4ZYDA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
LVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPAHRVIAENGIGGYSRGVKLKRALLELEGVKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 38
structure length 149
sequence length 149
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zydA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zydA01
4L9VA 1U2WA 3K69A 1FX7A 3MEXA 4KIBA 4U0WA 4KN4X 1USSA 1ZLJA 3FMQA 1YFHA 3TDZC 5L3DA 4L9JA 3ABTA 2H09A 5DEQA 3GYHX 3QU6A 4Y15A 4EM1A 5FLXK 3I58A 1W5SA 1XMKA 3TOBA 3WTWC 1ZG5A 2FA5A 2XAQA 1FNNA 3RIRA 5E17F 4LLLA 4I01A 4I98B 1B9MA 4HAMA 1LQ1A 1I5ZA 3R4KA 3F22A 4Y13A 1O3SA 4I02A 3LAJA 2HFHA 4HBLA 2QZ8A 4BHCA 4GYGA 3HHHA 2LF7A 1D8KA 2J5PA 3RDIA 1J75A 1YW9A 2W24A 3COAC 2JRTA 3TO6A 1G3YA 3CUOA 2GA1A 2HTSA 3WGIA 2G7UA 2FE3A 3V8KA 1S8NA 4G8XA 1RZ4A 2VBXA 4Q47A 3P7NA 4HDUA 4PGGA 3SXYA 4ZYGA 3FXQA 2V1XA 2QBYA 1FT9A 3CUQB 1OR7A 3J81Z 2UZKA 3I54A 2P8TA 2ZMEA 1IW7F 5KK1A 3EETA 1FC3A 1R58A 5D4RA 2CSOA 2H94A 4UV9A 1BC8C 2W25A 1R5GA 1HW1A 4ENKA 2ETHA 2JPCA 1SD5A 3L09A 1TLHB 2BBYA 1KQ0A 2MA3A 3ZQ7A 1RUNA 4WWCA 1T39A 3RKXA 1CF7B 2XAFA 5EEGA 2DPDA 1PP7U 2IW5A 2AXLA 2XGXA 2WTEA 3KEQA 3NEUA 2HQRA 1LEBA 1HSJA 4LGWA 4UVCA 5K5RA 1W4MA 3SZTA 2CW0F 2JZYA 1SAXA 5FD6A 4WK8F 1K78A 3ZMVA 3QOPA 2FU4A 1HW2A 1IXRC 1BJAA 1XSDA 4B09A 2HWVA 5F1RA 2DLLA 1P6RA 3E6CC 1YQAA 3GO5A 4Q4ZF 1RNLA 3FF5A 1ZGAA 3F72A 2QUFA 5BPDA 1HSTA 1DPRA 2DW4A 3E5XA 4A6DA 1SD4A 3LQQA 1KYWA 3FZVA 2XROA 2A3SA 5HS8A 2K86A 2VOPA 1R22A 3WE2A 2V79A 2YR2A 1FBSA 1TNTA 4LB6B 4PGHA 2ACJA 3HHGA 4KN7X 5BQTA 2QLZA 1YTYA 5LGUA 3SFZA 1ZRDA 3FXUA 3WTVC 1HKTA 1GHCA 3BZ6A 2K02A 5D4SA 3EQLF 2L4AA 5HLGA 5LHIA 4WX9A 4AIKA 4RGXA 3R0AA 2GWRA 4ENMA 4QLCU 4LJZF 1IF1A 4RAZA 2FNAA 2Y75A 2KKOA 5A2QK 2VE8A 5HDNA 4ZYHA 3K1MA 2A69F 3P9CA 2V6CA 3I53A 2IP2A 2TDXA 5AIQA 1K7AA 2GAUA 2KJBA 1ZGJA 2QQBA 2FBIA 1DUXC 5LEJA 4U0VA 2BV6A 4OIQF 4KICA 3HTUA 5BPIA 2E7WA 2V1DA 2XUBA 3DP7A 3GZ6A 4HYEA 3CO7C 1MGTA 3R61A 2A68F 4R8HA 2K7LA 2PEXA 4UVBA 2D1HA 2Q8KA 2PI0A 3ROUA 4MEYF 4OIRF 1FBQA 3J80K 2HGCA 3GFMA 3QPTA 1SMTA 4Y17A 3I59B 2RNJA 2CYYA 1T98A 5FLXZ 3JSPA 1KU9A 2XASA 5ICGA 2EJRA 1IN4A 3P9IA 2IT0A 3ZP5A 4N0BA 2Z33A 2VE9A 4EJWA 4LK1F 4GO1A 3HIFA 1FOKA 3PQJA 3FHZA 3CO6C 5K1YA 1R1TA 1Z91A 4XLNF 1EV7A 1HXDA 2M87A 5CVVA 3F3XA 3KZYA 1C0WA 4EQQA 2P7VB 2QM3A 4YIIA 2DPUA 4KIGA 4LG0B 2M8EA 4U0YA 2DQRA 4OU0A 1AWCA 3VOEA 2QQAA 2FSWA 2GXGA 2KRFA 2R3SA 4S05A 1FPQA 2VT2A 5CJ9A 2ZJ2A 3BPVA 4FX4A 2JPBA 4EV0A 3I71A 4KA4A 5TJJA 3E6DA 2HEOA 3ZMDA 1S29A 4ZZDA 3CDHA 3ELKA 3IRRA 1KGSA 3MFKA 2XKPA 3DV8A 2FNPA 5DCMB 2LSOA 3DKWA 1Z9CA 1IAWA 2Z5UA 4L0ZB 3NRVA 2BGCA 1F5TA 2LF8A 4I2OA 3K9TA 3G73A 4KDPA 3F23A 4LFUA 3IC7A 4NB5A 2RDPA 3V7SA 1SMYF 2E7XA 4G7HF 2PFBA 2JT1A 2ZKZA 1H9GA 1MDMA 1PDNC 4BQAA 2HKXA 4M9ZA 4EJTA 2UXNA 1BI3A 3MWMA 4P5OA 3VEPA 2FRHA 4AIHA 5LBQA 1V3FA 4H0EA 3ABUA 3B73A 3LAPA 4KUMA 1TW2A 1IRGA 1ONVA 1BIBA 2OA4A 1P4AA 2IA2A 1P2FA 3SZPA 5DCFA 4R79A 1R36A 4HV5A 4RB2C 3CLOA 1BC7C 3O6BB 3WTYC 4BHBA 2M1BA 2P5VA 3WGHA 1YW7A 5E1WA 2STWA 1W7PB 3ULQB 1RUOA 2W84A 1OMIA 2HR3A 4G6DA 1YYVA 2KIFA 1WI9A 2X4HA 1AOYA 1TQIA 4CDGA 1ZG1A 4ZYEA 5E1XA 3I5UA 5DDGA 2GQQA 2EFQA 1EH7A 3JW4A 3K2ZA 1I1GA 2YX7A 2ZNYA 3T8RA 4MEXF 1DDNA 2ZCWA 2H6BA 3LA3A 1B6AA 1QNTA 1J9IA 4A12A 2HTJA 5A2QZ 5CVJA 3M7GA 4CHUA 1HBXG 1U5TA 2FF4A 2A61A 2PLYA 2DI3A 3AAFA 2L02A 3RTRA 2HOEA 3CTAA 4IVNA 2O6GE 2DTRA 1IXSB 3F8NA 4OIPF 1P4XA 2XVCA 3ZMZA 3QPHA 1IRFA 1KA8A 3HOSA 1I27A 2MLGA 4GGGA 4WXCA 2BYVE 1R5HA 2Y0MA 3HRMA 3M8EA 5H20A 4M6YA 1O57A 2VT3A 4IJAA 1LDDA 1KU3A 1R00A 3J80Z 4JQFA 1WKMA 4M9SA 2RQPA 2VXZA 4DNCA 1Z6RA 3KP7A 1GVJA 3N97A 3HYIA 4CGZA 2DK8A 4EM2A 4G7ZF 4HX7A 2LNBA 2ZFWA 2MLKA 4I7HA 2XAGA 4EJVA 3QAHA 2O61A 3HRSA 3ML6A 5LLQA 2RC4A 2NYXA 1TBXA 2Z99A 1SD6A 3HRTA 1R1VA 2Y48A 3BROA 2FEZA 3C18A 2MBFA 1OYWA 4FT8A 4IRGA 2G7HA 3DQVC 4CO8A 3KEOA 4NQWA 2UWMA 1R23A 3RYPA 4IRIA 5D5XB 4KYWA 4DQ2A 2PJPA 4O5VA 3V7RA 5LHHA 4IHSA 2XHKA 3F8BA 1O3RA 3DPTA 4RB1A 1ZH5A 1I1SA 3LA2A 3WTUC 3P9KA 3D5LA 1JHHA 5D6EA 4EVIA 3GF2A 1REPC 2CQKA 2F2EA 1P92A 3JTHA 1MJAA 1EH8A 1FWZA 3SHFA 4LLNA 3FMSA 4G94A 4CXFA 2HS5A 3IWFA 5CYVA 2LKPA 3WTSC 2E1NA 2GA2A 4HX4A 1O7LA 3GX4X 1F1ZA 2LDUA 4PZJA 3IHUA 4I0BA 5DYMA 1K6OA 1U78A 5E8GA 3GFLA 1Z7UA 4UUVA 5D5WB 3KP4A 2O0YA 4A0ZA 5K5OA 4L5IA 4CZZA 2XIGA 4UV8A 3ZMSA 4KFCA 3DF8A 1ON2A 2JTVA 4IF4A 2HDCA 1K79A 3REOA 2WWYA 3PQKA 2EK5A 1W5TA 5E20A 1BBYA 2COMA 2OQGA 2O3FA 2IA1A 1EH6A 3BJOA 2L3DA 3E3VA 3Q9VA 5H6RA 4Z2YA 3H3ZA 4MQVA 1WQ2A 3HSFA 3L7WA 4ZZLA 2VC1A 3LWFA 3SQNA 4ENJA 5ILUA 1E17A 3VODA 4M9XA 3BY6A 1MKMA 4A5NA 1QGPA 3HRUA 3KFWX 3B02A 1O3TA 1MJBA 2M45A 5J8CA 2FBKA 5ED4A 1FSHA 5LRSA 4KMFA 2K27A 4HX8A 1J0RA 2EFNA 4O3MA 3WTXC 4EMSA 3T0YA 2Q2EA 5ICEA 5HLIA 1YO5C 4N9IA 4PCQA 2XAHA 2GIVA 2IPQX 2RV8A 2OZUA 2A6EF 5HDGA 4MQ9F 3GVAA 2O8XA 3DEUA 3L9FA 4A0XA 1CGPA 2P4WA 2OAZA 3F6OA 2DO7A 1ZHFA 2P5LC 2K4JA 2WV0A 1XB4A 5D8KB 3ECOA 3JAMK 5L3BA 4GXOA 2QBYB 1H9TA 1J2XA 4ESJA 1FLIA 3M8FA 5ILVA 3IKVA 2QWWA 2ZMEB 2QENA 4MTEA 4BNCA 4JBAA 3GEZA 5D8LB 4ASNA 4AWXB 2RKHA 1G3WA 1UB9A 5DUKA 3E6MA 2YU3A 2MH9A 2EFOA 1PUEE 1TTYA 2FMYA 5E8IA 1YIOA 5DUIA 2PN6A 5FB2A 3T1BA 1SD7A 4HDVA 2XV4S 2L01A 5BMZA 1G4DA 1XCBA 3V8LA 2A07F 4L5JA 1R7JA 1ZARA 4LK0F 3WU1B 5E18F 2C6YA 1YG2A 4K2EA 2RGVA 3JTGA 3ZN0A 3R6SA 1LB2A 4WXHA 1QQIA 4ETSA 5D6FA 1ZN2A 2D1VA 5DD4A 5ERIA 3HOTA 5FFZA 4OMZA 1K78B 3LQRA 2EV5A 1Q1HA 4M71A 3BOQA 2A5YB 3LA7A 4M74A 4EJOA 4O6JA 4GYIA 3L2CA 3CUQA 3E97A 4B8XA 2OQRA 1U8RA 4MHGA 3D0SA 1IZ1A 2O03A 3G3ZA 2X0LA 2GXBA 1KQ9A 1XSXA 1Y0UA 1QO0D 3CJNA 5FD5A 3C3WA 1GXPA 3WTTC 3JSOA 1OYYA 2IRFG 4L9NA 3K1PA 3BWGA 4HW0A 2F5EA 1QZZA 4BHPA 3MZYA 1SFXA 2DK5A 1BOAA 4M73A 2YX4A 3GFIA 1FP2A 1V4RA 3F8FA 3V8JA 5CVIA 2VC0A 2EWNA 1KU7A 1TNSA 3HUGA 3VFZA 2PMHA 4KIFA 1XDUA 4PDKA 4U88A 3FM3A 2NAZA 1IUYA 1QZYA 1UCRA 1SFEA 5L3EA 4RB3C 4Q48A 5IT9K 5HOOA 3RKWA 4BXUA 4LD5A 5LGNA 4AVPA 1G3TA 4AIJA 4FHTA 2W57A 3RJPA 5LEKA 1LEAA 3HTSB 1B4AA 2PQ8A 1X3UA 5D5VB 4MNUA 3V7CA 1U3EM 4MGRA 2PG4A 2NRAC 4XRFA 1FYKA 5JR3A 5DV5A 1LVAA 3K1NA 4XLPF 4YFXF 1FZPB 3L00A 5CVUA 5ICCA 3IL2A 4RGSA 3EYIA 4A5MA 4RAYA 1XGMA 2WC2A 3TO7A 6PAXA 3MZHA 2J5OA 3KCCA 2CFXA 1FP1D 1ZG3A 1HKSA 2MD5A 4WCGA 3RYRA 4P96A 4XSZF 4R1HA 2ISZA 5JI6A 3IRQA 1QBJA 3LFKA 3E5QA 3WU0A 2E1CA 4U7DA 4FX0A 1T2KA 3V4GA 1I6XA 1FYMA 1IN7A 3LSTA 3WG9A 3E6BA 4XSXF 5F6FA 3ZMTA 1QPMA 3KLOA 3KZZA 3Q9SA 1IXCA 2P6SA 3H3UA 3BJ6A 5D5UB 4P9FA 3KP2A 3F8MA 1KQ8A 2QYOA 2P7CB 2HQNA 4HV6A 1MD0A 3ISPA 3OOPA 4YFKF 2A6HF 4BAYA 2CWEA 2OU2A 1DP7P 1U5TC 2YSRA 5LHGA 3WODF 2EV6A 1OYIA 2YPRA 2VBYA 3FWEA 1S7AA 3RPQA 1ZYRF 5L3CA 1Z05A 2XAJA 2GZWA 3EYYA 3JAMZ 4KNYA 2STTA 3T8TA 4MTDA 1BI1A 1E2XA 2DBBA 3I59A 4OMYA 5HDKA 1MZBA 1H0MA 4G7OF 5HLHA 4HZFA 2EFPA 3ZPLA 4OINF 2ZXJA 1A04A 3DPLC 5CLSA 3FM5A 2P5KA 1LJ9A 2MC3A 2OZ6A 5CVRA 3WGGA 1XGNA 2P6TA 2G9WA 2V9VA 2R7FA 4UVAA 4RGRA 5FFXA 3BP8A 1FSEA 3QU3A 1G3SA 4TV7A 4LLGF 3FXRA 1MDMB 3K0LA 3I64A 2EV0A 4LG0A 3GW2A 4G6QA 2ZO4A 4I09A 4IXAA 3E5UA 1W7PD 3J7AO 1WSUA 3WE3A 4HLXA 5HS9A 4LB5A 1XSVA 3DXJF 2M5WA 2XRNA 1B9NA 3I4PA 3BJAA 1UHMA 3MAJA 4A2UA 3QRFF 2OBPA 1U6GA 5J8FA 4L9TA 5JFRA 3F6VA 2FOKA 1DPUA 4I0AA 1IN5A 2EA4A 3RI4A 2QQ9A 3H92A 1UHWA 1HKQA 1XGSA 2OD5A 4WF2A 5DCMA 1ZREA 4HQMA 4AD9A 2NS0A 4N9HA 2NNNA 2IA0A 3EDPA 1XDSA 2ZNZA 4M72A 2EA2A 3RKYA 3IKTA 4ESFA 3U1DA 1G6NA 4IHTA 4BYYA 1D8JA 5J6XA 2BEOA 3F21A 2PMUA 1XCVA 5TRDA 2F5FA 1MJ9A 3BDDA 1YS6A 2L4MA 1HW5A 3NQOA 3TKYA 3WTZA 3VB2A 1WWXA 4JK1X 2VN2A 3QP6A 1BN5A 3O2PE 1SFUA 5IT9Z 1NHAA 4A0YA 1D3YA 1R1UA 4KT5C 3ERED 3GFJA 1XGOA 3GUDA 3KP3A 4CYDA 4NHJA 1WRJA 3OV8A 1U5TB 3PFIA 3F8CA 1TQMA 2D2WA 2ISYA 4HA8A 1TW3A 1T0FA 2K4BA 4YG2F 1JXSA 3C7JA 1YW8A 5HVQC 3N4MA 1S3JA 4Q5SF 4HF0A 4ENNA 2VBZA 1BI0A 2QVOA 2KIMA 2PBIA 1LDKB 1YLFA 5LRRA 1W7PA 1B1BA 1XN7A 2VBWA 1KYZA 2EFWA 4HF1A 2M30A 5F64A 1UFMA 3FMRA 1JE8A 4RB0A 1JHFA 1P4WA 3KETA 1Z1DA 5JHUA 2F5DA 2VONA 3M1EA 2F5CA 4ZYDA 4HF2A 2JSCA 2KJCA 1ZAOA 4RS8A 3DFGA 3R60A 3TGNA 1USTA 4F7ZA 1VTNC 4L0YB 1T6SA 3BPXA 4OOIA 3KP6A 1XD7A 5BOXA 2CGPA 1J5YA 3J81K 3GLXA 4IPAA 3KP5A 2CG4A 2EB7A 4HQEA 1FYLA 2Z9OA 3W6JB 2H6CA 3GZ5A 1L3LA 4ESBA 4EGYA 2BE5F 3C1DA 3ZMUA 3QP5A 4EJUA 1IN8A 1O3QA 1F4KA 1LDJA 4UHTA 2IJLA 5K5QA 1YS7A 1F9NA 3FX3A 3MQ0A 4A6EA 5KVRA 5ICFA 3I0TA 2VOOA 3ECHA 4OIOF 4ON0A 2HKOA 5FO5A 3ZN1A 4U7BA 1B59A 2ESHA 1STZA 2AS5F 3GXOA 3KLNA 1OKRA 2MH2A 1J7KA 5JVTA 2NNYA 2DFIA 5L3FA 1PP8F 1ULYA 4ZH4F 2RVCA 2Q0OA 1OPCA 5H6QA 4RGUA 5DD8A 3TDUC 2HYGD 2ESNA 3U9GA 2Z3YA 3HSRA 4S04A 1IN6A 1HQCA 3KE2A 4BH9A 4YIFA 1FBUA 2R7DA 5E1ZB 4P9UA 1ON1A 4GCVA 2DQLA 4E70A 1S7OA 3M9AA 5BS6A 3EUHA 2KIUA 4WXDA 1S6LA 2IVMA 3U2RA 3CUQC 2HYFA 1LNWA 4L18B 1XMAA 2ZBKA 1CF7A 3TQNA 2H27A 4P55A 2RN7A 1RI7A 1FY7A 4UXNA 3W6KB 2L54A 1KU2A 5ILSA 4HOBA 2FMLA 5FGMA 3TO9A 4EGZA 3S2WA 5L3GA 5HS7A 1ZRCA 1BIAA 3TOAA 3GWZA 1T38A 3O3KA 5EEHA 2FQ3A 2XKOA 4G9YA 2V1UA 2B0LA 1BM9A 2UXXA 4LMYA 3Q5FA 2DAOA 3R0JA 5AIPA 1O7FA 3T5XA 2HZTA 5LGTA 2ADUA 1ZLKA 3IWZA 2W85A 4KMUX 2VODA 1GXQA 4IRHA 4EM0B 5AONA 2FXAA 5IT3A 1D5VA 4YFNF 4QWQA 3RPUA 1ZRFA 1Z6TA 1L0OC 1ODDA 4D0PA 2ELHA 4M6XA 4CICA 2DT5A 4HLYA 2CO5A 2D45A 2FBHA 1JGSA 1RIOH 1J59A 3HSEA 1BI2A 4UNOA 4XBFA 1TQPA 2DU9A 3MCZA
chains in the Genus database with same CATH superfamily
4L9VA 3W6VA 5CFFE 1U2WA 3K69A 4LU9A 2E19A 1TWGJ 4E7ZA 5J1YA 1FX7A 1JT0A 1DU0A 2LY1A 3MEXA 4KIBA 4PJJA 1XMXA 1X4PA 2RPCA 1HNZE 3HOYJ 3PNTA 4X62E 3HBLA 4U0WA 4KN4X 1USSA 1ZLJA 3FMQA 1YFHA 3TDZC 3P1XA 4IHWA 3S2DJ 5L3DA 4BQNA 4IO9F 2EM9A 4MLQA 2VQEE 2DMTA 2QQ8A 4L9JA 4HRIA 3HB9A 3ABTA 2QF7A 4IOAF 2H09A 1XX5A 4ZJZA 2R7OA 5DEQA 2JQ7A 3ZQQA 4N4RB 3GYHX 1IMUA 2L92A 3ABKH 3HTXA 3QU6A 4RAFA 2DDAA 4Y15A 4EM1A 3M3YJ 2NUGA 4N4OB 4L8NA 3JRIA 4A3GJ 5FLXK 3SDBA 1A1IA 3I58A 1W5SA 1XMKA 3TOBA 1IGNA 1MSEC 2JVGA 2ZC2A 3WTWC 3L2WA 1SAUA 1ZG5A 1B72B 2FA5A 4RMNA 4HSTA 2IGMA 2XAQA 1MMSA 1HDDC 1FNNA 2UUBE 2DGCA 4A3LJ 3JRDA 2JSPA 3RIRA 4DJAA 2EPAA 1LPQA 3OIPA 5DS9A 5E17F 2M4IA 1SANA 2ME6A 2AXTC 4LLLA 1ETWA 1XS9A 4PJ0C 1RR7A 3QYEA 4I01A 3A0BC 5DTDA 2X9DA 4I98B 1B9MA 4HAMA 2LTSA 1LQ1A 1I5ZA 2PJRB 2WY8Q 2E2JJ 3R4KA 3LSJA 1NK2P 2KLOA 4QPQA 3JRFA 1V55H 1VQLI 3B6AA 3F22A 4Y13A 2EM8A 1O3SA 2PX9A 3OY9A 4E7IA 4B43A 1EA3A 3ASNH 4I02A 2KQRA 4CCJA 3LAJA 4A69C 1G2HA 2HFHA 1WJDA 4HBLA 2QZ8A 5B1BH 4BHCA 2LVSA 2NVQJ 1QU6A 4GYGA 3HHHA 1IV6A 4RM3A 2LF7A 1VNDA 1D8KA 2J5PA 3RDIA 4M2ZA 1EF4A 2EQ1A 5EZGA 3MKYB 1VQPI 1J75A 1YW9A 3D1NI 2W24A 3CF2A 3COAC 3K2AA 2JRTA 3TO6A 1G3YA 2IXSA 1WXRA 3BF2A 1P7IA 3CUOA 2GA1A 1FOXA 2HTSA 3W2VA 3WGIA 2FX0A 2FE3A 2G7UA 3DKYA 1S8NA 3V8KA 1GTKA 4NHRA 4G8XA 3PIOF 4BACA 3FXOA 1RZ4A 1YZ9A 2VBXA 3LSHA 4Q47A 2CMPA 3P7NA 2OCCH 4HDUA 4DYCA 4PGGA 1OCZH 3SXYA 4ZYGA 3FXQA 2V1XA 3GTOJ 3HOXJ 2QBYA 2K4VA 1FT9A 5EF6A 2CV1A 5FLMJ 3SFIA 4XR6A 2EMHA 3CUQB 1MMNA 3LL7A 1WHNA 4IHVA 1OR7A 4FE4A 1E3OC 1ACIA 3J81Z 2UZKA 2A6TA 2EQRA 3I54A 4JV5E 2P8TA 2MGQA 2XPUA 2ZMEA 4HNTA 1IW7F 5KK1A 3ZRGA 4F52A 5F0CA 1AKHB 2CPNA 2EL5A 1LLMC 2UUAE 3EETA 1FC3A 1R58A 2H36X 5D4RA 5CQEA 4BDYA 2EL4A 2V9PA 2CSOA 3T1HE 4XOPA 2H94A 4UV9A 1BC8C 3K6GA 2W25A 2CQNA 1R5GA 1HW1A 2VJIA 4ENKA 2ETHA 2JPCA 1SD5A 2F4MB 3L09A 1TLHB 2BBYA 3JAMC 4F54A 5IYBJ 4GKKE 1N3GA 4LF8E 1KQ0A 2MA3A 3WHBA 3ZQ7A 5KAFC 3VYRB 1RUNA 1J5EE 1SEUA 1O4XA 2NXNB 4WWCA 2ZJQF 1GDTA 2B3TB 1T39A 1HNXE 2E2IJ 4I76A 3PO2J 3HUGB 3RKXA 4J01A 4R2DA 1CF7B 2XAFA 5EEGA 2ZMEC 3OTOE 2DPDA 1PP7U 4LTYA 1BR4A 2AXLA 2IW5A 2DA7A 2LP0A 2TRTA 2YU8A 2WB1N 4F6MA 3C4TA 2GPIA 2QCOA 2WBTA 2XGXA 2YUSA 2WTEA 1ETVA 3KEQA 3H9JA 3NEUA 1OCCH 3D5SC 2XSJC 1Y1WJ 2HQRA 1LEBA 1LFBA 1HSJA 2LUQA 4LGWA 4UVCA 5K5RA 3JTZA 1IUFA 1I50J 1W4MA 2BY1A 2VJ4A 3SZTA 2CW0F 2JZYA 1SAXA 1HDPA 2YTDA 1MBGA 3RZOJ 3O8GA 2LKSA 3OSFA 5FD6A 3ADJA 3LSKA 3KX2A 1Y8RB 4WK8F 1K78A 5LL6R 3K70D 3ZQGA 3OYBA 4E7KA 2EPZA 3ZMVA 1MH3A 1X4OA 3QOPA 4BKXA 2RAEA 4ZTJA 2YTIA 2FU4A 1HW2A 3ZOBA 2R1FA 2VE7C 1IXRC 4UY8I 1BJAA 5DM6F 2NA2A 2EMZA 1XSDA 2E5ZA 2KISA 4B09A 4FE7A 5H2FC 2HWVA 1TWAJ 2LK2A 4G12A 1I3AA 5F1RA 2DLLA 1P6RA 3E6CC 1E0EA 2KRCA 1YQAA 2RREA 3DPUA 2LUPB 3GO5A 3CCMI 3LSGA 4Q4ZF 3GTLJ 1RNLA 5JLXA 4BS9A 4R2RA 3L2RA 3FF5A 3HG9A 1ZGAA 2DLKA 4MFDA 3F72A 1X1DA 1XG1A 2EN2A 1GUUA 2EM6A 2QUFA 1SFKA 1Y56A 4BBYA 5BPDA 1HSTA 1DPRA 2NVUB 2DW4A 3E5XA 4LIUA 4A6DA 3J7AG 3M07A 1SD4A 1MW7A 2R0QC 2DODA 1U9OA 2BW3B 2Y2ZA 1SFOJ 1IQOA 3LQQA 4CA0A 2VPRA 1KYWA 3FZVA 2DDBA 2XROA 2A3SA 1VQOI 5HS8A 1EJ9A 4LFBE 2KMUA 2VASA 4C3IJ 2LE2A 1YX5A 2K86A 2L2OA 2VOPA 1Y8QB 1WI3A 1R22A 2F8BA 2LD5A 1QA6A 3WE2A 2V79A 2YR2A 1FBSA 4XM3A 1HC8A 2RS7A 1I6HJ 3HXLA 1FOYA 1TNTA 2CH0A 4LB6B 4DR6E 4PGHA 3BC8A 2KHMA 2ACJA 3HPSA 1R4MB 3HHGA 1DQUA 4E7JA 3MSWA 2EN7A 3S1QJ 4KN7X 5BQTA 2QLZA 1IBME 1YTYA 5LGUA 2AQFA 3SFZA 2KZGA 1ZRDA 1DGCA 3FXUA 3WTVC 1HKTA 2BXZA 1Z1BA 2R93J 1GHCA 3BZ6A 2K02A 5IV8B 5D4SA 3RSNA 3BQYA 1R4NB 1BR2A 3EQLF 2YTPA 3O8HA 5JVGF 2L4AA 1ZKGA 5HLGA 4DBRA 5LHIA 2BOLA 2Q8UA 3CZ6A 3MKWB 5EG0A 1A1GA 4WX9A 4AIKA 1Y6IA 4RGXA 1V5FA 4MLVA 3R0AA 4DV6E 2GWRA 4D5FA 4ENMA 3CC7I 4QLCU 4LJZF 1IF1A 1GZ6A 3IV5A 4RAZA 4R8OA 2FNAA 2Y75A 2KKOA 3KEYA 1NG7A 2LBFB 5A2QK 2VE8A 2JUCA 5HDNA 4TUIA 3LMMA 4JX5A 2JP9A 4ZYHA 3K1MA 1POGA 2A69F 1ERDA 3P9CA 2WBUA 2V6CA 5F27A 3I53A 1WZ2A 2IP2A 1X1PA 4BQOA 2FD5A 2TDXA 4XNFA 5AIQA 3CDLA 1WHQA 1JKRC 3TP3A 5IOYA 3HPZA 1X1CA 1DGWY 1VF9A 4D7MA 5B1AH 4HPQA 1K7AA 2GAUA 4DV3E 1A35A 3JRGA 3FXLA 3KPHA 2NS8A 2KJBA 1ZGJA 2QQBA 5JHFA 5IT9C 3S1MJ 4LFCE 2FBIA 1DUXC 2Y9ZA 5KL3A 5LEJA 4X9JA 3CP8A 1NH3A 2DA3A 5LFAA 4U0VA 2BV6A 3I56I 4OIQF 2OJED 4KICA 3LSRA 3HTUA 5EGOA 5M3MJ 2K9SA 5BPIA 2E7WA 2V1DA 2BY2A 2XUBA 3DP7A 3GZ6A 2VKVA 2XB5A 4HYEA 2K3FA 3THOB 1IG7A 4DKKA 3CO7C 4M6VA 4F9BB 1MGTA 3R61A 2A68F 5A6AA 4R8HA 1RPWA 3FHNA 2K7LA 1X58A 2PEXA 3VYTB 2LH9A 2D1HA 4UVBA 2Q8KA 4LITA 2PI0A 2KP6A 3DJWA 3ROUA 3RKQA 1B69A 1U0JA 4MEYF 4OIRF 1FBQA 3J80K 2EMAA 4E7SA 1X19A 2HGCA 1A1FA 3GFMA 2LMZA 2W48A 3QPTA 1SMTA 4Y17A 3EPJA 1T33A 3I59B 2YU9J 2RNJA 2EPOA 2CYYA 1T98A 5FLXZ 4YELA 4L5NC 1HF0A 3JSPA 3CJRB 2VJJA 2CQXA 1KU9A 4HNUA 3F6GA 1KJKA 1YJ9I 2XASA 5ICGA 3JR9A 2EJRA 1LE8B 4M30A 1IN4A 3P9IA 5TSEA 2IT0A 3ZP5A 4N0BA 2E34A 2JK3A 2Z33A 5TGTA 2VE9A 4LK1F 4EJWA 4GO1A 3HIFA 1FOKA 3PQJA 3EPLA 2BBGA 3FHZA 4LF9E 2LLKA 4BJTA 3CCLI 3CO6C 2CU7A 5K1YA 1R1TA 1Z91A 4XLNF 3S32A 1EV7A 4F6NA 3OYNA 1HXDA 2X6OA 2M87A 1RC9A 5CVVA 1BW5A 4XOTA 2ODRD 1QHGA 4DR7E 2NVXJ 1XTAA 5KAIC 3F3XA 1MBKA 2GOXB 5EDNA 3N05A 2R5ZA 1VQ7I 4F2JC 4GKJE 2Y0SA 3KZYA 3AL0C 1AH5A 2L9SA 1C0WA 1OCTC 2VLAA 4R2EA 3KIOA 4EQQA 2P7VB 5M3FJ 2QM3A 5HODA 4YIIA 2DPUA 4KIGA 4LG0B 2M8EA 4U0YA 2DQRA 4OU0A 2L2NA 2EOOA 3P5JA 1AWCA 3VOEA 1JGGA 3BBGA 2QQAA 2M9HA 3AKZA 1YRNA 2HHHE 2FSWA 2ZXHA 2GXGA 1B8IA 2MABA 1PDAA 2KRFA 2R3SA 4S05A 5FJ8J 1FPQA 2VT2A 5CJ9A 2ZJ2A 3J7ZI 3BPVA 4FX4A 2CFOA 3OYAA 1YUJA 1JTXA 1WVRA 2EM3A 2JPBA 4EV0A 3I71A 4M3FA 1H88C 1FMVA 3Q0UA 4KA4A 5TJJA 4IQJA 3E6DA 3K4BA 2HEOA 3ZMDA 2H8WA 4RM2A 1A5JA 1GLNA 4CYCB 1S29A 2K85A 1X3WB 4PK4A 4ZZDA 4C30A 1X6EA 3CDHA 4H4KC 3ELKA 2LVHA 3IRRA 2K9LA 1MNMC 1KGSA 3MFKA 3PIPF 1LKXA 2XKPA 4JI4E 3DV8A 3HOUJ 2DA5A 5E3NA 3ZQHA 1IRZA 2FNPA 1PVEA 3PM1A 3QPSA 5DNYA 5DCMB 1GVDA 5KCMA 2JUGA 2JYAA 1IDYA 2LSOA 2WZOA 2ADRA 3VHTB 3DKWA 1XPXA 3MKLA 3OR1C 1Z9CA 3K4LA 4XLFA 2Z5UA 1IAWA 4L0ZB 3NRVA 2BGCA 1F5TA 4NZVA 2LF8A 2D9HA 4I2OA 1FIPA 2ICWG 2WAQA 3K9TA 3G73A 1A36A 2XC7A 1R71A 1F43A 1VQ8I 2E36A 2XDVA 4KDPA 3F23A 2VKDA 4RH8A 4LFUA 4RA2A 3IC7A 1OCOH 4NB5A 2RDPA 2X1EA 3ASOH 3V7SA 2ZJRF 5GTIC 1SMYF 5E3OA 2LY2A 3GLLA 3LLHA 2JA7J 2E7XA 4G7HF 2PFBA 2HNHA 3CCJI 2JT1A 2ZKZA 2KIQA 2ZXWH 3EUHC 1H9GA 1MDMA 4NC6A 3F6HA 4QSHA 2FQ4A 1PDNC 4BQAA 1D0XA 2HKXA 4M9ZA 1PYVA 4EJTA 1BJZA 4YIRX 2I8DA 2UXNA 1BI3A 1ZR2A 3MWMA 4P5OA 2K5CA 4A3FJ 1HOMA 3VEPA 2FRHA 3LMLA 3BG5A 4LF5E 4GDFA 4AIHA 3ZOQB 3CQZJ 5LBQA 4B3SE 4FISA 3DKXA 2RSMA 1TWCJ 1V3FA 3TL4X 4H0EA 2ECCA 4X8WA 3ABUA 3B73A 3LAPA 2R76A 4KUMA 1TW2A 3SZGA 5KL2A 1IRGA 1ONVA 4BE0A 1BIBA 4P1WA 1Z21A 4AUXA 3ZQIA 4A3BJ 4XKCA 2OA4A 4ZYAA 2UXCE 4BXFA 1P4AA 3GTJJ 2DB2A 3VSKA 2EOEA 2LCEA 2IA2A 3JCUC 1P2FA 3SZPA 2L2KB 4BQQA 1RESA 5DCFA 5IWAE 2BB8A 2DMPA 2VKEA 4J19A 1ZAAC 4R79A 1N78A 1R36A 2EMYA 4HV5A 3OMYA 4RB2C 1GV5A 1W36C 3CLOA 5KL7A 4FK5C 1WJEA 3MKZA 2B9SA 3F0CA 5B5EC 2IS4A 2EMCA 2EZKA 3H9QA 2YTNA 1BC7C 3O6BB 4J8ZA 3WTYC 4BHBA 2M1BA 2P5VA 3WGHA 3JRBA 1YW7A 5E1WA 1YYOA 2STWA 1W7PB 2QSHX 3ULQB 1RUOA 2CT1A 2W84A 3BG6A 2EPNA 2LRDA 1MH4A 4C2TA 3L2VA 3S3OA 3S15J 1YITI 1J09A 3BTIA 1ZU1A 1K4TA 1OMIA 2GIZA 3J7YJ 1MBEA 2HR3A 4ZDPA 2V87A 4G6DA 3DTKA 1D0YA 5IOZA 1KYQA 3HKZA 4II2A 1N32E 3CCVI 1YYVA 2KIFA 1WI9A 2JRMA 2F4IA 2X4HA 1TQIA 4CDGA 1D1AA 5FKOA 1ZG1A 2JA8J 1U8BA 1AOYA 2E72A 4ZYEA 5E1XA 4BGDA 3I5UA 1UG2A 3QYFA 5DDGA 2YTFA 2EPPA 3PO3J 2GQQA 2EFQA 1EH7A 3OL4A 2XB0X 3VYUB 3JW4A 4QTRA 4UUTA 3OYGA 2LYCA 2Z1DA 1X5WA 3K2ZA 1ETYA 1I1GA 3CCUI 5FROA 5HNFA 2YX7A 2JA2A 2R7UA 2ZNYA 3T8RA 4MEXF 1DDNA 2ZCWA 2H6BA 2EMFA 3LA3A 1NK3P 3MHSC 4HTGA 4LF6E 3QPLA 1B6AA 1SVMA 2KHXA 1QNTA 3MMYB 3A01A 1J9IA 1A1KA 2LC2A 2V9KA 5B66C 5KNLA 4A12A 3AL0B 4KHPE 1TC3C 2EMWA 2X6WA 2HTJA 3VK6A 4PUSA 4O5GA 1OLTA 1ZBTA 1R9TJ 2F48A 5A2QZ 5CVJA 3ZQCA 1X49A 3M7GA 3K6QA 4CHUA 2CTDA 4NXME 3GTGJ 1HBXG 1U5TA 2FF4A 2V7FA 3G2BA 2A61A 1D5YA 2DIXA 2PLYA 4FQGA 2DI3A 3M8JA 1XMQE 3AAFA 2ENCA 1RKWA 4DV4E 2L02A 3RTRA 2EM7A 4A3DJ 2HOEA 3CTAA 2DSYA 4IVNA 2DMYA 4X65E 1ZBQA 5K7HA 2O6GE 1IXSB 2DTRA 3F8NA 4DZPA 4OIPF 3JREA 4DW6A 1P4XA 3GCMA 3HOVJ 1WH5A 4DZJA 2EM0A 4KJZA 4JP0A 1X47A 2XVCA 3ZMZA 4Q28A 1OJLA 1S9HA 3QPHA 1IRFA 3Q0WA 2E1MB 3OYIA 1JI8A 1KA8A 3HOSA 4XLAA 2OPTA 1I27A 1Q1VA 2MLGA 4GGGA 3OSGA 3OYMA 1BBGA 2ELYA 2DT6A 3WU2C 4BU2A 4WXCA 2BYVE 4B3AA 1R5HA 2DOFA 2Y0MA 3HRMA 3M8EA 5H20A 1FTZA 2EM5A 5E79C 2AQEA 4NXNE 4M6YA 1O57A 1ETXA 2VT3A 4XKWA 1TWHJ 2YTGA 3MZ8A 4IJAA 1QU3A 2MYSA 2DYSH 3MVPA 4A3IJ 1LDDA 4RAGA 1KU3A 2IHR1 4RLQA 1R00A 3J80Z 3ADLA 4JQFA 1WKMA 2YPNA 3EPKA 4JI0E 2HC5A 4M9SA 3OS0A 2RQPA 1T4NA 2EOSA 2VXZA 4F91B 1R5ID 1TF3A 4DNCA 2EZHA 1Z6RA 3KP7A 1GVJA 2ID6A 3N97A 4DV2E 3HYIA 2HDWA 2KL4A 4CGZA 1JKQC 2DK8A 1VQ9I 4X0GA 4X1EA 4EM2A 4FCYA 4G7ZF 4HX7A 4CCOA 2LNBA 2ZFWA 5J4VA 5FKMA 1MBFA 1X2MA 2EILH 2MLKA 2JMWA 4I7HA 5F0FA 2YTOA 2MFZA 1X2NA 4ITVA 2XAGA 2QKLB 5F08A 4EJVA 3QAHA 2O61A 3WHCA 3HRSA 3ML6A 5LLQA 2BY0A 2RC4A 5GADJ 2NYXA 4XONA 1TBXA 2Z99A 1SD6A 2R5YB 4BE1A 3HRTA 1R1VA 2F5VA 1Y1VJ 2Y48A 3BROA 1HLVA 2Q1ZB 2FEZA 3KWRA 2Z16A 3BTLA 2OCEA 3C18A 1UBDC 1WJBA 2MBFA 1OYWA 4FT8A 2VQLA 4IRGA 1DU6A 2G7HA 3DQVC 3OIOA 3ERMA 3FK7A 5CPRB 1D1BA 4CO8A 3KEOA 3AG4H 3PFYA 4NQWA 3RQ4A 2DMNA 1R23A 3MN2A 3RYPA 1OR7C 5HLTA 4IRIA 5D5XB 2UWMA 2EP3A 2MKDA 4KYWA 4DQ2A 2PJPA 4O5VA 3V7RA 4D9JA 5LHHA 4I6ZA 2BZTA 3CDIA 4IHSA 2XHKA 3BR3A 3F8BA 1O3RA 2IS6A 1FKAE 2VJ5A 5F3WA 4LF4E 3DPTA 3S8PA 4RB1A 1ZH5A 5FRMA 1YIJI 2ELZA 5AE1A 2LJHA 3RCOA 4AU7A 3G6EI 3J81C 2WAFA 2OC6A 4BJ6C 3FIWA 3LA2A 1I1SA 3WTUC 2RS6A 4ZDOA 3P9KA 2PMZN 4XRSG 4XLEA 2N8GA 2Z2SB 1U9NA 3D5LA 1PUFB 1JHHA 1ENHA 4XORA 3A1YA 5D6EA 4Y3OA 4EVIA 4OX9E 2DN0A 3GF2A 4IS1C 1REPC 3LNQA 2YZTA 2CQKA 4ZDLA 2F2EA 1GT0C 1N77A 1P92A 3L2QA 3JTHA 2V89A 5FLVA 1MJAA 3CCYA 3C2HA 1EH8A 1ORKA 1FWZA 2PRTA 3SHFA 4LLNA 3FMSA 2K40A 2DA6A 4G94A 4P7DA 4K0KE 2N3HA 3ONQA 2X51A 2K3PA 1UHZA 4CXFA 2HS5A 4XN0A 2YRHA 3IWFA 2EPRA 5AASA 5CYVA 3OYKA 5A6BD 2LKPA 1VZ0A 3WTSC 2KT0A 3UR3C 3H1CA 2E1NA 1UELB 3FIGA 2GA2A 4HX4A 4CUGA 1O7LA 2EMIA 3C6KA 2W7NA 3GX4X 1F1ZA 2LDUA 4PZJA 2IS2A 3IHUA 4BCAA 4IKFA 2KRHA 2B7TA 2ZFUA 4I0BA 5DYMA 1K6OA 2ZM6E 3G1OA 1U78A 5E8GA 2L9VA 1X6HA 5A6JA 1FJGE 3GFLA 3M4OJ 1Z7UA 2BHYA 4UUVA 5D5WB 5IYCJ 2DFFA 4JYKA 3KP4A 1RC7A 4HEIA 2O0YA 4A0ZA 5GAHJ 5K5OA 2EMGA 3PL8A 1P47A 2LTRA 3DU6A 4L5IA 4CZZA 2XIGA 3S1NJ 4JYAE 4UV8A 3ZMSA 4KFCA 3DLLF 2LTPA 1OFCX 2DCEA 3DF8A 5IPAA 1S72I 1UG0A 2LG4A 4R03A 4QPOA 2K9MA 4I99C 1LVKA 4CCMA 4FTHA 5B3SH 4A3KJ 5LMUE 1JK2A 1YYWA 1MMAA 2XGCA 1ON2A 4KT6A 2JTVA 4XICA 4IF4A 4HNVA 2HDCA 1APLC 1K79A 3REOA 2WWYA 3PQKA 4GRIA 5M5YJ 2EK5A 2WBMA 2NOJB 4M0VA 1Z3XA 1W5TA 2QGUA 4JI3E 5E20A 1BBYA 2COMA 2YRKA 2OQGA 4BUPA 2O3FA 2ZSIB 2IA1A 4A93J 3BR0A 4UUSA 3HC7A 1EH6A 5E3LA 2N3GA 3BJOA 2L3DA 3E3VA 5E3MA 5BR8E 4R2SA 3Q9VA 2FUG2 5H6RA 4Z2YA 3H3ZA 3C4BA 1XMOE 4MQVA 3NARA 1JT6A 1WQ2A 3HSFA 3GMEA 3L7WA 3X2QH 4JX4A 1VQ6I 1R6RA 2VC1A 3LWFA 4ZZLA 2L2MA 1OQYA 3SQNA 4ENJA 2EN6A 5ILUA 3KYDB 1E17A 3M1CA 4D7NA 4YY3E 3VODA 2EPKX 4M9XA 3BY6A 1MKMA 4A5NA 1QGPA 2MDRA 3ADGA 4BMJA 1PJRA 2VQCA 1FIAA 3HRUA 4NUBA 3KFWX 3B02A 2LRSA 5T6JA 1O3TA 1MJBA 3H3VK 2CS3A 2IGNA 2M45A 2R7RA 5J8CA 2FBKA 5ED4A 3U1KA 1I39A 2EIKH 3ZR8X 1FTTA 2YTEA 3FXKA 3BQZA 2IEKA 3BLYA 1FSHA 5LRSA 4KMFA 2K27A 2K9NA 3ABMH 4KZSA 2R7SA 4HX8A 3DEEA 4R2AA 1J0RA 2EFNA 4O3MA 2EOMA 4XLCA 4DUYE 3WTXC 4EMSA 3DBHB 3T0YA 5KL5A 2YT4A 2Q2EA 2J7JA 5ICEA 3FBIB 5HLIA 4FETA 1YO5C 4N9IA 2EPFA 2YSOA 4PCQA 1WJPA 2CUZA 2MDGA 2XAHA 2GIVA 2IPQX 1UHSA 2RV8A 2OZUA 4MFEA 1TP4A 2A6EF 4B44A 5HDGA 4MQ9F 3OYLA 1Z7LA 4NC8A 1A6IA 5J4YA 2HDDA 4BEHA 2YU5A 3GVAA 1MMDA 2O8XA 4DR5E 3DEUA 3D5RC 2L7ZA 1ITYA 4E4HA 3L9FA 4A0XA 3BZCA 1CGPA 4OAZA 2CUEA 2EOZA 2P4WA 4A3JJ 2OAZA 3F6OA 3TBIA 2DO7A 1T8IA 1ZHFA 1PKPA 2A25A 5A6BA 2P5LC 2K4JA 1PJSA 2WV0A 3AG2H 1XB4A 5D8KB 1KZHA 3ECOA 3JAMK 4BE2A 2XRLA 3I55I 5FKNA 4GXOA 5L3BA 2QBYB 2EOJA 1H9TA 2ENHA 3ECRA 1J2XA 3K7AJ 1UZCA 2HVRA 1N34E 4ESJA 1FLIA 3M8FA 5ILVA 3LFUA 3IKVA 4CCNA 3THNA 2WV1A 2CRGA 4QIWN 3K70C 2W00A 2QWWA 2ZMEB 3FISA 4LG3A 2LO3A 4M3BA 2E60A 2YTQA 2QENA 4B3RE 4MTEA 4BNCA 4JBAA 3GEZA 5D8LB 1N25A 4ASNA 4PJMA 4II3A 3QG5C 4AWXB 2R7QA 2DYRH 2RKHA 4A3EJ 1G3WA 1UB9A 5DUKA 3CLQA 1B72A 4XKVA 2NUEA 3H0DA 3E6MA 3SJMA 2YU3A 1T08B 2DA2A 5JLWA 2MH9A 2EFOA 3A0HC 1TL8A 4AYBN 1PUEE 2JVHA 1TTYA 2ELJA 2F4VE 2CQQA 2FMYA 3CP2A 2ID3A 5E8IA 1YIOA 5DUIA 2PN6A 4YEJA 4KWYA 5FB2A 3I4MJ 3T1BA 1SD7A 4HDVA 2H1LA 2LT7A 3BGHA 2XV4S 2VI6A 3GTMJ 2EQ3A 3PSIA 2L01A 2PJRA 1WGXA 5BMZA 1G4DA 1SVLA 1XCBA 3V8LA 2D5VA 3HKZN 4JI8E 1JK1A 2A07F 4IL6C 3A2KA 5FLXC 4B3ME 4RLFA 4DOZA 2ZB9A 2VQFE 4L5JA 2HVQA 1R7JA 4XRMA 1ZARA 3L1PA 1NG6A 4ABZA 1JUSA 3EUAA 4LK0F 3WU1B 4V2FA 3DTIA 5E18F 1W5CC 2C6YA 3IP4B 2EM4A 4DR2E 1YG2A 4XL9A 4K2EA 1IBLE 2RGVA 3ZN0A 3JTGA 1N36E 3R6SA 1LB2A 4WXHA 1G8XA 1QQIA 4ETSA 1AHDP 5D6FA 2EMKA 1IO2A 1BR1A 2NUFA 1ZN2A 1E3PA 2D1VA 4C9YA 5DD4A 5ERIA 3HOTA 5FFZA 4OMZA 2DFEA 1K78B 3LQRA 5IP9J 3GTQJ 1MMGA 1QZEA 2EV5A 2QKMB 3SEZA 4AIDA 5GTHC 1AAYA 1Q1HA 2VQHA 2IGOA 4M71A 3I3LA 1N33E 3ADIA 2WY7Q 3BOQA 2A5YB 4XK4A 3LA7A 2XF5A 2BY3A 2IAIA 4M74A 4EJOA 1YSAC 5KL4A 4O6JA 2EN8A 3NWTA 2CUFA 4GYIA 1WJFA 4AVZA 2LFBA 3L2CA 3CCRI 2JPAA 1S7EA 5CKTA 1GQEA 3CUQA 2EJ4A 3E97A 1TZLA 3ZXSA 4B8XA 2OQRA 1U8RA 1FJLA 4MHGA 3D0SA 1IZ1A 2O03A 3G3ZA 2X0LA 2GXBA 1KQ9A 1XSXA 1Y0UA 2LBSB 2M0MA 1QO0D 3CJNA 5FD5A 3S3MA 3W2WA 3C3WA 3CC2I 1GXPA 3WTTC 3JSOA 1OYYA 1AKHA 2DRPA 4DYQA 2IRFG 4L9NA 3K1PA 2X1DA 3BWGA 3JRAA 4BDZA 4HW0A 2F5EA 4DR3E 1QZZA 2HYJA 2HI3A 4BHPA 3TQMA 2GHFA 3MZYA 2XGEA 1SFXA 2DK5A 1BOAA 4M73A 4NNJA 2EOXA 2VQGA 3FXMA 5IP7J 1QVUA 4XMYA 2E35A 2HVSA 4V19K 3GTKJ 2YX4A 3GFIA 1FP2A 1ZR4A 2O9LA 1LFUP 1V4RA 3F8FA 4XIDA 1VQ4I 3M99B 2MSYA 2B63J 3V8JA 2MD0A 3HGYA 5CVIA 1EKEA 3HPHA 4C2UA 2VC0A 2EWNA 1KU7A 1TNSA 3HUGA 3W2AA 2L9RA 3IH2A 1G2DC 1FOWA 4F9CB 1MNEA 3VFZA 4LFAE 2PMHA 3OS1A 4KIFA 2H8RA 1XDUA 2L5QA 4PDKA 4PSXA 4U88A 2L6MA 4ANJA 2GLIA 2A05A 1MIJA 2NAZA 3FM3A 3I9V2 1ZQ3P 2EPCA 3CMMA 2YS9A 4HEA2 5A69A 2I13A 2F4OB 1IUYA 2QSFX 2EQ0A 1QZYA 2AHQA 3S14J 2IGKA 2EZIA 1UCRA 3PJRA 1SFEA 5L3EA 4RB3C 4Q48A 5IT9K 5HOOA 2DJNA 2O5RA 5EG0B 1Y0NA 1UMQA 2CW7A 3RKWA 4B3TE 1D1CA 3OYCA 4BXUA 3IH4A 4LD5A 5EYRA 2UUCE 4CCLA 3NWSA 1BBOA 5M5XJ 5LGNA 4AVPA 1G3TA 4N4NB 4AIJA 4FHTA 2W57A 3RJPA 4E6KG 5LEKA 4BY7J 2W1OA 4D5CA 4BXXJ 1YOVB 1LEAA 1V5EA 4R2CA 2E1OA 3FDYA 3HTSB 4X64E 1HCRA 1W1WE 5C44J 4R2QA 2XF7A 1X48A 1B4AA 1RMDA 2PQ8A 3AG1H 4M3EA 4KITB 1X3UA 4S0HB 4MO7A 5D5VB 4MNUA 4WFTA 3V7CA 4OWRB 2P0WA 3CF5F 4IZZA 1U3EM 1JUMA 3ZQLA 4MGRA 1MSFC 1HR0E 2PG4A 4J00A 1RRJA 1IRXA 1X3ZB 4E7HA 5HNHA 3F9KA 1FMWA 3HEFA 2NRAC 4DV7E 4XRFA 5CQGA 4PJNA 4LOCA 4EATA 1FYKA 3CCQI 1WH7A 5JR3A 3RZDJ 1JJ6C 5DV5A 1LVAA 3K1NA 2ODRC 2BW3A 3RQIA 5EGOB 2UUZA 4YFXF 4XLPF 3L2UA 1FZPB 1PJTA 3L00A 2VXDA 3NAUA 3UNGC 3CCSI 1IV8A 2EPLX 3QQAA 2QEXI 5CVUA 3E1SA 4LF7E 5ICCA 1QRYA 4M3GA 3IL2A 3BG7A 4RGSA 1MBHA 3EYIA 2XF6A 4A5MA 1YX3A 4RAYA 2WCC3 2DA1A 1XGMA 2EOFA 2WC2A 3BZKA 4BC7A 2LMDA 3TO7A 4C3JJ 1RQ0A 2HJJA 4GFBA 3S1RJ 3HDDA 6PAXA 2R4GA 3MZHA 2J5OA 1EKZA 3KCCA 4WYQB 2EM2A 2CFXA 2DMUA 4JI2E 2XPWA 1IJWC 1FP1D 1ZG3A 1HKSA 2MD5A 4WCGA 3RYRA 2LOOA 4P96A 4R1HA 4XSZF 5JI6A 2ISZA 2EOQA 2YSPA 3IRQA 1QBJA 3VPRA 3LFKA 4M9VC 2DOAA 3E5QA 2KDOA 3WU0A 4DUZE 2EIMH 3OMLA 2E1CA 4U7DA 3A4CA 2BXYA 1ETQA 2O7OA 4FX0A 2VPLA 1T95A 1T2KA 3V4GA 1ETKA 1I6XA 1FYMA 1A1LA 1IN7A 1Z77A 3LSTA 3WG9A 2ECBA 2ME0A 2X85A 1BL0A 1ZR9A 3E6BA 1S5LC 4XSXF 5F6FA 3ZMTA 1ZTRA 1QPMA 3BR2A 3KLOA 3KZZA 5KHDA 2LBFA 1OCRH 3Q9SA 1IXCA 2L7FP 2P6SA 3H3UA 3BJ6A 1H89C 1MBJA 2L0KA 5D5UB 2VKHA 4P9FA 2V26A 2EBIA 3KP2A 4YRVA 3UK3C 3F8MA 2HU9A 3FKJA 2M3AA 3E7LA 4ZTFA 1KQ8A 1YYKA 4PFOA 2R5ZB 3CMAI 2EMBA 2QYOA 2GBYA 2P7CB 1STUA 3H0GJ 2CW8A 2HQNA 4HV6A 4GEQB 1MD0A 1T4OA 3ISPA 3OOPA 2R92J 2EPMX 1BA5A 2XPVA 4YFKF 2A6HF 4BAYA 3BT9A 1JKPC 2CWEA 2OU2A 4Y52J 1IDZA 1UN6B 2HOSA 4IX7A 1DP7P 1U5TC 4UB6C 1JJ8C 1YRNB 2YSRA 5GAEJ 4DYRA 1TT0A 5LHGA 1B8IB 2OF7A 3WODF 3SDGA 2EV6A 1OYIA 2YPRA 2VBYA 3FWEA 2EORA 1S7AA 2JA5J 2M7QA 3RPQA 5A2QC 1ZYRF 5L3CA 2FTXB 4Z6YA 1XNRE 5EEAA 1Z05A 1NEIA 2XAJA 2GZWA 2OUMA 4JI5E 3I4NJ 3EYYA 3JAMZ 4KNYA 1TN9A 4MLOA 4XN3A 2CV0A 2FJ1A 2W4SA 1YJWI 2STTA 4XRSA 2CV2A 1I94E 2JR1A 3T8TA 5ADZA 4AM3A 1WPKA 4MTDA 4IOCF 1BI1A 2ZXIA 2V6EA 3CMYA 1E2XA 2DBBA 3I59A 4OMYA 1YPNA 5HDKA 1MZBA 3IAS2 4UB8C 1H0MA 4G7OF 3DLAA 3IH3A 4F3QA 2DJIA 2VF1A 5HLHA 1TWFJ 2NVYJ 4HZFA 4MIMA 2EFPA 3ZPLA 3IUOA 4OINF 2ZXJA 2X1CA 1A04A 1D0ZA 1JUPA 2MG4A 3DPLC 3FM5A 5CLSA 3FBNB 1LE8A 2HQAA 2P5KA 1LJ9A 2MC3A 2EL6A 5K7FA 2OZ6A 2Y69H 2Y31A 5CVRA 3WGGA 2NABA 1XGNA 2P6TA 4D1QA 2EOHA 2G9WA 2KOUA 4F55A 3VYXA 1MEYC 3C2BA 2L7MP 4X6AJ 3ESWB 1UAAA 3FXJA 2V9VA 3A02A 3DBLB 2R7FA 4UVAA 5IP6A 2P81A 4RGRA 5FFXA 4RDUA 1X3CA 3DCFA 2X48A 2FGGA 3BP8A 3J80C 2M34A 1FSEA 1R49A 3HOZJ 1LFPA 3EQ1A 3QU3A 3MHHC 4WPYA 1HA8A 4WSPA 3K4MA 1JKOC 1G3SA 2QSGX 4DV5E 2R7XA 4TV7A 2DXIA 3S17J 1DGRM 4LLGF 2DLQA 1GV2A 3G1LA 3FXRA 5LD2C 1MDMB 1DP3A 3K0LA 3I64A 2YTJA 4C3HJ 3QODA 2EV0A 5GPAA 2WAEA 3ABLH 4LG0A 3CMEI 3GW2A 4G6QA 3GZNB 2EZ6A 2ZO4A 1SC7A 4I09A 2DA4A 3BR6A 3FK6A 4IXAA 2B7VA 3E5UA 1G2FC 3H35A 1W7PD 1RR8C 3J7AO 4I8OA 2K9QA 3LSMA 3WE3A 1WSUA 4WSGA 4HLXA 5HS9A 3BG9A 2MC5A 4LB5A 2RQLA 1XSVA 3DXJF 2M5WA 2BHZA 2XRNA 1B9NA 3I4PA 3OYDA 2JOBA 4F93B 3HZJA 2VL8A 4B1RA 1K6YA 2GXAA 3BJAA 2MC6A 2I10A 1UHMA 3MAJA 3KZIC 1OCPA 2QA4I 2LV2A 2E5LE 1ETOA 3Q0VA 4A2UA 3QRFF 2OBPA 1U6GA 4CYCA 2N8XA 2DMIA 5J8FA 1WJ5A 2JXPA 5IYDJ 4L9TA 5IXMB 2HGHA 5JFRA 3F6VA 2FOKA 1DPUA 4I0AA 2HQ5A 2KDZA 1IN5A 4IHXA 2HPMA 3BR1A 2EN4A 3KYLA 2EA4A 2WADA 3RI4A 2IBDA 2JA6J 2QQ9A 3H92A 3G1MA 2O8KA 4AQYE 1UHWA 1HKQA 3AFHA 2Y0SN 2HXIA 1XGSA 2OD5A 4WF2A 2EN3A 2RNGA 2V4JC 4IEJA 2A5WA 1O0WA 2LY9A 5DCMA 1Z0XA 2M4GA 2EPUA 1ZREA 4HQMA 3IAM2 4F9AB 4AD9A 1V5GA 1V54H 2NS0A 4N9HA 1LUJB 1QHHD 2NNNA 3JRCA 3IWDA 4E7LA 1A1HA 5EZHA 2IA0A 3EDPA 3H36A 1XDSA 2VB6A 2ZNZA 4XLHA 4JI6E 3BG3A 3OYJA 4M72A 5M5WJ 1A31A 2EA2A 3RKYA 3IKTA 4ESFA 3BIDA 3U1DA 3HJEA 1WJAA 2K7IA 4O24A 1G6NA 4IHTA 2L33A 4BYYA 1D8JA 5J6XA 2BEOA 3OYHA 3F21A 1WHUA 2DTZA 4PJLA 1VFCA 2PMUA 1XCVA 5TRDA 2GM4A 4Q35B 2ZJPF 2OV7A 4F92B 2F5FA 5EJCA 4OOGC 1MJ9A 5F0HA 3BDDA 3OL3A 1YS6A 2L4MA 1HW5A 3NQOA 3G71I 5AE3A 3SEQA 3TKYA 3WTZA 5J1UA 4GZNC 2NOGA 3VB2A 1WWXA 3BCAA 4JK1X 4NC7A 2VN2A 3QP6A 1H8AC 1BN5A 2RSIA 3O2PE 3TW7A 2M7AA 3TP0A 4M3DA 1SR9A 1SFUA 5IT9Z 1NHAA 3CESA 4A0YA 2NVTJ 3QYBA 3UKGA 2JWTA 4OAYA 1D3YA 3JRHA 1R1UA 4KT5C 3A01B 3ZCOA 3ERED 2V88A 4P78A 3GFJA 4DGWB 1F36A 1XGOA 4Y4RA 4CZCA 3GUDA 3KP3A 3QOEA 4G6TB 4CYDA 4NHJA 3Q3SA 1L4SA 2Y30A 5C4XJ 1WRJA 3ZGKA 2KONA 4PFPA 1I3QJ 3OV8A 1KONA 2L8TA 9ANTA 1U5TB 2OTLI 4O4KA 3PFIA 3F8CA 2AO9A 3CCEI 2WAQN 2F6CA 5K7ZA 2HOTA 1TQMA 3EPHA 2D2WA 2ISYA 3QWLA 3VSLA 2EWLA 1ZGWA 4HA8A 1TW3A 2FV4B 1T4LB 5F1JA 1T0FA 3C2GA 2V83A 2K4BA 4YG2F 1JXSA 3C7JA 1YW8A 5HVQC 5J47A 2JN6A 3H9GA 3N4MA 1S3JA 2XGDA 4Q5SF 2EINH 3TEDA 4HF0A 4ENNA 2V8QB 2VBZA 5AC4A 2RQQA 1BI0A 2QVOA 2KIMA 2PBIA 1LDKB 1YLFA 5LRRA 1W7PA 4BY1J 3VDXA 1B1BA 1XN7A 1K61A 3DTEA 4KISA 2R7VA 2VBWA 1KYZA 2EFWA 2JY9A 3EPZA 1J26A 1BB8A 4TUGA 3HPGA 2L3JA 1E3HA 4HF1A 2M30A 5F64A 1UFMA 2MC4A 3FMRA 1ZELA 2YRMA 1JE8A 2M8GX 1JHFA 1P4WA 4RB0A 2DFHA 3KETA 4DR4E 1Z1DA 1T0FC 4NBQA 5JHUA 2KFDA 2M2EA 2F5DA 2WB1A 1K4SA 2VONA 1Z67A 3M1EA 4ZC3A 4R2PA 3CD6I 1DQ3A 2F5CA 5J1RA 3VYSB 4ZYDA 4HF2A 2JSCA 4JI7E 2KJCA 1W0TA 4X66E 1ZAOA 5DM7F 2JJ7A 2NS7A 3A03A 1YI2I 1G59A 4RS8A 3DFGA 3R60A 3K10A 3LSPA 3TGNA 2PMZA 3H5RA 2MW8A 1USTA 4F7ZA 1VTNC 3S2HJ 4L0YB 1T6SA 3BPXA 4OOIA 3KP6A 4DBQA 3DWLE 2LKXA 3HOWJ 1XD7A 3S16J 3H5NA 3OR2C 5BOXA 5AC5A 2CGPA 2LREA 3OOUA 1VQMI 1J5YA 3IWBA 2I5UA 3J81K 3GLXA 3BTJA 1CQTA 3VYYA 4W1UA 4IPAA 2M4KA 2DT7B 4Y33A 4JX6A 3KP5A 4A3CJ 2M1SA 2CG4A 1QPIA 1P7JA 2EB7A 4BL0B 2HPIA 2TCTA 4B48A 4HQEA 1W36D 1FYLA 3GTPJ 1UILA 2Z9OA 2JOXA 4BBRJ 3LSIA 3W6JB 2B9DA 4NQWB 2H6CA 2W82A 3GZ5A 1T56A 5FRNA 2E5NA 1L3LA 5F04A 3DF6A 2E71A 4ESBA 4LIVA 3OS2A 1NTCA 3PUFA 3FKIJ 2BVLA 5AE2A 3HGGA 4EGYA 2BE5F 4CSWA 3TMOA 4W97A 3C1DA 3ZMUA 3K4KA 1QVTA 1WFXA 3QP5A 2X6XA 2DOEA 4EJUA 1IN8A 2CJJA 1O3QA 1F4KA 1FEXA 4V2GA 1LDJA 2HZDA 5J40A 4UHTA 4A3MJ 2IJLA 1ZK8A 2EN1A 2ENAA 1VQNI 5K5QA 5GAGJ 1BOBA 1YS7A 3ZQFA 3CJTB 1YJNI 1K83J 1F9NA 4BBSJ 3RPUD 2E1MA 1IQSA 2M9AA 3FX3A 2CQ7A 2JWOA 3MQ0A 4FASD 4A6EA 3AUZA 3H09A 5KVRA 5BNGA 4DMIA 3AV0A 3OWTA 5ICFA 1PJQA 3I0TA 2VOOA 2RTXA 5LMNE 3ECHA 4OIOF 4ON0A 2R7TA 2HKOA 5FO5A 3ZN1A 4U7BA 1B59A 3KYCB 2ESHA 1STZA 2AS5F 2BVMA 3GXOA 3KLNA 3PUBA 2V86A 4DV1E 1OKRA 3H5AA 2G0EA 2MH2A 4BJ5C 1J7KA 2EMXA 3TW6A 5JVTA 2XSDC 2CSHA 3DU5A 2NNYA 1Z3YA 2X6YA 2DFIA 5L3FA 1PP8F 2GLOA 4YHHE 3S3NA 3AG3H 4DIQA 2XAUA 1ULYA 1NCSA 4ZH4F 2RVCA 2Q0OA 3GBGA 3PNYA 1VI0A 2E1MC 4NDLA 2I9IA 1OPCA 5H6QA 4DV0E 4RGUA 5DD8A 4O43A 3TDUC 2JVAA 3JU0A 1IC8A 2HYGD 1OISA 3BCBA 3HM5A 2ESNA 2M7BA 3U9GA 5TISC 4JOMA 2ZSHB 2Z3YA 2R7ZJ 3HSRA 4S04A 1IN6A 1HQCA 1X6FA 3KE2A 4B47A 4BH9A 1FBUA 2R7DA 3DBRB 5E1ZB 4YIFA 1ON1A 4P9UA 4GCVA 2R5YA 2DQLA 4RHBB 2EOYA 2LJUA 4E70A 1S7OA 4CCKA 3M9AA 5BS6A 5C4JJ 3LOCA 3EUHA 2KIUA 4WXDA 1S6LA 5GP9A 2WBSA 1RKTA 5J3LA 4BC9A 3HQ1A 1IBKE 5IY5H 2IVMA 3MD2A 3S93A 2EOIA 3W3CA 3U2RA 1BW6A 3CUQC 2HYFA 1XNQE 1LNWA 3VWBA 3RMPA 5A6KA 4U87A 4L18B 2UXDE 1YE9A 1XMAA 2YWQA 4PSWA 4EEFG 1A6QA 1AA7A 2ZBKA 3TQNA 4B4CA 1CF7A 1VQKI 3HL2A 3BR5A 2H27A 4P55A 2RN7A 1VQ5I 1MNDA 1RI7A 2ELKA 1JTYA 1FY7A 3K4CA 2FOWA 4UXNA 1M1EB 2L54A 1KU2A 3K4JA 5ILSA 3W6KB 4IHYA 5C3EJ 4HOBA 1Y39A 2FMLA 4XKBA 5FGMA 3TO9A 2DMQA 4EGZA 2IS1A 3IWCA 4UUSB 2UXBE 3S2WA 5L3GA 2V85A 3J7Yp 5HS7A 1PUFA 1ZRCA 2EMLA 1BIAA 1X1AA 3GWZA 3TOAA 4CH7A 1T38A 1HNWE 3DEWA 3U21A 1WJCA 3O3KA 5FKKA 2M0CA 2UV1A 2L9NA 2GOMA 3C6MA 5EEHA 2UU9E 2FQ3A 2XKOA 4G9YA 5FKLA 2R7WA 1A1JA 2KZVA 2B0LA 1BM9A 2UXXA 3PSFA 2V1UA 4HG2A 2VRDA 2EH3A 4LMYA 1YHQI 2WA0A 3Q5FA 2DAOA 3V42A 1N75A 3CJQB 3R0JA 3SYTA 4XQFA 3OYFA 3E0JB 5AIPA 1O7FA 2EZLA 2VIXA 3T5XA 3G4SI 4B3XA 2MKNA 2L7KA 2HZTA 5LGTA 1AU7A 2ADUA 2V1NA 4RBOA 1YUIA 3B6CA 2OTJI 1P9QC 1ZLKA 1SVOA 2EPXA 3OYEA 3IWZA 3OIQA 1W0UA 2W85A 3K4NA 4KMUX 4L5EA 1GXQA 2VODA 1RETA 2CUJA 1UJ8A 2EE8A 4IRHA 2Q2EB 4EM0B 5AONA 1TT5B 2B7EA 2FXAA 5IT3A 2HOAA 3BTCA 3EUKL 4HSRA 1WCMJ 4YFNF 1D5VA 2KPMA 2HXOA 4Y7NJ 4QWQA 3RPUA 1DI2A 1ZRFA 1Z6TA 1L0OC 1ODDA 4D0PA 2LR8A 2ELHA 4M6XA 2DT5A 4CICA 3J7AY 2Y9YA 4IJDA 4HLYA 2EIJH 3WG7H 2CO5A 1XC5A 2D45A 3T1YE 2VUMJ 2COBA 3PNVA 2FBHA 4IQ4A 1JGSA 1RIOH 2L3CA 4AYBA 4DR1E 1J59A 3HSEA 2E2HJ 4JI1E 5GPCA 1BI2A 1X1BA 4UNOA 4AC0A 4BEHB 3CC4I 4XBFA 5KL6A 1TQPA 4C2MJ 2H1KA 1TF6A 2DU9A 1F2IG 3MCZA
chains in the Genus database with same CATH topology
4L9VA 1U2WA 3K69A 1FX7A 3MEXA 4KIBA 4U0WA 4KN4X 1USSA 1ZLJA 3FMQA 1YFHA 3TDZC 5L3DA 4L9JA 3ABTA 2H09A 5DEQA 3GYHX 3QU6A 4Y15A 4EM1A 5FLXK 3I58A 1W5SA 1XMKA 3TOBA 3WTWC 1ZG5A 2FA5A 2XAQA 1FNNA 3RIRA 5E17F 4LLLA 4I01A 4I98B 1B9MA 4HAMA 1LQ1A 1I5ZA 3R4KA 3F22A 4Y13A 1O3SA 4I02A 3LAJA 2HFHA 4HBLA 2QZ8A 4BHCA 4GYGA 3HHHA 2LF7A 1D8KA 2J5PA 3RDIA 1J75A 1YW9A 2W24A 3COAC 2JRTA 3TO6A 1G3YA 3CUOA 2GA1A 2HTSA 3WGIA 2G7UA 2FE3A 3V8KA 1S8NA 4G8XA 1RZ4A 2VBXA 4Q47A 3P7NA 4HDUA 4PGGA 3SXYA 4ZYGA 3FXQA 2V1XA 2QBYA 1FT9A 3CUQB 1OR7A 3J81Z 2UZKA 3I54A 2P8TA 2ZMEA 1IW7F 5KK1A 3EETA 1FC3A 1R58A 5D4RA 2CSOA 2H94A 4UV9A 1BC8C 2W25A 1R5GA 1HW1A 4ENKA 2ETHA 2JPCA 1SD5A 3L09A 1TLHB 2BBYA 1KQ0A 2MA3A 3ZQ7A 1RUNA 4WWCA 1T39A 3RKXA 1CF7B 2XAFA 5EEGA 2DPDA 1PP7U 2IW5A 2AXLA 2XGXA 2WTEA 3KEQA 3NEUA 2HQRA 1LEBA 1HSJA 4LGWA 4UVCA 5K5RA 1W4MA 3SZTA 2CW0F 2JZYA 1SAXA 5FD6A 4WK8F 1K78A 3ZMVA 3QOPA 2FU4A 1HW2A 1IXRC 1BJAA 1XSDA 4B09A 2HWVA 5F1RA 2DLLA 1P6RA 3E6CC 1YQAA 3GO5A 4Q4ZF 1RNLA 3FF5A 1ZGAA 3F72A 2QUFA 5BPDA 1HSTA 1DPRA 2DW4A 3E5XA 4A6DA 1SD4A 3LQQA 1KYWA 3FZVA 2XROA 2A3SA 5HS8A 2K86A 2VOPA 1R22A 3WE2A 2V79A 2YR2A 1FBSA 1TNTA 4LB6B 4PGHA 2ACJA 3HHGA 4KN7X 5BQTA 2QLZA 1YTYA 5LGUA 3SFZA 1ZRDA 3FXUA 3WTVC 1HKTA 1GHCA 3BZ6A 2K02A 5D4SA 3EQLF 2L4AA 5HLGA 5LHIA 4WX9A 4AIKA 4RGXA 3R0AA 2GWRA 4ENMA 4QLCU 4LJZF 1IF1A 4RAZA 2FNAA 2Y75A 2KKOA 5A2QK 2VE8A 5HDNA 4ZYHA 3K1MA 2A69F 3P9CA 2V6CA 3I53A 2IP2A 2TDXA 5AIQA 1K7AA 2GAUA 2KJBA 1ZGJA 2QQBA 2FBIA 1DUXC 5LEJA 4U0VA 2BV6A 4OIQF 4KICA 3HTUA 5BPIA 2E7WA 2V1DA 2XUBA 3DP7A 3GZ6A 4HYEA 3CO7C 1MGTA 3R61A 2A68F 4R8HA 2K7LA 2PEXA 4UVBA 2D1HA 2Q8KA 2PI0A 3ROUA 4MEYF 4OIRF 1FBQA 3J80K 2HGCA 3GFMA 3QPTA 1SMTA 4Y17A 3I59B 2RNJA 2CYYA 1T98A 5FLXZ 3JSPA 1KU9A 2XASA 5ICGA 2EJRA 1IN4A 3P9IA 2IT0A 3ZP5A 4N0BA 2Z33A 2VE9A 4EJWA 4LK1F 4GO1A 3HIFA 1FOKA 3PQJA 3FHZA 3CO6C 5K1YA 1R1TA 1Z91A 4XLNF 1EV7A 1HXDA 2M87A 5CVVA 3F3XA 3KZYA 1C0WA 4EQQA 2P7VB 2QM3A 4YIIA 2DPUA 4KIGA 4LG0B 2M8EA 4U0YA 2DQRA 4OU0A 1AWCA 3VOEA 2QQAA 2FSWA 2GXGA 2KRFA 2R3SA 4S05A 1FPQA 2VT2A 5CJ9A 2ZJ2A 3BPVA 4FX4A 2JPBA 4EV0A 3I71A 4KA4A 5TJJA 3E6DA 2HEOA 3ZMDA 1S29A 4ZZDA 3CDHA 3ELKA 3IRRA 1KGSA 3MFKA 2XKPA 3DV8A 2FNPA 5DCMB 2LSOA 3DKWA 1Z9CA 1IAWA 2Z5UA 4L0ZB 3NRVA 2BGCA 1F5TA 2LF8A 4I2OA 3K9TA 3G73A 4KDPA 3F23A 4LFUA 3IC7A 4NB5A 2RDPA 3V7SA 1SMYF 2E7XA 4G7HF 2PFBA 2JT1A 2ZKZA 1H9GA 1MDMA 1PDNC 4BQAA 2HKXA 4M9ZA 4EJTA 2UXNA 1BI3A 3MWMA 4P5OA 3VEPA 2FRHA 4AIHA 5LBQA 1V3FA 4H0EA 3ABUA 3B73A 3LAPA 4KUMA 1TW2A 1IRGA 1ONVA 1BIBA 2OA4A 1P4AA 2IA2A 1P2FA 3SZPA 5DCFA 4R79A 1R36A 4HV5A 4RB2C 3CLOA 1BC7C 3O6BB 3WTYC 4BHBA 2M1BA 2P5VA 3WGHA 1YW7A 5E1WA 2STWA 1W7PB 3ULQB 1RUOA 2W84A 1OMIA 2HR3A 4G6DA 1YYVA 2KIFA 1WI9A 2X4HA 1AOYA 1TQIA 4CDGA 1ZG1A 4ZYEA 5E1XA 3I5UA 5DDGA 2GQQA 2EFQA 1EH7A 3JW4A 3K2ZA 1I1GA 2YX7A 2ZNYA 3T8RA 4MEXF 1DDNA 2ZCWA 2H6BA 3LA3A 1B6AA 1QNTA 1J9IA 4A12A 2HTJA 5A2QZ 5CVJA 3M7GA 4CHUA 1HBXG 1U5TA 2FF4A 2A61A 2PLYA 2DI3A 3AAFA 2L02A 3RTRA 2HOEA 3CTAA 4IVNA 2O6GE 2DTRA 1IXSB 3F8NA 4OIPF 1P4XA 2XVCA 3ZMZA 3QPHA 1IRFA 1KA8A 3HOSA 1I27A 2MLGA 4GGGA 4WXCA 2BYVE 1R5HA 2Y0MA 3HRMA 3M8EA 5H20A 4M6YA 1O57A 2VT3A 4IJAA 1LDDA 1KU3A 1R00A 3J80Z 4JQFA 1WKMA 4M9SA 2RQPA 2VXZA 4DNCA 1Z6RA 3KP7A 1GVJA 3N97A 3HYIA 4CGZA 2DK8A 4EM2A 4G7ZF 4HX7A 2LNBA 2ZFWA 2MLKA 4I7HA 2XAGA 4EJVA 3QAHA 2O61A 3HRSA 3ML6A 5LLQA 2RC4A 2NYXA 1TBXA 2Z99A 1SD6A 3HRTA 1R1VA 2Y48A 3BROA 2FEZA 3C18A 2MBFA 1OYWA 4FT8A 4IRGA 2G7HA 3DQVC 4CO8A 3KEOA 4NQWA 2UWMA 1R23A 3RYPA 4IRIA 5D5XB 4KYWA 4DQ2A 2PJPA 4O5VA 3V7RA 5LHHA 4IHSA 2XHKA 3F8BA 1O3RA 3DPTA 4RB1A 1ZH5A 1I1SA 3LA2A 3WTUC 3P9KA 3D5LA 1JHHA 5D6EA 4EVIA 3GF2A 1REPC 2CQKA 2F2EA 1P92A 3JTHA 1MJAA 1EH8A 1FWZA 3SHFA 4LLNA 3FMSA 4G94A 4CXFA 2HS5A 3IWFA 5CYVA 2LKPA 3WTSC 2E1NA 2GA2A 4HX4A 1O7LA 3GX4X 1F1ZA 2LDUA 4PZJA 3IHUA 4I0BA 5DYMA 1K6OA 1U78A 5E8GA 3GFLA 1Z7UA 4UUVA 5D5WB 3KP4A 2O0YA 4A0ZA 5K5OA 4L5IA 4CZZA 2XIGA 4UV8A 3ZMSA 4KFCA 3DF8A 1ON2A 2JTVA 4IF4A 2HDCA 1K79A 3REOA 2WWYA 3PQKA 2EK5A 1W5TA 5E20A 1BBYA 2COMA 2OQGA 2O3FA 2IA1A 1EH6A 3BJOA 2L3DA 3E3VA 3Q9VA 5H6RA 4Z2YA 3H3ZA 4MQVA 1WQ2A 3HSFA 3L7WA 4ZZLA 2VC1A 3LWFA 3SQNA 4ENJA 5ILUA 1E17A 3VODA 4M9XA 3BY6A 1MKMA 4A5NA 1QGPA 3HRUA 3KFWX 3B02A 1O3TA 1MJBA 2M45A 5J8CA 2FBKA 5ED4A 1FSHA 5LRSA 4KMFA 2K27A 4HX8A 1J0RA 2EFNA 4O3MA 3WTXC 4EMSA 3T0YA 2Q2EA 5ICEA 5HLIA 1YO5C 4N9IA 4PCQA 2XAHA 2GIVA 2IPQX 2RV8A 2OZUA 2A6EF 5HDGA 4MQ9F 3GVAA 2O8XA 3DEUA 3L9FA 4A0XA 1CGPA 2P4WA 2OAZA 3F6OA 2DO7A 1ZHFA 2P5LC 2K4JA 2WV0A 1XB4A 5D8KB 3ECOA 3JAMK 5L3BA 4GXOA 2QBYB 1H9TA 1J2XA 4ESJA 1FLIA 3M8FA 5ILVA 3IKVA 2QWWA 2ZMEB 2QENA 4MTEA 4BNCA 4JBAA 3GEZA 5D8LB 4ASNA 4AWXB 2RKHA 1G3WA 1UB9A 5DUKA 3E6MA 2YU3A 2MH9A 2EFOA 1PUEE 1TTYA 2FMYA 5E8IA 1YIOA 5DUIA 2PN6A 5FB2A 3T1BA 1SD7A 4HDVA 2XV4S 2L01A 5BMZA 1G4DA 1XCBA 3V8LA 2A07F 4L5JA 1R7JA 1ZARA 4LK0F 3WU1B 5E18F 2C6YA 1YG2A 4K2EA 2RGVA 3JTGA 3ZN0A 3R6SA 1LB2A 4WXHA 1QQIA 4ETSA 5D6FA 1ZN2A 2D1VA 5DD4A 5ERIA 3HOTA 5FFZA 4OMZA 1K78B 3LQRA 2EV5A 1Q1HA 4M71A 3BOQA 2A5YB 3LA7A 4M74A 4EJOA 4O6JA 4GYIA 3L2CA 3CUQA 3E97A 4B8XA 2OQRA 1U8RA 4MHGA 3D0SA 1IZ1A 2O03A 3G3ZA 2X0LA 2GXBA 1KQ9A 1XSXA 1Y0UA 1QO0D 3CJNA 5FD5A 3C3WA 1GXPA 3WTTC 3JSOA 1OYYA 2IRFG 4L9NA 3K1PA 3BWGA 4HW0A 2F5EA 1QZZA 4BHPA 3MZYA 1SFXA 2DK5A 1BOAA 4M73A 2YX4A 3GFIA 1FP2A 1V4RA 3F8FA 3V8JA 5CVIA 2VC0A 2EWNA 1KU7A 1TNSA 3HUGA 3VFZA 2PMHA 4KIFA 1XDUA 4PDKA 4U88A 3FM3A 2NAZA 1IUYA 1QZYA 1UCRA 1SFEA 5L3EA 4RB3C 4Q48A 5IT9K 5HOOA 3RKWA 4BXUA 4LD5A 5LGNA 4AVPA 1G3TA 4AIJA 4FHTA 2W57A 3RJPA 5LEKA 1LEAA 3HTSB 1B4AA 2PQ8A 1X3UA 5D5VB 4MNUA 3V7CA 1U3EM 4MGRA 2PG4A 2NRAC 4XRFA 1FYKA 5JR3A 5DV5A 1LVAA 3K1NA 4XLPF 4YFXF 1FZPB 3L00A 5CVUA 5ICCA 3IL2A 4RGSA 3EYIA 4A5MA 4RAYA 1XGMA 2WC2A 3TO7A 6PAXA 3MZHA 2J5OA 3KCCA 2CFXA 1FP1D 1ZG3A 1HKSA 2MD5A 4WCGA 3RYRA 4P96A 4XSZF 4R1HA 2ISZA 5JI6A 3IRQA 1QBJA 3LFKA 3E5QA 3WU0A 2E1CA 4U7DA 4FX0A 1T2KA 3V4GA 1I6XA 1FYMA 1IN7A 3LSTA 3WG9A 3E6BA 4XSXF 5F6FA 3ZMTA 1QPMA 3KLOA 3KZZA 3Q9SA 1IXCA 2P6SA 3H3UA 3BJ6A 5D5UB 4P9FA 3KP2A 3F8MA 1KQ8A 2QYOA 2P7CB 2HQNA 4HV6A 1MD0A 3ISPA 3OOPA 4YFKF 2A6HF 4BAYA 2CWEA 2OU2A 1DP7P 1U5TC 2YSRA 5LHGA 3WODF 2EV6A 1OYIA 2YPRA 2VBYA 3FWEA 1S7AA 3RPQA 1ZYRF 5L3CA 1Z05A 2XAJA 2GZWA 3EYYA 3JAMZ 4KNYA 2STTA 3T8TA 4MTDA 1BI1A 1E2XA 2DBBA 3I59A 4OMYA 5HDKA 1MZBA 1H0MA 4G7OF 5HLHA 4HZFA 2EFPA 3ZPLA 4OINF 2ZXJA 1A04A 3DPLC 5CLSA 3FM5A 2P5KA 1LJ9A 2MC3A 2OZ6A 5CVRA 3WGGA 1XGNA 2P6TA 2G9WA 2V9VA 2R7FA 4UVAA 4RGRA 5FFXA 3BP8A 1FSEA 3QU3A 1G3SA 4TV7A 4LLGF 3FXRA 1MDMB 3K0LA 3I64A 2EV0A 4LG0A 3GW2A 4G6QA 2ZO4A 4I09A 4IXAA 3E5UA 1W7PD 3J7AO 1WSUA 3WE3A 4HLXA 5HS9A 4LB5A 1XSVA 3DXJF 2M5WA 2XRNA 1B9NA 3I4PA 3BJAA 1UHMA 3MAJA 4A2UA 3QRFF 2OBPA 1U6GA 5J8FA 4L9TA 5JFRA 3F6VA 2FOKA 1DPUA 4I0AA 1IN5A 2EA4A 3RI4A 2QQ9A 3H92A 1UHWA 1HKQA 1XGSA 2OD5A 4WF2A 5DCMA 1ZREA 4HQMA 4AD9A 2NS0A 4N9HA 2NNNA 2IA0A 3EDPA 1XDSA 2ZNZA 4M72A 2EA2A 3RKYA 3IKTA 4ESFA 3U1DA 1G6NA 4IHTA 4BYYA 1D8JA 5J6XA 2BEOA 3F21A 2PMUA 1XCVA 5TRDA 2F5FA 1MJ9A 3BDDA 1YS6A 2L4MA 1HW5A 3NQOA 3TKYA 3WTZA 3VB2A 1WWXA 4JK1X 2VN2A 3QP6A 1BN5A 3O2PE 1SFUA 5IT9Z 1NHAA 4A0YA 1D3YA 1R1UA 4KT5C 3ERED 3GFJA 1XGOA 3GUDA 3KP3A 4CYDA 4NHJA 1WRJA 3OV8A 1U5TB 3PFIA 3F8CA 1TQMA 2D2WA 2ISYA 4HA8A 1TW3A 1T0FA 2K4BA 4YG2F 1JXSA 3C7JA 1YW8A 5HVQC 3N4MA 1S3JA 4Q5SF 4HF0A 4ENNA 2VBZA 1BI0A 2QVOA 2KIMA 2PBIA 1LDKB 1YLFA 5LRRA 1W7PA 1B1BA 1XN7A 2VBWA 1KYZA 2EFWA 4HF1A 2M30A 5F64A 1UFMA 3FMRA 1JE8A 4RB0A 1JHFA 1P4WA 3KETA 1Z1DA 5JHUA 2F5DA 2VONA 3M1EA 2F5CA 4ZYDA 4HF2A 2JSCA 2KJCA 1ZAOA 4RS8A 3DFGA 3R60A 3TGNA 1USTA 4F7ZA 1VTNC 4L0YB 1T6SA 3BPXA 4OOIA 3KP6A 1XD7A 5BOXA 2CGPA 1J5YA 3J81K 3GLXA 4IPAA 3KP5A 2CG4A 2EB7A 4HQEA 1FYLA 2Z9OA 3W6JB 2H6CA 3GZ5A 1L3LA 4ESBA 4EGYA 2BE5F 3C1DA 3ZMUA 3QP5A 4EJUA 1IN8A 1O3QA 1F4KA 1LDJA 4UHTA 2IJLA 5K5QA 1YS7A 1F9NA 3FX3A 3MQ0A 4A6EA 5KVRA 5ICFA 3I0TA 2VOOA 3ECHA 4OIOF 4ON0A 2HKOA 5FO5A 3ZN1A 4U7BA 1B59A 2ESHA 1STZA 2AS5F 3GXOA 3KLNA 1OKRA 2MH2A 1J7KA 5JVTA 2NNYA 2DFIA 5L3FA 1PP8F 1ULYA 4ZH4F 2RVCA 2Q0OA 1OPCA 5H6QA 4RGUA 5DD8A 3TDUC 2HYGD 2ESNA 3U9GA 2Z3YA 3HSRA 4S04A 1IN6A 1HQCA 3KE2A 4BH9A 4YIFA 1FBUA 2R7DA 5E1ZB 4P9UA 1ON1A 4GCVA 2DQLA 4E70A 1S7OA 3M9AA 5BS6A 3EUHA 2KIUA 4WXDA 1S6LA 2IVMA 3U2RA 3CUQC 2HYFA 1LNWA 4L18B 1XMAA 2ZBKA 1CF7A 3TQNA 2H27A 4P55A 2RN7A 1RI7A 1FY7A 4UXNA 3W6KB 2L54A 1KU2A 5ILSA 4HOBA 2FMLA 5FGMA 3TO9A 4EGZA 3S2WA 5L3GA 5HS7A 1ZRCA 1BIAA 3TOAA 3GWZA 1T38A 3O3KA 5EEHA 2FQ3A 2XKOA 4G9YA 2V1UA 2B0LA 1BM9A 2UXXA 4LMYA 3Q5FA 2DAOA 3R0JA 5AIPA 1O7FA