A12A 4PGGA 3LFKA 5TRDA 3F8MA 3Q5FA 1S3JA 4ZYGA 4NQWA 2XGXA 1O3TA 4BHBA 3L00A 2HGCA 4ZYEA 5FFZA 4K2EA 4BNCA 3KP6A 2GXBA 3M8FA 2HYFA 4JBAA 5E17F 2NAZA 2K86A 4O3MA 1QGPA 2IA2A 3I0TA 4G8XA 3E6BA 2BYVE 3ABTA 1VTNC 5LRSA 4HV5A 1FWZA 5A2QK 3F8FA 2YR2A 5DCMA 5LRRA 4YFNF 3KZZA 4I0BA 5BS6A 3RYPA 3ECOA 3BPXA 4IRHA 4L18B 4HAMA 1RIOH 4RAYA 3LA7A 3EQLF 2HYGD 2QENA 3M7GA 1ZAOA 4BXUA 4EM0B 4FX0A 3CLOA 1C0WA 3HRMA 4PGHA 1OPCA 2HS5A 4LLLA 2L4MA 1K78A 2VBYA 2EWNA 2QYOA 3DF8A 2CWEA 4IXAA 2A68F 2W85A 2MH2A 3L9FA 3F3XA 3CUQA 3CDHA 4A6EA 1ON1A 4WXCA 2JT1A 3CUOA 3RKXA 2JRTA 4L9VA 3F21A 2DPUA 4KA4A 5CVIA 4I2OA 2ISYA 5DEQA 2XKPA 1WI9A 2M5WA 4KIFA 1S7AA 4AD9A 3RKWA 4HX8A 3FXRA 4ENNA 3JAMZ 4EV0A 1UB9A 1KQ8A 4EJVA 4WCGA 1R1VA 2PI0A 3IWZA 4L5JA 3MWMA 5ICCA 5ED4A 2W84A 4M9ZA 3G73A 4GO1A 2Z3YA 2FXAA 1U5TB 5J8CA 1XMAA 4RGRA 2QBYB 4Q4ZF 1R23A 3KP3A 1ZGJA 2UWMA 2VC0A 4HLXA 5H6QA 3I5UA 5CVUA 2V1UA 3I59B 1YLFA 3L09A 3HSRA 3E5QA 3FM5A 4LB6B 1O7FA 4BH9A 2HQRA 4KNYA 3SZPA 4KDPA 3P9IA 3ELKA 3Q9SA 5CVJA 1O3QA 4MEYF 4NB5A 2XHKA 3EETA 3QP6A 1T38A 1BC8C 5D6EA 4CDGA 4PCQA 4ZH4F 3RDIA 3ZMDA 4WF2A 3IKTA 5DDGA 4I0AA 1HSTA 1LNWA 2JPBA 1UHMA 3V7RA 2IA1A 1IN6A 1TQPA 2F5DA 3N4MA 1Z7UA 4RB0A 5FO5A 1R22A 2P8TA 2VC1A 1OYWA 2VE8A 1IZ1A 4RAZA 1KQ0A 3QU6A 4KN7X 3BDDA 4KIGA 2V6CA 4ENJA 4IRGA 3I4PA 3K9TA 5J6XA 4E70A 2Q2EA 3O6BB 3R4KA 1J5YA 2A6EF 3ISPA 4OMZA 1CF7A 4KMUX 4ETSA 3F8BA 2Y48A 4HV6A 2WC2A 3HOTA 1U8RA 3HYIA 1WQ2A 2HKXA 1FBQA 2M30A 2LF7A 4LMYA 2O0YA 4CXFA 1BM9A 2ZFWA 4IF4A 1HKSA 3RIRA 3WGIA 1I1GA 1WWXA 4HA8A 1J2XA 2FQ3A 3HSFA 4N9IA 3QOPA 5FB2A 3JSPA 2RQPA 4CYDA 4R8HA 1R36A 4GGGA 5D5WB 3WTSC 2L54A 1WSUA 4CGZA 1IW7F 1I5ZA 2KIFA 2KJBA 1XSDA 2Z9OA 3VFZA 5A2QZ 2PMHA 4UXNA 2XIGA 4A6DA 4HW0A 2COMA 4HYEA 1JXSA 1YS6A 4XLPF 1Q1HA 4L0YB 1T2KA 2AS5F 3GFLA 4G6QA 2HTJA 1UHWA 1XDSA 5LHIA 3BOQA 2MBFA 5LGUA 5IT3A 2L01A 2P7CB 3ZN0A 4PDKA 3C18A 2ZXJA 2YU3A 2RN7A 3G3ZA 4B09A 2FBIA 2YX7A 1BN5A 1W7PB 4ASNA 1XN7A 4IJAA 2GIVA 3GF2A 2IA0A 1EV7A 2XASA 4KYWA 3WU0A 3B73A 2NYXA 1HW2A 2E7XA 3M9AA 3DP7A 2OZ6A 1ZLJA 1HKTA 2LKPA 4KIBA 2XAGA 2GA1A 1XGOA 1XD7A 1EH6A 1P92A 3N97A 2H6CA 3KP5A 2QZ8A 5IT9K 4EMSA 3DV8A 2Q0OA 1FPQA 3E6CC 3WODF 1SFUA 3I64A 2MH9A 3C3WA 1ZG5A 5LEJA 3WTVC 4OIOF 2WTEA 1J75A 3HIFA 3GLXA 2ADUA 3ERED 2PLYA 1XGMA 1U78A 5JR3A 4U0VA 2QVOA 5LBQA 3LAPA 3GYHX 4EJTA 5CVRA 5DYMA 2RKHA 3P9KA 2PG4A 5BMZA 3U1DA 1FP1D 4HX7A 3Q9VA 1ZRDA 3K1NA 5LHGA 3GZ6A 1EH7A 2C6YA 1XGSA 2PMUA 1XCVA 3ZMVA 1YW9A 2KJCA 4MGRA 1R7JA 2ZMEA 2VBWA 3R0JA 4IVNA 3U9GA 3LSTA 1BI2A 1FYMA 4HOBA 3SFZA 1FY7A 3DFGA 3I71A 2EK5A 3GEZA 1H0MA 2XAFA 2O3FA 5HS9A 3ULQB 2PFBA 3PQKA 5J8FA 4UHTA 3DXJF 4BHPA 4S05A 2V79A 4I98B 4HDUA 2DQRA 3KLOA 2CYYA 3GVAA 1H9GA 1IRFA 4O6JA 1I27A 2EB7A 2IVMA 3R60A 4M72A 2XKOA 4QLCU 4LD5A 5HDNA 5FLXK 3COAC 1QBJA 2EV6A 2ETHA 2CQKA 1BIAA 1BI3A 2A5YB 3LAJA 1YS7A 3HRSA 2Y0MA 1BOAA 1X3UA 3LWFA 5D5VB 5AONA 2VT2A 3WE3A 4MTEA 5E8GA 4XBFA 3RPQA 3BZ6A 5FD6A 3PQJA 5BPDA 2KIMA 2VN2A 3FMSA 3E6MA 3NRVA 2X0LA 3GWZA 1S8NA 1ONVA 1U5TA 3GUDA 4WWCA 1Z1DA 2ELHA 2RDPA 1F4KA 2F5EA 3FZVA 2Z99A 4PZJA 2ZCWA 4XSZF 1BIBA 3MZHA 5HLGA 1B59A 1E2XA 2GAUA 3VODA 2MD5A 2A3SA 5ICEA 2CW0F 1YW7A 2ZKZA 4YG2F 2RNJA 2LNBA 3WE2A 4UNOA 1T39A 2YSRA 3TDUC 1T98A 5LHHA 3J7AO 3E3VA 2H94A 2VOPA 4U0WA 3CUQB 1FC3A 1SD7A 3W6KB 5D5UB 1K7AA 5H20A 1RI7A 2FOKA 5TJJA 2Z5UA 4WK8F 2FNAA 2P5VA 2QLZA 3IRRA 5FFXA 4UVBA 3F6OA 3BROA 3FF5A 2V9VA 4LJZF 3MAJA 2KRFA 2EV5A 4Q48A 1TQIA 2NNYA 3R6SA 2M45A 3M1EA 1IUYA 1K78B 4LLNA 1PDNC 2EFQA 3TKYA 3T5XA 1MDMA 3EYIA 4IRIA 3BWGA 2RV8A 1TNSA 2FNPA 2CSOA 2IW5A 3RKYA 2H09A 3WGGA 1HQCA 4HF0A 4OU0A 1IRGA 1QPMA 4A0XA 3MFKA 2G7UA 1UCRA 1NHAA 2YX4A 4G6DA 3KP2A 2QBYA 4I09A 3FHZA 2FE3A 3MZYA 3ABUA 4RB2C 3HRUA 1F1ZA 2DTRA 3F22A 1JGSA 4MNUA 5AIPA 5JVTA 3EYYA 1G3WA 2O61A 2J5PA 4F7ZA 2JPCA 1QZZA 1G3SA 3VB2A 1DPUA 2GZWA 4L0ZB 3BPVA 4QWQA 2FBHA 2XV4S 1UFMA 1SAXA 3IL2A 1G3TA 1I1SA 2FMYA 5FGMA 4EGYA 1XMKA 4EQQA 1OYYA 2H27A 4P9FA 4KT5C 2HKOA 4AIJA 4HQEA 1BBYA 4M9SA 2D45A 5F64A 1QO0D 1BJAA 1B1BA 1AOYA 1REPC 3IC7A 1FSEA 2DPDA 1XSVA 5BOXA 1MZBA 1LB2A 2OQRA 4LFUA 3FM3A 1GHCA 3NEUA 1KU9A 3P9CA 1XDUA 2XROA 2QQAA 2VODA 3CUQC 1R1UA 4S04A 4M6XA 2Y75A 4KMFA 4R79A 3T0YA 4R1HA 5L3DA 1E17A 2AXLA 1TW3A 2IP2A 3TDZC 4AIHA 3WTTC 1JHHA 5DCFA 4EJOA 1FBUA 1J7KA 1W7PD 4Y17A 1FOKA 3H3ZA 1TLHB 2VT3A 5D4SA 1SFXA 5BPIA 2XAHA 3T1BA 1IF1A 3HSEA 5EEHA 2G7HA 5DUIA 1LDKB 3LQQA 2MA3A 3DPLC 4LG0A 1A04A 3H3UA 5DUKA 2QM3A 1SMYF 2VXZA 4LK1F 4HF2A 3I58A 1STZA 3BJOA 1WRJA 1KU7A 1O3SA 4FX4A 3FMRA 4OIQF 2M1BA 3GFIA 3MEXA 5HOOA 2EFOA 3CO6C 2VE9A 3V7SA 5HVQC 4WXDA 3RPUA 2ZNYA 2V1DA 5LGTA 1J0RA 2OAZA 1D8KA 1IN4A 1TQMA 1G6NA 1ZH5A 3JW4A 1MJAA 1IXRC 2XAQA 3L2CA 2UXXA 3MCZA 4HDVA 1R00A 5H6RA 5HLIA 2GA2A 3RI4A 1Z05A 3O3KA 2X4HA 3V7CA 3TOBA 1FSHA 2B0LA 4LLGF 2F5FA 4O5VA 2HWVA 3C7JA 1YTYA 3ZMUA 2PBIA 3ZMZA 2QQBA 1B9MA 3LQRA 3WTWC 5KK1A 3WTUC 2HFHA 2P5KA 2Z33A 4BQAA 1RNLA 3QPHA 4G94A 4G9YA 1BI1A 2HQNA 4A0YA 5ICGA 2DLLA 3DEUA 3KFWX 5AIQA 1IXCA 4DQ2A 1D3YA 3T8TA 3HTSB 1Z91A 1KGSA 2PEXA 2HOEA 2VONA 4XLNF 1OKRA 2R7DA 1K79A 2CO5A 1MJ9A 1ZG3A 3TO6A 1W7PA 1FNNA 1OYIA 2HR3A 2DT5A 2EA4A 1G3YA 2P4WA 4JK1X 1FLIA 2XAJA 2RVCA 5HS8A 2DW4A 1EH8A 3KE2A 1YO5C 3GO5A 2DQLA 4CHUA 5DCMB 1KQ9A 1YW8A 5FD5A 1LDDA 4YFXF 5CVVA 1L0OC 4EJUA 4BYYA 2D1VA 2R3SA 4M73A 2QUFA 3QP5A 1U2WA 2L4AA 3J80Z 1GXPA 1Z9CA 3BJAA 2F5CA 1OR7A 4I02A 1R5HA 4Q5SF 3GXOA 2FF4A 4Z2YA 3DPTA 3VEPA 4I7HA 2PQ8A 4AIKA 3K0LA 5KVRA 2DK5A 2A69F 1S7OA 2BEOA 4Y15A 2ACJA 3TGNA 5HLHA 1MD0A 3AAFA 5F6FA 2IJLA 5JHUA 2IPQX 3TO9A 4H0EA 4MHGA 2YPRA 4MQ9F 4G7HF 1ODDA 2CFXA 2K02A 2EFWA 1CGPA 3T8RA 4HZFA 2PJPA 4RGUA 5ERIA 4DNCA 4KFCA 5ICFA 4L5IA
chains in the Genus database with same CATH superfamily
4XN0A 1G4DA 1LVKA 3OR2C 3BT9A 2VJIA 2O03A 3DU6A 5L3GA 1FP2A 5HS7A 3ZQ7A 1E3OC 2V9KA 3GTPJ 1E3HA 1W1WE 2L7ZA 1SVLA 3E97A 4RDUA 1TL8A 3V4GA 4L9TA 3VOEA 2YRHA 4HTGA 1TWHJ 1N32E 3NQOA 3JTHA 4CCNA 3GMEA 2BW3A 2DO7A 4P1WA 2R0QC 2X85A 4BQOA 4DV7E 3M8JA 3V8LA 1YYOA 3QAHA 4P96A 3WGHA 4LGWA 3A2KA 2OUMA 3GZ5A 4DV4E 3BG6A 1WHNA 3OYDA 1ZHFA 5FKLA 3PUBA 2O9LA 1OISA 3IRQA 2DMYA 1W0TA 1MMSA 1X1AA 4BHCA 2Y9ZA 2AQEA 3CJQB 3L7WA 3KP4A 4M3EA 5IT9C 1AWCA 1E3PA 1LFUP 2DJNA 3KEQA 2B7TA 1ZARA 1D8JA 2BE5F 2DT6A 3VYYA 3G6EI 2FU4A 3ROUA 3K1MA 1HXDA 1SD4A 3BCAA 4IHSA 2VJ5A 2K4BA 5C4JJ 4BY7J 5EG0A 4DV5E 2GM4A 3J81Z 1N78A 1LDJA 2VQGA 2W25A 2V88A 1R4NB 1TW2A 2FTXB 2EMIA 4KZSA 3I55I 1YITI 2M8GX 2PJRB 2LYCA 1F9NA 2BVLA 3W3CA 2K4VA 4ON0A 2CV2A 2JSCA 3HBLA 2DJIA 4PFPA 4NC8A 1VQ8I 2JA6J 1ENHA 2HTSA 3BJ6A 2RC4A 3K4MA 4P5OA 3ZP5A 2CFOA 4R2RA 1N34E 4RAGA 2CMPA 1J9IA 2EFPA 4LG0B 2W57A 4LFCE 3HUGB 1ZN2A 2E1CA 2MC3A 3F23A 5CFFE 4A0ZA 3D0SA 2VOOA 2ENHA 2JTVA 1JT6A 5IYDJ 3ZN1A 3ADIA 2LBFB 2VASA 4I6ZA 4IHTA 2NUEA 2VBZA 5BNGA 4N4OB 4XQFA 2HC5A 3FKIJ 2BBYA 2W48A 4D1QA 3ZQGA 2GQQA 5B66C 1N77A 9ANTA 1ZBTA 4XLEA 4L8NA 2WWYA 2VRDA 3M8EA 3LSJA 4B3SE 1X2NA 4LK0F 4KUMA 1P4AA 1SMTA 1TWAJ 4C9YA 3PFYA 2XGEA 4DUYE 1MBKA 1P2FA 2O6GE 4D7NA 1T6SA 5E1ZB 3ZMTA 1HKQA 1GVJA 1W5SA 4XONA 1PUEE 5EGOA 4M6YA 2H6BA 1G2DC 3I53A 2MYSA 2E72A 2K4JA 2FMLA 4W97A 4IHWA 5FKKA 1JGGA 1IRZA 2CTDA 4Y13A 3U2RA 4AYBN 4B3ME 4X64E 3LA3A 2DIXA 3HOSA 2NS0A 3PSIA 1UBDC 1IAWA 1BB8A 4B44A 1A36A 1D1BA 3RJPA 1X1PA 2VE7C 4PSWA 2OC6A 5L3BA 3E7LA 4YRVA 1FT9A 4FT8A 4N9HA 1V4RA 3V8JA 4BEHA 1LQ1A 1ZRFA 1OR7C 4HSRA 3HOWJ 3BBGA 2LFBA 3MHHC 2M2EA 4Q47A 1KU3A 3B02A 1LEBA 1BW5A 2XB0X 5E18F 1P4XA 2D1HA 1ITYA 4RB3C 3DQVC 3RYRA 2WA0A 1AU7A 1MJBA 4GYGA 2W24A 1YG2A 1QQIA 3HHHA 4HLYA 2XRNA 2XVCA 4F9CB 2CW7A 1MDMB 2RTXA 3RKQA 3I54A 5K5RA 2M4GA 3OYAA 3H0DA 2A61A 4HSTA 2IS1A 2LMDA 3E6DA 4A5NA 3HTUA 5HDGA 4BBSJ 1V5GA 1W4MA 4CO8A 3GFJA 1XS9A 1X4PA 3O8GA 2P5LC 3K2AA 4BEHB 5L3CA 1W0UA 5T6JA 2V1XA 2K7IA 2FJ1A 2IT0A 3BR3A 2LCEA 3L2WA 1ORKA 3SYTA 5DV5A 2HDCA 4M9XA 3CMYA 4M3FA 3MZ8A 1XMXA 3QPTA 1HA8A 4X9JA 2WY8Q 2KHMA 3FX3A 4TV7A 2RSMA 1JJ8C 3E5UA 2EBIA 2JP9A 3FWEA 1RPWA 5J4YA 2EMBA 4Y52J 4ZYDA 5KAIC 1VFCA 1S29A 1WJDA 2WADA 4JI4E 1WCMJ 5K5OA 4U7BA 1TWCJ 3CC2I 2KOUA 1R5ID 1X47A 3ABKH 4GFBA 3I3LA 4ANJA 1ETYA 1W5CC 1QA6A 2XUBA 2QSFX 4II2A 3WTYC 3Q0UA 4GYIA 5IYCJ 2MC6A 2WAQA 2Y0SA 4WX9A 4HEIA 1ZGAA 2BV6A 2L3DA 2L7KA 3H09A 1DQUA 2DDAA 2EIKH 3Q3SA 2LY9A 2EPLX 4C2TA 1FZPB 2CGPA 3FBIB 4E7IA 2NUGA 1H9TA 4BQQA 3PNTA 4M3GA 2STWA 2LVSA 4ENMA 2JOXA 3JTGA 2LJHA 3HJEA 1QU6A 2D2WA 5CLSA 3BF2A 3MSWA 2E1NA 3KEOA 2L02A 1FBSA 4KN4X 4EVIA 5GTIC 3H92A 4HEA2 4ZYHA 1RUNA 3S3NA 1SFEA 2UXNA 2VPLA 1U3EM 2CUFA 3K10A 3D5LA 1YX3A 3WG7H 2H1KA 3KETA 4XLHA 4IKFA 2PN6A 2FA5A 4I01A 1BR4A 5D8KB 4BE2A 1DPRA 1ZLKA 3HKZN 4OOIA 3J80K 3KLNA 5D6FA 5C3EJ 2F5VA 2LV2A 2YZTA 2UUZA 1IXSB 3HB9A 1JTXA 2O5RA 4XMYA 5E1XA 5CQGA 4OIRF 2CQQA 5E8IA 1HF0A 5K7FA 2ID6A 1ZR4A 4RMNA 5JFRA 3BP8A 2K7LA 1FEXA 3REOA 2FRHA 3HOVJ 1B4AA 1LPQA 2EM7A 3R61A 3TOAA 4IL6C 2KKOA 3CESA 3WTXC 4P9UA 1ZG1A 3MKYB 5F1JA 3GX4X 4HNUA 3H5RA 3LOCA 1QHHD 4OMYA 2DBBA 3ZR8X 2M9HA 2VBXA 2B9SA 1K61A 1MSEC 1KA8A 3EUAA 3OIQA 3ZMSA 4X6AJ 2K85A 3JRAA 2QCOA 2E5ZA 2BHYA 2A5WA 2E36A 2M9AA 5LEKA 1LVAA 1LJ9A 3K6GA 4AVZA 1FX7A 3KP7A 2P6TA 3C2BA 1Y56A 4EM1A 4A3EJ 1DP7P 4XKVA 4D7MA 3ABLH 4BAYA 4ESBA 1L3LA 2QWWA 4KICA 4P55A 4GXOA 1IN7A 3IHUA 5JI6A 2E5LE 5GAEJ 4LIUA 3GZNB 5FRNA 4CICA 2MG4A 3RZOJ 1HDDC 3KYCB 4PSXA 3C2GA 2XAUA 3BTCA 1YFHA 3KZYA 1UHZA 2GXGA 3CJNA 1XB4A 4CH7A 3TO7A 2ZJ2A 5DD4A 5EEGA 1HW5A 4AUXA 3DKWA 2A6HF 2DRPA 3IP4B 5J1UA 3IAS2 4EM2A 4F9BB 3M99B 5DD8A 2EPCA 4PJLA 3FXUA 2BBGA 1IQSA 2CPNA 5K1YA 4L9JA 1FJGE 2NNNA 2PMZA 3FIWA 2LTRA 2EJRA 4MLVA 5JLWA 2YU5A 2CG4A 3L1PA 3NWSA 2FBKA 4G6TB 2DMTA 2WB1N 4IHVA 2JRMA 1N3GA 4P78A 3L2UA 2EFNA 4B47A 4KT6A 4C3JJ 2EZKA 4AVPA 3GFMA 5KL4A 2Q8KA 2E7WA 3LSKA 1USSA 1ZU1A 3ECHA 1B6AA 2OZUA 3EPZA 4UV9A 2DXIA 1J26A 1VQMI 1UJ8A 1N36E 2N3GA 2R7FA 1R6RA 2KMUA 1T56A 3OV8A 3CCVI 1U6GA 4DBQA 2KL4A 2N3HA 2RAEA 4OINF 4F52A 3ML6A 1VQKI 3I56I 2MDGA 2OBPA 5LGNA 2ZMEB 1ETKA 2EORA 1SFKA 1T33A 2YUSA 2H8RA 2R5ZB 2L33A 3DTKA 2HPIA 3J81K 4R03A 5IP6A 2VJ4A 5H2FC 1I6XA 5LD2C 3I4NJ 1JKPC 5D8LB 4LF5E 4MTDA 5ILVA 3LA2A 1R1TA 1YRNA 1VQ6I 1V3FA 1S7EA 2MC5A 4BS9A 2ENCA 1O57A 3A0HC 1J59A 1SD6A 4YIFA 5IPAA 2M4IA 4GEQB 1PJTA 3FXQA 2VQFE 4ITVA 4J19A 1A6QA 3QU3A 1HDPA 5E79C 1XNQE 1BI0A 1K83J 2V4JC 2ZNZA 3CO7C 4G7ZF 1Y0UA 3EUHA 3WTZA 4BUPA 1PUFA 3SQNA 1RUOA 3AG1H 1WHUA 4A5MA 2X9DA 1HSJA 1O7LA 1SC7A 2HEOA 2DA3A 2RGVA 3FDYA 4AWXB 1Y39A 4FHTA 5DNYA 3O2PE 4AQYE 5LFAA 2DMNA 1UN6B 1GXQA 1Z6TA 2OA4A 3IKVA 1JE8A 3E5XA 2DA6A 2E2HJ 3M3YJ 2F8BA 1BL0A 3E0JB 3FMQA 3S2DJ 3VSLA 1YJ9I 2L9NA 1X1CA 4A69C 1SD5A 1Y8QB 2EM8A 1F5TA 3T1YE 2NRAC 2LP0A 1TBXA 3MQ0A 1GZ6A 4UUVA 2O8XA 2DMQA 2GIZA 3ZQIA 1KYWA 2TRTA 2V26A 1IBLE 2CQXA 1YE9A 1JHFA 2E19A 3GLLA 1HW1A 4L9NA 4CYCA 1XMOE 2ISZA 2OJED 2XF5A 1EA3A 3JREA 2I9IA 3LSIA 1ZRCA 4R2EA 2AXTC 3ZPLA 4RAFA 1RR7A 1HNWE 3KYDB 2FV4B 2EA2A 4JI7E 5J40A 3MHSC 1K4SA 4Q28A 2X48A 4RS8A 3JSOA 3OYLA 4XSXF 2VKVA 4Y33A 2EWLA 5FLMJ 4YFKF 3F6GA 3GCMA 1YIOA 1RESA 2UV1A 4LIVA 1R49A 2MC4A 3SHFA 2O7OA 2IGNA 2DTZA 2FD5A 1WFXA 2DU9A 3IWFA 3C1DA 4XKBA 2LO3A 2FEZA 2L9VA 1IDYA 2V9PA 4WXHA 1P7JA 1WJEA 5BR8E 1YQAA 3TP0A 3I59A 2ZJQF 4DYQA 2J5OA 4JI8E 1QZEA 3ZQLA 1DGRM 1Z21A 6PAXA 3V42A 5HDKA 2EMLA 2DI3A 2IEKA 1XGNA 3K2ZA 4XRSA 1DUXC 3GTQJ 3P1XA 2L7FP 3SJMA 5HODA 5ILSA 5D5XB 5KCMA 1YZ9A 3RCOA 3BLYA 3HRTA 1VQOI 3W6JB 2CH0A 1WJPA 2JY9A 5GP9A 2STTA 1MMDA 2JZYA 3W2WA 3CF5F 2NXNB 3F8CA 4BL0B 2P7VB 2VQLA 3H36A 4MEXF 1NH3A 2JVHA 1MMGA 4ESFA 1PP8F 4QSHA 5AE1A 5F1RA 1WKMA 4E7SA 1U5TC 3H0GJ 1TTYA 4A3IJ 4CCMA 1X1DA 4M74A 2DFHA 2LF8A 4B3XA 4IHXA 4BJ5C 2ECBA 3PO2J 4BXXJ 2IHR1 2Y69H 4YHHE 4ZZDA 3BY6A 1GDTA 2EOOA 4IPAA 5M5WJ 1JK1A 3QRFF 1DDNA 1VI0A 2M87A 2CJJA 4XRFA 1O3RA 1S6LA 3P7NA 1A1JA 1KYZA 4M9VC 1FJLA 5B1BH 2ZO4A 3CTAA 5E1WA 4DMIA 1QNTA 3RTRA 2D9HA 4M2ZA 3ZXSA 3SEZA 2XPUA 4U0YA 2O8KA 4RB1A 2ESNA 3QWLA 4IOAF 3JAMK 2DA5A 2EPKX 3K4CA 1ZR2A 2EPXA 4O43A 1X3ZB 2DLKA 2HZTA 5ILUA 3VSKA 1BC7C 2ESHA 3KWRA 1IN8A 1ZREA 1F36A 4A2UA 4HX4A 1WPKA 4BBYA 3F8NA 1TT0A 5EZHA 1D5VA 3PFIA 3GTOJ 4IZZA 1Z6RA 2LUPB 4BY1J 2G9WA 2NVQJ 1AKHA 4PJJA 3HPZA 4YIIA 1ZYRF 2HDDA 4LF9E 2JWTA 3K69A 4B8XA 2F2EA 3TMOA 3CMEI 3C2HA 1HCRA 1DQ3A 1VF9A 3F6VA 2LC2A 3WG9A 3SZTA 3VWBA 5IT9Z 1MGTA 1LFPA 2EN4A 1N25A 1YOVB 5BQTA 2DFIA 2WV0A 4D0PA 2EIMH 3Q0WA 5L3EA 2EM4A 3ZQQA 4XM3A 1P6RA 1R58A 3ASNH 1WZ2A 2L92A 3JU0A 5K5QA 4FE4A 1NG7A 4M3BA 2GWRA 3S2WA 1JUMA 3ZRGA 3UK3C 2I13A 4GKJE 5CYVA 2LY1A 2GXAA 4DYRA 4MQVA 4N4RB 1ULYA 1XCBA 2ZBKA 3BZKA 4JI3E 4UVCA 2E2JJ 4II3A 5K7HA 1FYLA 3FXOA 2CSHA 2UUCE 1P4WA 1QVTA 2BGCA 2WY7Q 2EN7A 3K1PA 3WU1B 4RGSA 1X19A 2E1OA 4MO7A 4JQFA 2VKHA 4HQMA 5EZGA 4ZZLA 2EOQA 4ESJA 4CCJA 2M7QA 5TISC 5GAGJ 2RNGA 2LLKA 1MIJA 1OMIA 3DLAA 3K4KA 3K4LA 2UZKA 1OJLA 3F0CA 2OU2A 3A02A 4U88A 5D4RA 2EOXA 2LREA 1TNTA 2EMFA 3VPRA 3OOPA 4F9AB 1XSXA 3HKZA 2RSIA 4CZZA 2LRSA 3LSRA 3TP3A 4LB5A 4NXME 3HUGA 4E7LA 3A4CA 1IGNA 2V1NA 1RMDA 1W36C 3AUZA 4NHJA 4UVAA 5E20A 2K27A 3DJWA 2OQGA 2QQ9A 2FSWA 2YTPA 1EKZA 4G12A 4A3FJ 4EJWA 2L2OA 3CD6I 2LE2A 2P6SA 2JR1A 2BY1A 4M3DA 1PP7U 2EL4A 2Q1ZB 4ABZA 1V55H 2ADRA 1KU2A 1FOYA 1ON2A 2KIUA 2LDUA 4A3LJ 3MKLA 4ENKA 1X2MA 2LSOA 2MLGA 3TBIA 3VYUB 1TWFJ 3OMYA 1FOXA 5AE2A 2EV0A 2YPNA 1X6EA 3W2VA 2Q8UA 3R0AA 2DLQA 2YRKA 1MNDA 3PNVA 3V8KA 5GAHJ 4U7DA 3PNYA 3GTGJ 2B9DA 3NWTA 2EOEA 1HNXE 3TQNA 4G7OF 1UELB 3BR2A 3SXYA 5CJ9A 2V87A 4JYAE 4M71A 2HPMA 3HHGA 5KL3A 2YTNA 5ADZA 1EKEA 1MKMA 2B7EA 2E35A 1W5TA 2DYSH 2IGKA 1RKTA 2MD0A 2MLKA 4XK4A 3BTJA 1VQLI 3ZCOA 1NEIA 3EDPA 2L2KB 3BQYA 4N0BA 1MBGA 2ELKA 3OIOA 4HBLA 1VQ5I 4J00A 2WBUA 3KCCA 4LG3A 4CZCA 4OIPF 2EN2A 1T95A 3KEYA 3C6KA 1K6OA 2DAOA 2OD5A 2ZXHA 1R5GA 3BG3A 1Y8RB 2R7TA 3GW2A 4RGXA 1CF7B 2E71A 4Q35B 1YYKA 1QZYA 4YEJA 1FTTA 5FLXZ 5FJ8J 3G71I 1HC8A 4EGZA 1T0FA 3AG4H 1G2FC 1YYVA 2YTIA 5L3FA 4W1UA 5LLQA 1FYKA 4HF1A 2MW8A 2QKMB 1USTA 1RZ4A 1HNZE 2Z1DA 1NK3P 1LEAA 2F6CA 1ZGWA 1T4OA 4M6VA 2TDXA 2DK8A 1IN5A 2LD5A 2IRFG 2WB1A 1B9NA 3PSFA 4GCVA 1T4LB 3F72A 4UV8A 3RZDJ 2V85A 1AHDP 4XICA 2M8EA 2A07F 3GTJJ 1A5JA 1HBXG 4A12A 4PGGA 1ZKGA 3LFKA 5TRDA 3F8MA 3CCUI 3Q5FA 2XPWA 1S3JA 3OL4A 2H8WA 4ZYGA 5HNHA 4NQWA 2XGXA 1SAUA 3GBGA 1UILA 1X3CA 1O3TA 2EOMA 4BHBA 3L00A 4BBRJ 2HGCA 2EPAA 4ZYEA 2R7VA 5FFZA 4K2EA 4F93B 1H89C 4BNCA 2A25A 3KP6A 2GXBA 2CUZA 3RPUD 1LLMC 1NG6A 2QKLB 3CDIA 4BDZA 1B72B 1R9TJ 2UXDE 3M8FA 2HYFA 2RQQA 2L8TA 2LKSA 2YTGA 4JBAA 5EGOB 2EL5A 5E17F 2CQNA 1IV8A 2NAZA 2LT7A 2K86A 4E6KG 4O3MA 4B3AA 2ME6A 4UB6C 2B63J 1QGPA 4X66E 3LSPA 3K4NA 2IA2A 3I0TA 4FK5C 4G8XA 5B3SH 1XPXA 2LUQA 2YT4A 3E6BA 4JI5E 2BYVE 3ABTA 1VTNC 2HDWA 5LRSA 5HLTA 4FCYA 4NZVA 5HNFA 4HV5A 5GTHC 4WSGA 1FWZA 5A2QK 3K7AJ 4BACA 3F8FA 1Z77A 2YR2A 4PJMA 4UUTA 2QEXI 5EG0B 5DCMA 1U0JA 2QF7A 2DDBA 4F55A 2XDVA 5LRRA 4AC0A 2EZHA 3KZZA 4YFNF 4I0BA 5BS6A 2EOJA 3S32A 3RYPA 3ZQCA 3ECOA 2F4MB 3BPXA 4IRHA 4ZDPA 1RETA 4L18B 3FK7A 4HAMA 3SFIA 1RIOH 4RAYA 3LA7A 1L4SA 3L2VA 3EQLF 2JWOA 2HYGD 2EOZA 2QENA 2F48A 4BQNA 2L6MA 2EZIA 3M7GA 2YSPA 2UUBE 1ZAOA 4DOZA 3OYKA 3DBLB 3S17J 2EN1A 4BXUA 4EM0B 4FX0A 2L3CA 3CLOA 4LOCA 2WBTA 1GTKA 1D0ZA 3VK6A 1C0WA 3HRMA 4PGHA 1OPCA 2HS5A 4LLLA 2L4MA 1K78A 4L5NC 2EOSA 4DR7E 2VBYA 2EWNA 2QYOA 3DWLE 4DZPA 3DF8A 2CWEA 4IXAA 3ECRA 2A68F 2W85A 1XMQE 2MH2A 3L9FA 3F3XA 2HJJA 2M3AA 1WJAA 2P0WA 3CDHA 3CUQA 2B3TB 3LSMA 4A6EA 1QVUA 1ON1A 4WXCA 3CCJI 1HR0E 2EINH 2ZJPF 3RSNA 2JT1A 3ERMA 2R7OA 2B7VA 5GADJ 3MKZA 3CUOA 3RKXA 3THOB 2D5VA 3OYJA 2JSPA 2JRTA 1YX5A 4CUGA 2LMZA 4P7DA 4DZJA 4O5GA 5E3LA 4L9VA 3PIPF 1X4OA 5TGTA 3F21A 3LSHA 2DPUA 4KA4A 4BJ6C 2J7JA 5CVIA 3FISA 2X1EA 1JJ6C 2X6WA 2ISYA 5DEQA 3TL4X 4I2OA 2YU9J 2Z16A 3HQ1A 4LF7E 2XKPA 5M3MJ 2XSJC 1MMNA 1WI9A 3K6QA 2CV0A 2M5WA 4KIFA 2EPRA 4LFBE 1YRNB 1S7AA 4AD9A 3RKWA 5AC4A 2R7WA 4CCKA 2ZXWH 4CCOA 4MFEA 3MMYB 4HX8A 2EOIA 3FXRA 3JCUC 4S0HB 4ENNA 2G0EA 1P47A 4NC6A 3JAMZ 4EV0A 2BY3A 2DB2A 1UB9A 1Y6IA 2YRMA 2IS4A 3OY9A 1KQ8A 1QHGA 4EJVA 4WCGA 1OLTA 1VQ4I 2EJ4A 4JX6A 3CCQI 2L9RA 4IOCF 3J7AG 3D5SC 1YPNA 1R1VA 4D5CA 2DA7A 3X2QH 2PI0A 3IWZA 5J3LA 4L5JA 3FBNB 3MWMA 5FRMA 1DGCA 4BGDA 4B1RA 5ICCA 5ED4A 2HVSA 4A3BJ 2H36X 2W84A 3HGGA 3AV0A 2LG4A 4M9ZA 3G73A 1S72I 4GO1A 2CUEA 4RM3A 2EM6A 4JI0E 2Z3YA 2FXAA 1U5TB 5J8CA 1OFCX 1XMAA 1A6IA 4RGRA 2QBYB 4C2MJ 2YSOA 2L7MP 4C3IJ 4Q4ZF 2DT7B 2CUJA 3SDBA 2AO9A 4V2FA 1R23A 2KLOA 3KP3A 1ZGJA 4ZDLA 2UWMA 3RQIA 2W82A 2VC0A 1VQPI 4HLXA 5H6QA 3I5UA 5CVUA 1G59A 2V1UA 3ZGKA 2K9QA 3I59B 3CCEI 2EPUA 2EOFA 2BZTA 1YLFA 3L09A 3HSRA 3E5QA 3FM5A 4JI6E 1TT5B 2AQFA 2DOFA 4LB6B 1O7FA 4BH9A 3W6VA 3H9JA 1MW7A 2HQRA 4NDLA 2XF7A 4KNYA 4IJDA 3HXLA 2WZOA 3SZPA 5IYBJ 3AL0B 2GHFA 4KDPA 1Z67A 3P9IA 3ELKA 3H35A 3Q9SA 3QQAA 5CVJA 3CP8A 1O3QA 2OCCH 2JYAA 4WSPA 1O0WA 5IV8B 4XLCA 2KZVA 3J7Yp 2GLIA 4MEYF 4NB5A 2OV7A 2XHKA 3EETA 3I4MJ 3I9V2 4LU9A 3QP6A 1T38A 1BC8C 2YTEA 1ZR9A 5D6EA 3B6CA 3DPUA 4CDGA 3PJRA 4NC7A 1JKRC 4PCQA 4ZH4F 5A6BD 3H9GA 3RDIA 4WF2A 3ZMDA 3IKTA 4D9JA 1DU6A 2JVAA 1JUPA 5DDGA 1JTYA 4I0AA 1HSTA 1LNWA 5F3WA 3S93A 1ZK8A 2JPBA 1UHMA 3OR1C 4A3KJ 5LMNE 2Y9YA 3V7RA 2IA1A 3CLQA 2ZSIB 4BE1A 2V86A 1IN6A 1PYVA 4K0KE 3BGHA 1TQPA 2F5DA 3N4MA 1Z7UA 4RB0A 1UG2A 5FO5A 4IO9F 1R22A 2P8TA 2VC1A 1JI8A 1OYWA 4I8OA 2VE8A 5F0FA 4FQGA 3EPKA 4KISA 1IZ1A 3J81C 2L3JA 1A1HA 4RAZA 1KQ0A 3BC8A 3QU6A 4KN7X 3BDDA 5FKNA 1M1EB 3OYFA 1MBEA 4R2PA 1X48A 1POGA 4KIGA 2YTDA 4DV2E 4R2CA 3F9KA 3S3MA 2V6CA 4ENJA 3CQZJ 2EMGA 1BW6A 4IRGA 2JUCA 3I4PA 3K9TA 1WJBA 3VHTB 3DBHB 2KONA 4O24A 5J4VA 5J6XA 1BR1A 3WHBA 3ONQA 4E70A 2Q2EA 4BCAA 3SZGA 1ETQA 3O6BB 3CJRB 3R4KA 1J5YA 2A6EF 2FX0A 3ISPA 4OMZA 4KMUX 1CF7A 1YI2I 2EMZA 4JV5E 3CJTB 4RA2A 4JOMA 1IQOA 3JR9A 4ETSA 3F8BA 2V83A 2Y48A 1U9OA 3NARA 4HV6A 2VB6A 2WC2A 1YIJI 2ZB9A 3HOTA 1U8RA 3LMMA 5GPAA 4IHYA 3HYIA 1WQ2A 4MFDA 1FKAE 1EF4A 2HKXA 1ETXA 1FBQA 2X6YA 3TW6A 2M30A 3M4OJ 4YIRX 2BW3B 2LF7A 1D0XA 4LMYA 2O0YA 4CXFA 4E7KA 1Y0NA 2R4GA 4RH8A 1BM9A 3IH2A 3BIDA 1VZ0A 2JA8J 3MD2A 2W4SA 2ZFWA 3OOUA 4IF4A 3CCRI 1HKSA 1LFBA 1X3WB 2IXSA 3RIRA 2IS6A 1TN9A 4R2DA 3WGIA 2HXOA 4F91B 4V19K 2YTOA 1I1GA 1WWXA 4HA8A 4O4KA 3O8HA 1S9HA 1YJWI 2HHHE 2LK2A 1J2XA 5DS9A 2CV1A 4V2GA 4XOPA 2FQ3A 3HSFA 1FIPA 3LMLA 1PJQA 4TUIA 2EPFA 4N9IA 4M30A 1A35A 2HNHA 3QOPA 2EM9A 5FB2A 5DM6F 1ZELA 3CCYA 3JSPA 2E2IJ 5C4XJ 1A31A 5IOZA 1T8IA 2RQPA 4C3HJ 5F04A 4CYDA 4R8HA 2JPAA 3H3VK 1SANA 1R36A 4GGGA 3DBRB 5D5WB 3WTSC 2EP3A 4GZNC 1TZLA 5F0CA 5TSEA 3K70C 3JRIA 2L54A 2MDRA 2DFFA 5E3MA 2R76A 4YY3E 1WSUA 3G1MA 4CGZA 1IW7F 1I5ZA 2L2MA 4BC7A 5KL7A 2KIFA 1LE8A 4KHPE 2VUMJ 1Z7LA 2KJBA 3QYBA 4XIDA 1XSDA 2YS9A 3JRDA 2Z9OA 1WGXA 2GOXB 2I5UA 3VFZA 2EM3A 2L0KA 5A2QZ 2PMHA 3EUHC 2GOMA 3DEEA 4HG2A 4UXNA 2XIGA 4R2QA 3KPHA 4A6DA 3T1HE 4CSWA 4HW0A 1WJ5A 2COMA 2E60A 4HYEA 3OSGA 1JXSA 2H1LA 3HOUJ 1H8AC 2EPPA 4PK4A 3CCLI 2EN6A 3BG5A 3PO3J 2JN6A 1YS6A 4XLPF 3BR1A 3OYGA 1Q1HA 4XL9A 4L0YB 1T2KA 2AS5F 2Y31A 3H9QA 2N8XA 3GFLA 3AFHA 1H88C 3RQ4A 3H1CA 4G6QA 3S1QJ 2HTJA 1UHWA 1XDSA 5LHIA 3MN2A 3BOQA 2ECCA 2BB8A 2MBFA 5LGUA 3OSFA 5IT3A 2L01A 4OAZA 2P7CB 4NQWB 2MGQA 2ME0A 2GLOA 2EQ0A 3ZN0A 4PDKA 4FE7A 3C18A 1JT0A 3H5AA 2ZXJA 2YU3A 2KQRA 4WYQB 2RN7A 3BZCA 1XX5A 4FISA 3G3ZA 4ZC3A 4B09A 2FBIA 2YX7A 1BN5A 1W7PB 4ASNA 1XN7A 4IJAA 2DGCA 2GIVA 3GF2A 3TQMA 2IA0A 1EV7A 2XASA 3FK6A 3S1MJ 2BY2A 4KYWA 3WU0A 3DLLF 5EJCA 1R71A 1NTCA 2F4IA 2KHXA 1PDAA 1R4MB 3B73A 2NYXA 1X6FA 1FIAA 5EYRA 3HZJA 1HW2A 2E7XA 3M9AA 3DP7A 2OZ6A 4QTRA 2ZXIA 1ZAAC 1ZLJA 1HKTA 2CU7A 4Y7NJ 5A6BA 2LKPA 4KIBA 3HL2A 3S14J 1ACIA 1E0EA 2EL6A 2XAGA 2GA1A 1XGOA 3OIPA 1XD7A 2KP6A 2R93J 4KWYA 2YWQA 1EH6A 1P92A 3N97A 2H6CA 4ZJZA 3KP5A 2QZ8A 1RC9A 2Z2SB 2CRGA 5IT9K 1WHQA 4EMSA 3DV8A 2HI3A 2Q0OA 3HEFA 1FPQA 2KPMA 5LL6R 1IBKE 2FOWA 3EPHA 2YTQA 5CPRB 1SVOA 4A3DJ 3E6CC 2VJJA 1MBFA 3WODF 2E1MC 2Y2ZA 2MH9A 3I64A 1SFUA 2JVGA 3C3WA 2LVHA 1ZG5A 5LEJA 3WTVC 3HOZJ 2WAFA 4DR3E 2VPRA 4OIOF 1DI2A 5B5EC 2WTEA 1J75A 2GBYA 3HIFA 4C2UA 4DR4E 3GLXA 2ADUA 3ERED 2PLYA 2WBMA 1XGMA 1U78A 5JR3A 4U0VA 2EMWA 2QVOA 2XGCA 5LBQA 3LAPA 2NVUB 3GYHX 4EJTA 5J1RA 2BOLA 5CVRA 2RKHA 5DYMA 2JA5J 3GTLJ 1GLNA 3P9KA 3OMLA 2PG4A 5BMZA 1I39A 2V8QB 3U1DA 5E3NA 3F6HA 4PJ0C 3JTZA 2XRLA 2ZSHB 2ICWG 4LITA 3ZQHA 1SVMA 2YTJA 1FP1D 4DV1E 4HX7A 3Q9VA 2EE8A 1ZRDA 1A1GA 3K1NA 5LHGA 3IV5A 1I94E 3WHCA 1WI3A 3GZ6A 2VF1A 1EH7A 2C6YA 1XGSA 3CCMI 2PMUA 3CC7I 2DN0A 3S3OA 1ETWA 1XCVA 1J5EE 1PJSA 3ZMVA 4BKXA 3KYLA 1K4TA 1WJCA 1YW9A 1QPIA 3TEDA 2QSGX 3J7ZI 4DUZE 2KJCA 3BR6A 4MGRA 1K6YA 1YUIA 1R7JA 2ZMEA 2VBWA 1APLC 3R0JA 1ETVA 4IVNA 4XNFA 3J80C 3U9GA 3LSTA 1BI2A 4HOBA 1FYMA 3SFZA 1FY7A 3DFGA 1FOWA 1T08B 3I71A 5IXMB 2JK3A 2EK5A 3DKYA 3GEZA 4XLAA 2VXDA 3VDXA 1H0MA 2UU9E 3FKJA 2IAIA 2LR8A 2XAFA 1YHQI 4NXNE 2BXYA 2O3FA 2X1DA 5HS9A 2NABA 1MEYC 3ULQB 2M7AA 2EH3A 1OCRH 2Y0SN 2PFBA 3BTIA 3PQKA 5J8FA 3OYBA 4UHTA 1B72A 2ELZA 3DXJF 4BHPA 4S05A 2XGDA 5FKMA 1NK2P 1OCPA 4BU2A 2LTSA 2K3FA 2V79A 3PL8A 4I98B 4HDUA 2DQRA 1PUFB 3KLOA 3K70D 2E1MB 4HRIA 4X0GA 2CYYA 4C30A 2F4VE 3GVAA 4A3JJ 1H9GA 1IRFA 3CP2A 3HPSA 4O6JA 1I27A 2EB7A 3EPLA 2IVMA 2VQHA 1BBOA 3QOEA 1IO2A 3R60A 2PMZN 2EQ3A 3BR5A 2XKOA 4M72A 4X62E 4DR1E 2ZFUA 4QLCU 4LD5A 5HDNA 1AKHB 5FLXK 3COAC 2EN8A 3CCSI 1QBJA 2EV6A 2ETHA 2CQKA 1BIAA 1BI3A 2A5YB 2M0MA 2WV1A 4BE0A 4ZTJA 3LAJA 4WPYA 2XSDC 2I8DA 4RHBB 2LBFA 3DEWA 1YS7A 3HRSA 3OYCA 4JI1E 2BHZA 2Y0MA 2WCC3 1BOAA 1DGWY 1X3UA 4OOGC 5E3OA 1Z3YA 2RREA 3LWFA 5D5VB 5AONA 2VT2A 3WE3A 4TUGA 4GDFA 1RC7A 4MTEA 5E8GA 4XBFA 1MNMC 3RPQA 2OTJI 1G8XA 2KZGA 3DU5A 3BZ6A 5FD6A 3HOYJ 3PIOF 3OTOE 3PQJA 4F3QA 5M3FJ 5BPDA 3D5RC 2VI6A 3BG9A 3FIGA 2KIMA 1B8IB 3AG2H 4IEJA 2LRDA 2VN2A 3ABMH 3FMSA 4I99C 3E6MA 4AYBA 3IWDA 4LFAE 3NRVA 3GWZA 2X0LA 2LOOA 1S8NA 2M4KA 1VQNI 1ONVA 3PUFA 2MFZA 4CCLA 1U5TA 2GPIA 3GUDA 4WFTA 2EMKA 4A93J 2VQEE 3H5NA 4WWCA 1Z1DA 2EILH 5DTDA 3MVPA 4NUBA 3VYSB 2ELHA 1MNEA 4MLQA 2UXCE 3ZOQB 4QPQA 2RDPA 2DFEA 1F4KA 2F5EA 1AA7A 3CMMA 3FZVA 3OS1A 5KL2A 2Z99A 2EPOA 3ADLA 2DOEA 3C6MA 1GQEA 4PZJA 2ZCWA 4XSZF 4X8WA 4LTYA 2DA1A 1BIBA 4JX4A 2R92J 3MZHA 5HLGA 2W1OA 1B59A 1E2XA 4RM2A 2GAUA 4LF4E 2EIJH 3VODA 3ESWB 2MD5A 2NS8A 3U1KA 3C4TA 4XKCA 2A3SA 1X58A 2CW0F 1YW7A 2ZKZA 3QYEA 5ICEA 4YG2F 1X1BA 2JUGA 4BJTA 2RNJA 2LNBA 2KDOA 4R2AA 3WE2A 1PKPA 2EMYA 4UNOA 3IUOA 2JQ7A 2W00A 1T39A 2YSRA 5AC5A 3TDUC 1X49A 1I6HJ 1VQ7I 1T98A 5LHHA 2E34A 3J7AO 5F0HA 1I50J 1D1CA 3E3VA 1ERDA 2XC7A 2H94A 1XTAA 4H4KC 2VOPA 4U0WA 3CUQB 1FC3A 5KNLA 1SD7A 1IRXA 1WH5A 3OWTA 3W6KB 2CW8A 5FROA 5D5UB 1LKXA 1K7AA 3A03A 4IQJA 2M1SA 5H20A 1RI7A 3UNGC 2FOKA 1S5LC 3FXKA 5TJJA 2Z5UA 4WK8F 4AM3A 2FNAA 1MMAA 2P5VA 2QLZA 2KDZA 4X65E 1EJ9A 4ZYAA 1BJZA 1YUJA 3IRRA 5FFXA 2DA4A 4UVBA 2I10A 3WU2C 3F6OA 1HOMA 3BROA 4NHRA 4MIMA 2K3PA 3L2RA 3FF5A 3A01B 2V9VA 2DYRH 4LJZF 2HQAA 5EF6A 3MAJA 4Y4RA 1IBME 2FGGA 2KRFA 2EV5A 4Q48A 1IJWC 1TQIA 1P7IA 1V5EA 2NNYA 3R6SA 2M45A 3M1EA 2E5NA 1IUYA 1XG1A 3W2AA 2V89A 1K78B 1XC5A 1PDNC 4LLNA 4MLOA 2EFQA 3TKYA 1V54H 3EPJA 2E1MA 3T5XA 1MDMA 3JRGA 3EYIA 1YSAC 4DV6E 4GKKE 4IRIA 3HGYA 3ZQFA 3BWGA 5JLXA 2VLAA 2EM0A 3Q0VA 1ZQ3P 2RV8A 1WH7A 2LTPA 1A1IA 4F6NA 1KJKA 4XRSG 2N8GA 1TNSA 1DU0A 2K9MA 1B8IA 2FNPA 2CSOA 2K5CA 3P5JA 2IW5A 1B69A 4ZDOA 3RKYA 3DCFA 2H09A 3WGGA 2BY0A 4UY8I 4X1EA 2ODRC 2RS7A 2QSHX 1J09A 2X6XA 1HQCA 1Z0XA 1AH5A 3CMAI 4HF0A 1Z1BA 4OU0A 1IRGA 4Y3OA 1CQTA 1QPMA 4A0XA 3MFKA 2G7UA 1UCRA 1MBHA 5M5YJ 1LUJB 1NHAA 1RRJA 2YX4A 2ENAA 5A6KA 4G6DA 1UAAA 3KP2A 2QBYA 1QU3A 3FXMA 2QA4I 4I09A 4JX5A 3FHZA 2FE3A 3MZYA 3ABUA 4RB2C 3HRUA 1F1ZA 2DTRA 2NVTJ 3F22A 2R7ZJ 2JMWA 1JGSA 3IAM2 4MNUA 5AIPA 3G1OA 5JVTA 3EYYA 1G3WA 1TF6A 2O61A 3A01A 2LH9A 2A05A 2J5PA 3LFUA 3OYEA 2KIQA 4F7ZA 2HYJA 2EM5A 2LY2A 4XLFA 2JPCA 1QZZA 2MABA 1G3SA 3VB2A 3BCBA 5A6AA 1DPUA 2JA7J 3NAUA 2GZWA 4L0ZB 3BPVA 4QWQA 3AG3H 3OYNA 2FBHA 1BOBA 2XV4S 4PJNA 5FLXC 1UFMA 2MSYA 1SAXA 2F4OB 1Z3XA 3IL2A 1G3TA 2BVMA 1I1SA 5KL5A 2FMYA 2A6TA 2HZDA 5FGMA 1V5FA 4EGYA 1XMKA 2MKDA 4EQQA 1OYYA 1FTZA 2WBSA 2H27A 3HM5A 2IGMA 3MKWB 2EPZA 1N75A 4P9FA 4KT5C 2HKOA 4AIJA 4HQEA 3CC4I 1BBYA 2NUFA 4M9SA 2D45A 3FHNA 2EMXA 3FXLA 5F64A 4HPQA 1DP3A 3LLHA 1QO0D 2HVQA 4B4CA 1O4XA 1BJAA 2QGUA 3BTLA 4U87A 4XOTA 1ZTRA 4RBOA 5KL6A 1B1BA 1AOYA 2M7BA 3IWBA 4DGWB 1REPC 3IC7A 1FSEA 2DPDA 1XSVA 5BOXA 1RQ0A 2BXZA 4UB8C 1GUUA 1MZBA 4QPOA 3HPHA 1LB2A 3VYXA 2OQRA 3JRBA 5A2QC 4LFUA 3FM3A 2DMUA 4HNTA 1GHCA 3NEUA 1KU9A 1D5YA 3P9CA 2OTLI 1XDUA 2XROA 2QQAA 3IH4A 2VODA 1STUA 3IH3A 1GV5A 3CUQC 1R1UA 4FASD 3M1CA 4S04A 5CQEA 4M6XA 3G1LA 3B6AA 2NVXJ 4R8OA 2Y75A 4KMFA 2COBA 5IP9J 4R79A 4LF6E 2OF7A 1HLVA 3DTIA 2HOTA 3T0YA 4R1HA 2R5ZA 2MKNA 2EPNA 3VYRB 5L3DA 1E17A 2AXLA 1TW3A 2IP2A 2NA2A 3S1RJ 3TDZC 3HDDA 4AIHA 2UUAE 4AIDA 2ZJRF 4A3CJ 3CF2A 4E7ZA 2R7QA 3HPGA 3EQ1A 4PFOA 1MBJA 3WTTC 1JHHA 5DCFA 4EJOA 1FBUA 1J7KA 1W7PD 3BG7A 4DYCA 4Y17A 3HTXA 1FOKA 3H3ZA 1TLHB 2VT3A 4FETA 4NBQA 5D4SA 1SFXA 4M0VA 5BPIA 2XAHA 4E7HA 3BQZA 1OCZH 3M07A 3T1BA 1IF1A 3HSEA 2EOHA 1WXRA 5EEHA 1PVEA 4L5EA 4OX9E 4DJAA 2G7HA 5DUIA 2RPCA 1LDKB 3LQQA 2MA3A 3DPLC 4B43A 2KT0A 4XORA 5DM7F 4LG0A 1A04A 4B48A 4XRMA 3H3UA 5DUKA 3RMPA 1IDZA 1IV6A 2QM3A 2DCEA 2TCTA 1X5WA 1SMYF 2EMHA 2ODRD 2VXZA 4LK1F 1YJNI 4DKKA 2NVYJ 4HF2A 2L9SA 3I58A 1STZA 3SEQA 3BJOA 1WRJA 1KU7A 1JUSA 2CQ7A 1O3SA 2HOAA 4FX4A 3FMRA 1ZBQA 2XPVA 2P81A 5GPCA 3D1NI 4OIQF 4KJZA 1D0YA 2X51A 4RLQA 2M1BA 3GFIA 2DSYA 4BMJA 1SEUA 1SR9A 3E1SA 1PJRA 2LJUA 4B3TE 2K9NA 2R1FA 5IOYA 3MEXA 3C4BA 3IWCA 5AE3A 2DMIA 3AKZA 1UG0A 4D5FA 3UKGA 5HOOA 2EFOA 3S15J 3CO6C 1JKQC 2VE9A 3V7SA 5HVQC 4WXDA 3RPUA 2OCEA 2ZNYA 3CZ6A 1NCSA 1I3QJ 2V1DA 1P9QC 1J0RA 2OAZA 5LGTA 2LKXA 5AASA 1D8KA 3L2QA 1IN4A 3A1YA 1TQMA 4CA0A 4JP0A 2EMAA 1G6NA 1LE8B 1ZH5A 3JW4A 1MJAA 3QPSA 2LBSB 1IXRC 2XAQA 3L2CA 4BC9A 2UXXA 4XKWA 3ADGA 3MCZA 2UXBE 2EN3A 2QQ8A 4HDVA 1R00A 5EDNA 4NNJA 5H6RA 1KZHA 2HVRA 5HLIA 2GA2A 3RI4A 2K9SA 5C44J 1Z05A 3O3KA 2JJ7A 2X4HA 1KONA 3V7CA 5A69A 3N05A 3TOBA 1VNDA 2R7RA 2ELJA 4F92B 1FSHA 2B0LA 4A3GJ 2K9LA 4LLGF 2F5FA 2CT1A 4O5VA 2HWVA 2AHQA 1IG7A 3J7YJ 3C7JA 1YTYA 3ZMUA 4LF8E 5LMUE 2PBIA 2Y30A 4DV0E 3ZMZA 2HXIA 4XN3A 5K7ZA 2QQBA 5M5XJ 1B9MA 2L5QA 3LQRA 5IP7J 3WTWC 2IS2A 5KK1A 2YU8A 2VKDA 3WTUC 1I3AA 3GTMJ 3AL0C 2HFHA 2P5KA 2Z33A 3JRFA 4BQAA 1RNLA 2ZMEC 2XF6A 1FMVA 4UUSA 1GVDA 1WVRA 3QPHA 4G94A 4G9YA 2EQRA 3QYFA 2VKEA 3THNA 1BI1A 4F2JC 1U8BA 2HOSA 1KYQA 2HQNA 2WAQN 1JK2A 2VQCA 5CKTA 4A0YA 2DMPA 5ICGA 3KX2A 2DLLA 3OYMA 3G2BA 3CDLA 5A6JA 3DEUA 3KFWX 2JA2A 3S2HJ 3OS2A 3LL7A 1MH3A 5AIQA 5FKOA 1Y1VJ 1IXCA 4DQ2A 1D3YA 2NS7A 4DIQA 1OCTC 3T8TA 1U9NA 3HTSB 2KRHA 3HOXJ 3BR0A 2NOJB 4KITB 1Z91A 3EUKL 2IBDA 2KRCA 3UR3C 2FQ4A 3TW7A 1W36D 1IC8A 1MSFC 1KGSA 2XB5A 2PEXA 4JYKA 2V6EA 4DBRA 3J7AY 2EOYA 2HOEA 4XR6A 4RLFA 2VONA 4EEFG 4XLNF 1OKRA 2HQ5A 2R7DA 4BXFA 3U21A 1K79A 1N33E 2CO5A 1TWGJ 5F08A 4EATA 5IWAE 3QG5C 1MJ9A 1ZG3A 1Y1WJ 1T0FC 4CYCB 2EQ1A 2EMCA 1VQ9I 4N4NB 3TO6A 1IUFA 1W7PA 1FNNA 3QPLA 1A1LA 1OYIA 2R7SA 1D1AA 2HR3A 2DT5A 2R7XA 3DKXA 2EA4A 1G3YA 3FXJA 2P4WA 2R7UA 4DV3E 2VIXA 4JK1X 2XAJA 1FLIA 3PM1A 2RVCA 5HS8A 3OL3A 2CS3A 2DW4A 1EH8A 2FUG2 5EEAA 3KE2A 1YO5C 3GO5A 4A3MJ 2DQLA 1GT0C 5DCMB 4CHUA 2JXPA 3JAMC 2EZLA 3OYIA 1JKOC 4F6MA 1KQ9A 1WJFA 1YW8A 5FD5A 3A0BC 5IY5H 1RR8C 4PUSA 1XNRE 1SFOJ 1LDDA 4AU7A 2VL8A 1OCOH 5JHFA 3OS0A 5F27A 4YFXF 2EZ6A 3ZOBA 4DR6E 5CVVA 1L0OC 2X1CA 3LSGA 4EJUA 4F54A 4BYYA 1G2HA 2EPMX 5KHDA 2Q2EB 2D1VA 2R3SA 2DODA 3ASOH 4M73A 3S1NJ 2DOAA 2QUFA 1TC3C 3QP5A 1FMWA 1U2WA 1UMQA 2DA2A 4GRIA 3LNQA 2L4AA 2PX9A 3J80Z 2KISA 1GXPA 3DTEA 2EM2A 1Z9CA 3BJAA 1BR2A 2F5CA 2RQLA 1OR7A 4J8ZA 4I02A 1R5HA 3K4JA 4IX7A 2OPTA 4Q5SF 2W7NA 3GXOA 2WAEA 3HG9A 2FF4A 2M34A 2NOGA 4Z2YA 2ZM6E 2RS6A 3DPTA 3SDGA 3VEPA 2ID3A 2V7FA 4I7HA 2PQ8A 4AIKA 1UHSA 4OWRB 2L2NA 3S16J 3K0LA 5KVRA 4J01A 2ZC2A 3S8PA 2HGHA 4B3RE 4IS1C 2DK5A 2X6OA 4HNVA 2A69F 3ADJA 3G4SI 1S7OA 5J1YA 1T4NA 4DR2E 1GV2A 4OAYA 1BA5A 3VYTB 3GTKJ 5J47A 2YTFA 2BEOA 1A1KA 4Y15A 2HU9A 3KZIC 1X6HA 2ACJA 4YELA 3TGNA 5HLHA 3DF6A 1MD0A 3AAFA 5F6FA 1MH4A 2IJLA 5JHUA 4JI2E 2IPQX 1OCCH 1Q1VA 1OQYA 3TO9A 4H0EA 2KFDA 1AAYA 4E4HA 4E7JA 1IMUA 4IQ4A 5B1AH 4MHGA 3OYHA 2YPRA 2PRTA 2R5YA 4UUSB 4MQ9F 4G7HF 2JOBA 4Z6YA 4BDYA 1A1FA 1ODDA 2M0CA 2CFXA 3K4BA 2K02A 1ETOA 2ELYA 2EFWA 4DR5E 1RKWA 1F43A 2IGOA 1CGPA 4I76A 2K40A 3T8RA 3HC7A 4ZTFA 4DW6A 1TP4A 4HZFA 3JRCA 4FTHA 4R2SA 3JRHA 2R5YB 3KIOA 5KAFC 5FLVA 1YYWA 2PJPA 1BBGA 4RGUA 1F2IG 5ERIA 3QODA 4DNCA 4KFCA 4QIWN 5JVGF 1TF3A 5ICFA 1QRYA 1UZCA 2PJRA 4L5IA
chains in the Genus database with same CATH topology
1G4DA 2O03A 5L3GA 1FP2A 5HS7A 3ZQ7A 3E97A 3V4GA 4L9TA 3VOEA 3NQOA 3JTHA 2DO7A 3V8LA 3QAHA 4P96A 3WGHA 4LGWA 3GZ5A 1ZHFA 3IRQA 4BHCA 3L7WA 3KP4A 1AWCA 3KEQA 1ZARA 1D8JA 2BE5F 2FU4A 3ROUA 3K1MA 1HXDA 1SD4A 4IHSA 2K4BA 3J81Z 1LDJA 2W25A 1TW2A 1F9NA 4ON0A 2JSCA 2HTSA 3BJ6A 2RC4A 4P5OA 3ZP5A 1J9IA 2EFPA 4LG0B 2W57A 1ZN2A 2E1CA 2MC3A 3F23A 4A0ZA 3D0SA 2VOOA 2JTVA 3ZN1A 4IHTA 2VBZA 2BBYA 2GQQA 2WWYA 3M8EA 4LK0F 4KUMA 1P4AA 1SMTA 1P2FA 2O6GE 1T6SA 5E1ZB 3ZMTA 1HKQA 1GVJA 1W5SA 1PUEE 4M6YA 2H6BA 3I53A 2K4JA 2FMLA 4Y13A 3U2RA 3LA3A 3HOSA 2NS0A 1IAWA 3RJPA 5L3BA 1FT9A 4FT8A 4N9HA 1V4RA 3V8JA 1LQ1A 1ZRFA 4Q47A 1KU3A 3B02A 1LEBA 5E18F 1P4XA 2D1HA 4RB3C 3DQVC 3RYRA 1MJBA 4GYGA 2W24A 1YG2A 1QQIA 3HHHA 4HLYA 2XRNA 2XVCA 1MDMB 3I54A 5K5RA 2A61A 4A5NA 3E6DA 3HTUA 5HDGA 1W4MA 4CO8A 3GFJA 2P5LC 5L3CA 2V1XA 2IT0A 5DV5A 2HDCA 4M9XA 3QPTA 3FX3A 4TV7A 3E5UA 3FWEA 4ZYDA 1S29A 5K5OA 4U7BA 2XUBA 3WTYC 4GYIA 4WX9A 1ZGAA 2BV6A 2L3DA 1FZPB 2CGPA 1H9TA 2STWA 4ENMA 3JTGA 2D2WA 5CLSA 2E1NA 3KEOA 2L02A 1FBSA 4KN4X 4EVIA 3H92A 4ZYHA 1RUNA 1SFEA 2UXNA 1U3EM 3D5LA 3KETA 2PN6A 2FA5A 4I01A 5D8KB 1DPRA 1ZLKA 4OOIA 3J80K 3KLNA 5D6FA 1IXSB 5E1XA 4OIRF 5E8IA 5JFRA 3BP8A 2K7LA 3REOA 2FRHA 1B4AA 3R61A 3TOAA 2KKOA 3WTXC 4P9UA 1ZG1A 3GX4X 4OMYA 2DBBA 2VBXA 1KA8A 3ZMSA 5LEKA 1LVAA 1LJ9A 1FX7A 3KP7A 2P6TA 4EM1A 1DP7P 4BAYA 4ESBA 1L3LA 4KICA 4P55A 5JI6A 2QWWA 1IN7A 3IHUA 4GXOA 4CICA 1YFHA 3KZYA 2GXGA 3CJNA 1XB4A 3TO7A 2ZJ2A 5DD4A 5EEGA 1HW5A 3DKWA 2A6HF 4EM2A 5DD8A 3FXUA 5K1YA 4L9JA 2NNNA 2EJRA 2CG4A 2FBKA 2EFNA 4AVPA 3GFMA 2Q8KA 2E7WA 1USSA 3ECHA 1B6AA 2OZUA 4UV9A 2R7FA 3OV8A 1U6GA 4OINF 3ML6A 2OBPA 5LGNA 2ZMEB 3J81K 1I6XA 5D8LB 4MTDA 5ILVA 3LA2A 1R1TA 1V3FA 1O57A 1J59A 1SD6A 4YIFA 3FXQA 3QU3A 1BI0A 2ZNZA 3CO7C 4G7ZF 1Y0UA 3EUHA 3WTZA 3SQNA 1RUOA 4A5MA 1HSJA 1O7LA 2HEOA 2RGVA 4AWXB 4FHTA 3O2PE 1GXQA 1Z6TA 2OA4A 3IKVA 1JE8A 3E5XA 3FMQA 1SD5A 1F5TA 2NRAC 1TBXA 3MQ0A 4UUVA 2O8XA 1KYWA 1JHFA 1HW1A 4L9NA 2ISZA 1ZRCA 3ZPLA 2EA2A 4RS8A 3JSOA 4XSXF 4YFKF 1YIOA 3SHFA 3IWFA 2DU9A 3C1DA 2FEZA 4WXHA 1YQAA 3I59A 2J5OA 6PAXA 5HDKA 2DI3A 1XGNA 3K2ZA 1DUXC 5ILSA 5D5XB 3HRTA 3W6JB 2STTA 2JZYA 3F8CA 2P7VB 4MEXF 4ESFA 1PP8F 5F1RA 1WKMA 1U5TC 1TTYA 4M74A 2LF8A 4ZZDA 3BY6A 4IPAA 3QRFF 1DDNA 2M87A 1O3RA 4XRFA 1S6LA 3P7NA 1KYZA 2ZO4A 3CTAA 5E1WA 1QNTA 3RTRA 4U0YA 4RB1A 2ESNA 3JAMK 2HZTA 5ILUA 1BC7C 2ESHA 1IN8A 1ZREA 4A2UA 4HX4A 3F8NA 1D5VA 3PFIA 1Z6RA 2G9WA 4YIIA 1ZYRF 3K69A 4B8XA 2F2EA 3F6VA 3WG9A 3SZTA 5IT9Z 1MGTA 5BQTA 2DFIA 2WV0A 4D0PA 5L3EA 1P6RA 1R58A 5K5QA 2GWRA 3S2WA 5CYVA 4MQVA 1ULYA 1XCBA 2ZBKA 4UVCA 1FYLA 1P4WA 2BGCA 3K1PA 3WU1B 4RGSA 4ZZLA 4JQFA 4HQMA 4ESJA 1OMIA 2UZKA 2OU2A 4U88A 5D4RA 1TNTA 3OOPA 1XSXA 4CZZA 4LB5A 3HUGA 4NHJA 4UVAA 5E20A 2K27A 2OQGA 2QQ9A 2FSWA 4EJWA 2P6SA 1PP7U 1KU2A 1ON2A 2KIUA 2LDUA 4ENKA 2MLGA 2LSOA 2EV0A 3R0AA 3V8KA 4U7DA 3TQNA 4G7OF 3SXYA 5CJ9A 4M71A 3HHGA 1MKMA 1W5TA 2MLKA 3EDPA 4N0BA 4HBLA 3KCCA 4OIPF 1K6OA 2DAOA 2OD5A 1R5GA 3GW2A 4RGXA 1CF7B 1QZYA 5FLXZ 4EGZA 1T0FA 1YYVA 5L3FA 5LLQA 1FYKA 4HF1A 1USTA 1RZ4A 1LEAA 2TDXA 2DK8A 1IN5A 2IRFG 4GCVA 1B9NA 3F72A 4UV8A 2M8EA 2A07F 1HBXG 4A12A 4PGGA 3LFKA 5TRDA 3F8MA 3Q5FA 1S3JA 4ZYGA 4NQWA 2XGXA 1O3TA 4BHBA 3L00A 2HGCA 4ZYEA 5FFZA 4K2EA 4BNCA 3KP6A 2GXBA 3M8FA 2HYFA 4JBAA 5E17F 2NAZA 2K86A 4O3MA 1QGPA 2IA2A 3I0TA 4G8XA 3E6BA 2BYVE 3ABTA 1VTNC 5LRSA 4HV5A 1FWZA 5A2QK 3F8FA 2YR2A 5DCMA 5LRRA 4YFNF 3KZZA 4I0BA 5BS6A 3RYPA 3ECOA 3BPXA 4IRHA 4L18B 4HAMA 1RIOH 4RAYA 3LA7A 3EQLF 2HYGD 2QENA 3M7GA 1ZAOA 4BXUA 4EM0B 4FX0A 3CLOA 1C0WA 3HRMA 4PGHA 1OPCA 2HS5A 4LLLA 2L4MA 1K78A 2VBYA 2EWNA 2QYOA 3DF8A 2CWEA 4IXAA 2A68F 2W85A 2MH2A 3L9FA 3F3XA 3CUQA 3CDHA 4A6EA 1ON1A 4WXCA 2JT1A 3CUOA 3RKXA 2JRTA 4L9VA 3F21A 2DPUA 4KA4A 5CVIA 4I2OA 2ISYA 5DEQA 2XKPA 1WI9A 2M5WA 4KIFA 1S7AA 4AD9A 3RKWA 4HX8A 3FXRA 4ENNA 3JAMZ 4EV0A 1UB9A 1KQ8A 4EJVA 4WCGA 1R1VA 2PI0A 3IWZA 4L5JA 3MWMA 5ICCA 5ED4A 2W84A 4M9ZA 3G73A 4GO1A 2Z3YA 2FXAA 1U5TB 5J8CA 1XMAA 4RGRA 2QBYB 4Q4ZF 1R23A 3KP3A 1ZGJA 2UWMA 2VC0A 4HLXA 5H6QA 3I5UA 5CVUA 2V1UA 3I59B 1YLFA 3L09A 3HSRA 3E5QA 3FM5A 4LB6B 1O7FA 4BH9A 2HQRA 4KNYA 3SZPA 4KDPA 3P9IA 3ELKA 3Q9SA 5CVJA 1O3QA 4MEYF 4NB5A 2XHKA 3EETA 3QP6A 1T38A 1BC8C 5D6EA 4CDGA 4PCQA 4ZH4F 3RDIA 3ZMDA 4WF2A 3IKTA 5DDGA 4I0AA 1HSTA 1LNWA 2JPBA 1UHMA 3V7RA 2IA1A 1IN6A 1TQPA 2F5DA 3N4MA 1Z7UA 4RB0A 5FO5A 1R22A 2P8TA 2VC1A 1OYWA 2VE8A 1IZ1A 4RAZA 1KQ0A 3QU6A 4KN7X 3BDDA 4KIGA 2V6CA 4ENJA 4IRGA 3I4PA 3K9TA 5J6XA 4E70A 2Q2EA 3O6BB 3R4KA 1J5YA 2A6EF 3ISPA 4OMZA 1CF7A 4KMUX 4ETSA 3F8BA 2Y48A 4HV6A 2WC2A 3HOTA 1U8RA 3HYIA 1WQ2A 2HKXA 1FBQA 2M30A 2LF7A 4LMYA 2O0YA 4CXFA 1BM9A 2ZFWA 4IF4A 1HKSA 3RIRA 3WGIA 1I1GA 1WWXA 4HA8A 1J2XA 2FQ3A 3HSFA 4N9IA 3QOPA 5FB2A 3JSPA 2RQPA 4CYDA 4R8HA 1R36A 4GGGA 5D5WB 3WTSC 2L54A 1WSUA 4CGZA 1IW7F 1I5ZA 2KIFA 2KJBA 1XSDA 2Z9OA 3VFZA 5A2QZ 2PMHA 4UXNA 2XIGA 4A6DA 4HW0A 2COMA 4HYEA 1JXSA 1YS6A 4XLPF 1Q1HA 4L0YB 1T2KA 2AS5F 3GFLA 4G6QA 2HTJA 1UHWA 1XDSA 5LHIA 3BOQA 2MBFA 5LGUA 5IT3A 2L01A 2P7CB 3ZN0A 4PDKA 3C18A 2ZXJA 2YU3A 2RN7A 3G3ZA 4B09A 2FBIA 2YX7A 1BN5A 1W7PB 4ASNA 1XN7A 4IJAA 2GIVA 3GF2A 2IA0A 1EV7A 2XASA 4KYWA 3WU0A 3B73A 2NYXA 1HW2A 2E7XA 3M9AA 3DP7A 2OZ6A 1ZLJA 1HKTA 2LKPA 4KIBA 2XAGA 2GA1A 1XGOA 1XD7A 1EH6A 1P92A 3N97A 2H6CA 3KP5A 2QZ8A 5IT9K 4EMSA 3DV8A 2Q0OA 1FPQA 3E6CC 3WODF 1SFUA 3I64A 2MH9A 3C3WA 1ZG5A 5LEJA 3WTVC 4OIOF 2WTEA 1J75A 3HIFA 3GLXA 2ADUA 3ERED 2PLYA 1XGMA 1U78A 5JR3A 4U0VA 2QVOA 5LBQA 3LAPA 3GYHX 4EJTA 5CVRA 5DYMA 2RKHA 3P9KA 2PG4A 5BMZA 3U1DA 1FP1D 4HX7A 3Q9VA 1ZRDA 3K1NA 5LHGA 3GZ6A 1EH7A 2C6YA 1XGSA 2PMUA 1XCVA 3ZMVA 1YW9A 2KJCA 4MGRA 1R7JA 2ZMEA 2VBWA 3R0JA 4IVNA 3U9GA 3LSTA 1BI2A 1FYMA 4HOBA 3SFZA 1FY7A 3DFGA 3I71A 2EK5A 3GEZA 1H0MA 2XAFA 2O3FA 5HS9A 3ULQB 2PFBA 3PQKA 5J8FA 4UHTA 3DXJF 4BHPA 4S05A 2V79A 4I98B 4HDUA 2DQRA 3KLOA 2CYYA 3GVAA 1H9GA 1IRFA 4O6JA 1I27A 2EB7A 2IVMA 3R60A 4M72A 2XKOA 4QLCU 4LD5A 5HDNA 5FLXK 3COAC 1QBJA 2EV6A 2ETHA 2CQKA 1BIAA 1BI3A 2A5YB 3LAJA 1YS7A 3HRSA 2Y0MA 1BOAA 1X3UA 3LWFA 5D5VB 5AONA 2VT2A 3WE3A 4MTEA 5E8GA 4XBFA 3RPQA 3BZ6A 5FD6A 3PQJA 5BPDA 2KIMA 2VN2A 3FMSA 3E6MA 3NRVA 2X0LA 3GWZA 1S8NA 1ONVA 1U5TA 3GUDA 4WWCA 1Z1DA 2ELHA 2RDPA 1F4KA 2F5EA 3FZVA 2Z99A 4PZJA 2ZCWA 4XSZF 1BIBA 3MZHA 5HLGA 1B59A 1E2XA 2GAUA 3VODA 2MD5A 2A3SA 5ICEA 2CW0F 1YW7A 2ZKZA 4YG2F 2RNJA 2LNBA 3WE2A 4UNOA 1T39A 2YSRA 3TDUC 1T98A 5LHHA 3J7AO 3E3VA 2H94A 2VOPA 4U0WA 3CUQB 1FC3A 1SD7A 3W6KB 5D5UB 1K7AA 5H20A 1RI7A 2FOKA 5TJJA 2Z5UA 4WK8F 2FNAA 2P5VA 2QLZA 3IRRA 5FFXA 4UVBA 3F6OA 3BROA 3FF5A 2V9VA 4LJZF 3MAJA 2KRFA 2EV5A 4Q48A 1TQIA 2NNYA 3R6SA 2M45A 3M1EA 1IUYA 1K78B 4LLNA 1PDNC 2EFQA 3TKYA 3T5XA 1MDMA 3EYIA 4IRIA 3BWGA 2RV8A 1TNSA 2FNPA 2CSOA 2IW5A 3RKYA 2H09A 3WGGA 1HQCA 4HF0A 4OU0A 1IRGA 1QPMA 4A0XA 3MFKA 2G7UA 1UCRA 1NHAA 2YX4A 4G6DA 3KP2A 2QBYA 4I09A 3FHZA 2FE3A 3MZYA 3ABUA 4RB2C 3HRUA 1F1ZA 2DTRA 3F22A 1JGSA 4MNUA 5AIPA 5JVTA 3EYYA 1G3WA 2O61A 2J5PA 4F7ZA 2JPCA 1QZZA 1G3SA 3VB2A 1DPUA 2GZWA 4L0ZB 3BPVA 4QWQA 2FBHA 2XV4S 1UFMA 1SAXA 3IL2A 1G3TA 1I1SA 2FMYA 5FGMA 4EGYA 1XMKA 4EQQA 1OYYA 2H27A 4P9FA 4KT5C 2HKOA 4AIJA 4HQEA 1BBYA 4M9SA 2D45A 5F64A 1QO0D 1BJAA 1B1BA 1AOYA 1REPC 3IC7A 1FSEA 2DPDA 1XSVA 5BOXA 1MZBA 1LB2A 2OQRA 4LFUA 3FM3A 1GHCA 3NEUA 1KU9A 3P9CA 1XDUA 2XROA 2QQAA 2VODA 3CUQC 1R1UA 4S04A 4M6XA 2Y75A 4KMFA 4R79A 3T0YA 4R1HA 5L3DA 1E17A 2AXLA 1TW3A 2IP2A 3TDZC 4AIHA 3WTTC 1JHHA 5DCFA 4EJOA 1FBUA 1J7KA 1W7PD 4Y17A 1FOKA 3H3ZA 1TLHB 2VT3A 5D4SA 1SFXA 5BPIA 2XAHA 3T1BA 1IF1A 3HSEA 5EEHA 2G7HA 5DUIA 1LDKB 3LQQA 2MA3A 3DPLC 4LG0A 1A04A 3H3UA 5DUKA 2QM3A 1SMYF 2VXZA 4LK1F 4HF2A 3I58A 1STZA 3BJOA 1WRJA 1KU7A 1O3SA 4FX4A 3FMRA 4OIQF 2M1BA 3GFIA 3MEXA 5HOOA 2EFOA 3CO6C 2VE9A 3V7SA 5HVQC 4WXDA 3RPUA 2ZNYA 2V1DA 5LGTA 1J0RA 2OAZA 1D8KA 1IN4A 1TQMA 1G6NA 1ZH5A 3JW4A 1MJAA 1IXRC 2XAQA 3L2CA 2UXXA 3MCZA 4HDVA 1R00A 5H6RA 5HLIA 2GA2A 3RI4A 1Z05A 3O3KA 2X4HA 3V7CA 3TOBA 1FSHA 2B0LA 4LLGF 2F5FA 4O5VA 2HWVA 3C7JA 1YTYA 3ZMUA 2PBIA 3ZMZA 2QQBA 1B9MA 3LQRA 3WTWC 5KK1A 3WTUC 2HFHA 2P5KA 2Z33A 4BQAA 1RNLA 3QPHA 4G94A 4G9YA 1BI1A 2HQNA 4A0YA 5ICGA 2DLLA 3DEUA 3KFWX 5AIQA 1IXCA 4DQ2A 1D3YA 3T8TA 3HTSB 1Z91A 1KGSA 2PEXA 2HOEA 2VONA 4XLNF 1OKRA 2R7DA 1K79A 2CO5A 1MJ9A 1ZG3A 3TO6A 1W7PA 1FNNA 1OYIA 2HR3A 2DT5A 2EA4A 1G3YA 2P4WA 4JK1X 1FLIA 2XAJA 2RVCA 5HS8A 2DW4A 1EH8A 3KE2A 1YO5C 3GO5A 2DQLA 4CHUA 5DCMB 1KQ9A 1YW8A 5FD5A 1LDDA 4YFXF 5CVVA 1L0OC 4EJUA 4BYYA 2D1VA 2R3SA 4M73A 2QUFA 3QP5A 1U2WA 2L4AA 3J80Z 1GXPA 1Z9CA 3BJAA 2F5CA 1OR7A 4I02A 1R5HA 4Q5SF 3GXOA 2FF4A