4ZYDA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
b'LVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPAHRVIAENGIGGYSRGVKLKRALLELEGVKIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 38
structure length 149
sequence length 149
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zydA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zydA01
2TDXA 2NNNA 4EJVA 5LRRA 1U5TB 4ASNA 2V1DA 3L09A 2PEXA 3HRUA 2DT5A 1IXSB 5E8GA 2QQBA 5BPDA 1CF7B 3ZQ7A 3CUQA 4OMZA 1ZRDA 3HOTA 2D1HA 2V1UA 4HZFA 3I59A 2FEZA 1KA8A 2XV4S 2K86A 5ICGA 2J5OA 2HQRA 2Q0OA 5D4SA 4U7BA 4IRHA 3MFKA 1W5SA 5HS7A 1BM9A 1Q1HA 1XDUA 4GO1A 3ML6A 4LMYA 2V9VA 4KDPA 3WTTC 2W25A 2Z99A 2F2EA 1UB9A 4OMYA 1FT9A 5CVIA 1YYVA 5L3EA 2HKXA 3LFKA 4Q5SF 2GAUA 3I53A 1XB4A 3QU3A 3RJPA 4ZYDA 1RUOA 4ESJA 4BHBA 3FZVA 1I1GA 3GX4X 2MLKA 2FRHA 3H3ZA 3V4GA 4HOBA 5DEQA 4DNCA 1EH6A 2ELHA 4M72A 2IVMA 1O3QA 2YX7A 2ZKZA 2XAFA 5HVQC 2ISZA 1FY7A 5JFRA 4YFNF 3I58A 3CJNA 5IT9K 2VBZA 3DEUA 1Z7UA 4AWXB 1LVAA 4QWQA 3BP8A 3E6BA 1BN5A 2WTEA 2EV6A 3CLOA 4HX7A 1RUNA 2EFWA 5AIQA 2HWVA 1WSUA 4IVNA 4LG0A 4FX0A 1HSJA 2IP2A 4ENNA 4ESBA 4HX8A 4NB5A 4K2EA 3CO7C 5FLXK 3WE2A 3KETA 4HAMA 4LK0F 4HBLA 5ED4A 1W7PA 1UFMA 5TRDA 1TNSA 3F6VA 3M8EA 1GXQA 1CGPA 2F5FA 2BGCA 5JVTA 1OR7A 1FNNA 1FX7A 5F6FA 4AIHA 4LG0B 2RC4A 4GGGA 2R7DA 2PI0A 3B02A 5HS9A 3EUHA 1T2KA 2Z3YA 3HIFA 1I1SA 2DK8A 3N4MA 4IHSA 2FQ3A 4A6DA 3F23A 4EGZA 3ZMTA 3Q9VA 1Z9CA 4O3MA 4KUMA 1K7AA 5DCMA 4RGXA 1YW8A 1WRJA 2P6SA 3JAMK 2JPCA 3QRFF 4KN4X 2H6CA 1F9NA 4BQAA 4KMUX 2QM3A 1BI0A 1QPMA 4RB3C 3KP7A 5L3DA 5DCMB 3GF2A 4WWCA 1B9NA 2K27A 1R58A 2FE3A 1DPRA 4AIJA 1G3SA 3IHUA 4UXNA 1I6XA 1U5TC 4BHPA 3ERED 1FSEA 4KN7X 1YLFA 1YS7A 4M9XA 1LJ9A 3GFMA 1B9MA 2KIUA 3LA3A 2BE5F 3OOPA 2XAHA 4P9UA 1KU7A 2ZO4A 3PQKA 5FD5A 2GQQA 3CO6C 5HS8A 1KQ0A 3F8FA 4ZYGA 1YFHA 2X4HA 4FHTA 2PMHA 1YTYA 4FT8A 3K0LA 1FBUA 3R61A 2XHKA 1T38A 3T5XA 1T6SA 4GCVA 2VT2A 3FMRA 4KMFA 2D2WA 3ULQB 3EDPA 4HLYA 1LB2A 1P2FA 4HDUA 5H20A 3K1NA 2XKOA 2RQPA 1V3FA 4LD5A 2MBFA 4KIBA 2XKPA 5LGNA 1ZG3A 1QQIA 2YSRA 3K1MA 4N9HA 2DI3A 3G73A 3ROUA 5ILUA 1SD6A 2STWA 2QLZA 1PDNC 3M9AA 3PQJA 1RI7A 1R7JA 4L9VA 5DDGA 4P9FA 1Z05A 4LLLA 3H3UA 4H0EA 4YIFA 3ZMZA 4CXFA 4M71A 3KFWX 4EJUA 2EFOA 4U0VA 2GZWA 2FBIA 1E17A 5D8KB 2VODA 2ZMEA 4ZYEA 2DTRA 1TQPA 3P7NA 1IXRC 3WGGA 3DPTA 1D8JA 2K7LA 4PDKA 4G94A 3LWFA 4TV7A 3W6KB 5DUKA 5KK1A 3GZ6A 2M45A 1Z6RA 3O2PE 5TJJA 1PUEE 4U0WA 3TGNA 4HF2A 3FWEA 2GXBA 2L54A 2DAOA 2HFHA 1OMIA 3E5UA 1R5GA 1TTYA 5A2QK 3ZN0A 2Y75A 4M73A 1ULYA 4MTDA 1U8RA 1W4MA 1RZ4A 1K78B 3ZMUA 2M8EA 3GFLA 3GWZA 2GWRA 2YU3A 2Z33A 2O3FA 3KEOA 4R79A 2Z9OA 1O7FA 4HW0A 1ODDA 5BQTA 2FMYA 1D8KA 2V79A 4GXOA 2Q8KA 4KIFA 1IW7F 1FYMA 1ZREA 3N97A 4U0YA 4I98B 1YQAA 4I01A 3I4PA 4BXUA 4G8XA 4AVPA 2RVCA 4RB1A 1SD7A 4WXDA 4YIIA 1IRGA 1UCRA 3J7AO 3JSOA 5ICEA 1HQCA 1UHWA 4A0XA 1F4KA 5BS6A 3JSPA 2P5LC 1ZRCA 4EVIA 3O6BB 4HF0A 1S8NA 1O3TA 3V7RA 3GFIA 2J5PA 1ZARA 3F6OA 2A6EF 3LQQA 3T1BA 2EJRA 1SFXA 2FNPA 3VB2A 4EM0B 1S6LA 1ZRFA 2VONA 1XD7A 4UV8A 3HRMA 3KP4A 3NQOA 1LNWA 2FMLA 4WK8F 1J2XA 4UHTA 1FBSA 4G7ZF 3FHZA 4PZJA 3HRTA 2PFBA 3IWZA 1J0RA 5FGMA 2NNYA 3E6DA 3Q5FA 5HDNA 3COAC 3C18A 3VOEA 3Q9SA 2O61A 4XSZF 1R23A 2A6HF 2QYOA 4KT5C 2OQRA 4MEYF 2P7VB 3ECOA 1SMYF 1WKMA 3RPUA 5E17F 1J9IA 1PP7U 3R0JA 1PP8F 1FYKA 2P5VA 2P8TA 1IRFA 1U5TA 1P4AA 3KEQA 4JBAA 1CF7A 4JK1X 1YO5C 4EV0A 5AONA 5DUIA 3J81K 1KU2A 1HBXG 3SFZA 5HLIA 2IA0A 3KLNA 3NRVA 5JR3A 3LAPA 1WI9A 1A04A 3CDHA 4L9NA 3T8TA 3R6SA 1FZPB 3V8LA 2HYGD 3C7JA 2ZXJA 3TOBA 4M6XA 3WTVC 2P7CB 5E18F 3T8RA 5L3GA 4YFKF 3MZHA 3IKTA 3GVAA 2BYVE 3RDIA 2JPBA 3BOQA 3DP7A 1SD5A 1L0OC 4EJWA 2ZFWA 4EGYA 4GYIA 2HR3A 1I5ZA 1LDKB 2XAQA 1KU3A 1FLIA 1S29A 2FA5A 3L2CA 1S7AA 1KU9A 2Z5UA 4KFCA 2A61A 3BWGA 2DU9A 2DLLA 3MZYA 2XGXA 2AS5F 3ISPA 3EYYA 1O3RA 3HUGA 2VT3A 2G9WA 1XGMA 1ZAOA 3V7SA 1X3UA 3QP6A 4XSXF 1BI1A 2MH9A 1XCBA 1ZLJA 2XIGA 2W85A 3ZPLA 1G3WA 6PAXA 1QO0D 1RIOH 3QPHA 4HQMA 1KGSA 1GHCA 2HTJA 5D5UB 3V8KA 1YS6A 2QUFA 1B1BA 2ZBKA 3L7WA 3VODA 2FOKA 2EV0A 1FYLA 4I7HA 3RI4A 1XGNA 4CHUA 3K1PA 3F22A 1IAWA 5BMZA 3WTUC 1KYWA 1U2WA 5CVUA 3I54A 2AXLA 3J80K 2JZYA 2QENA 5HDKA 4UV9A 2VN2A 3ZN1A 3R4KA 1NHAA 1QGPA 4MNUA 3GFJA 1EH8A 4ZZLA 1IN4A 2D1VA 5CVRA 1G4DA 5J6XA 4UVAA 5ERIA 1FP1D 2EFNA 3E5QA 3FM3A 3HSFA 2K4JA 3DKWA 2CSOA 2IRFG 3P9CA 2K02A 3L00A 1EV7A 5CLSA 3OV8A 1LEBA 1MDMB 1JHHA 5D6EA 4N0BA 1S3JA 4EJTA 4N9IA 4HF1A 2O8XA 3FXUA 3W6JB 4A6EA 2YX4A 2QQAA 1HKSA 2L4AA 1R00A 3L9FA 5D6FA 1BC7C 2KKOA 3KZYA 3FX3A 4M74A 2HOEA 4CGZA 3HTUA 3F21A 1ZG1A 4I09A 4CDGA 5DD8A 4HLXA 2W57A 4AIKA 2E1CA 5LGTA 2CQKA 1ON1A 4OIQF 2P6TA 1ZG5A 1OPCA 1E2XA 2OA4A 2ZNYA 2KIFA 4AD9A 2EV5A 1ZN2A 3LA7A 1T98A 5E8IA 4BYYA 2QZ8A 1TQMA 4E70A 5K1YA 3E6MA 1QZYA 1JE8A 2PLYA 1ZHFA 3M1EA 3S2WA 1H9GA 2EA2A 1XGOA 4YG2F 4EJOA 1O3SA 4R8HA 2UXXA 4S05A 5ICCA 1XSDA 2LF7A 2XUBA 4IXAA 1DPUA 2ACJA 5L3BA 5LBQA 2QWWA 5IT9Z 3KZZA 4ON0A 2FF4A 1AOYA 1STZA 2COMA 1FBQA 4R1HA 4B09A 4M9SA 4LB5A 4M6YA 3KP5A 2E7XA 4L0YB 3IL2A 4XLNF 4IJAA 3E5XA 4IRIA 3KE2A 2CG4A 4A12A 4RAZA 5FLXZ 1J5YA 3F8MA 2PJPA 4DQ2A 5CVVA 3KP2A 4FX4A 2MLGA 2F5DA 3GUDA 3F8BA 1IN7A 2VOOA 3BROA 1TLHB 2O0YA 5L3FA 4HA8A 5H6RA 3LAJA 3EYIA 4L5IA 3GXOA 1BBYA 1SMTA 4P5OA 3F72A 2VBWA 2LDUA 4MQ9F 4XLPF 2ESHA 2H09A 5LEJA 4BH9A 2DQLA 3MCZA 1K78A 3DXJF 2UZKA 3QAHA 2QBYB 2MH2A 4I02A 2H6BA 3WE3A 2L02A 3ABTA 3ELKA 1KQ8A 2EB7A 3K9TA 3VEPA 4PGGA 3MEXA 3JAMZ 1REPC 3E6CC 2ZNZA 2ETHA 1QBJA 2X0LA 4ZYHA 1TQIA 2MD5A 3HTSB 3GLXA 1D3YA 2M30A 2FBHA 4UVCA 2XAJA 4XRFA 1IF1A 5J8FA 4HYEA 3CUOA 3WODF 3TQNA 1O7LA 2XROA 4BHCA 2OZUA 4LLGF 5HLHA 3REOA 2M1BA 5LRSA 5LHHA 2XVCA 4G9YA 3WTWC 3P9IA 1G6NA 2DO7A 2MC3A 2RGVA 2ZCWA 2R3SA 2F5CA 2IJLA 4A2UA 1BIBA 4ZZDA 1BI2A 3HHGA 3R0AA 4MQVA 2GA2A 5D5VB 1MJ9A 3U9GA 4KA4A 2ZJ2A 2FSWA 2V1XA 4RB0A 5FB2A 5ICFA 4A0YA 2A69F 1TW3A 3R60A 1MKMA 5DD4A 4QLCU 3SZPA 2C6YA 1VTNC 2JSCA 3BJAA 3RPQA 3HOSA 3BDDA 5EEHA 1GVJA 3QU6A 2CO5A 1FWZA 4NHJA 2A3SA 2PMUA 1S7OA 3WGIA 2EFQA 2L3DA 2HEOA 2QVOA 5KVRA 2DBBA 3MQ0A 2RN7A 4CZZA 1XGSA 3WTSC 2JRTA 1FC3A 1SFEA 4OIOF 1XSVA 3I0TA 1J59A 4L5JA 1GXPA 3C3WA 2LF8A 1AWCA 3H92A 2IW5A 2CYYA 1B4AA 2CGPA 4Q48A 5DYMA 1J7KA 4WXHA 3GYHX 1R36A 3SHFA 5E1ZB 4IHTA 1W7PD 3KCCA 4I2OA 1OYYA 3GO5A 3IRQA 2OZ6A 4EM1A 3TKYA 3BPVA 1ZLKA 4RGUA 2DW4A 5EEGA 3RIRA 3IRRA 3D0SA 1T0FA 1BIAA 1LDJA 2H94A 5ILSA 1Y0UA 1BJAA 2PG4A 4LJZF 2Q2EA 1HXDA 4KIGA 5E20A 2JTVA 5HDGA 5AIPA 5K5QA 1Z6TA 1XMKA 3GZ5A 5A2QZ 3U2RA 2D45A 3EETA 1BC8C 4BNCA 3I71A 4LLNA 4MEXF 2A68F 4I0AA 2W84A 1YW7A 2L4MA 3F8CA 5F1RA 3CUQB 3M7GA 1H9TA 4A5NA 3I59B 2A07F 2E7WA 3LQRA 2HS5A 2M87A 3RKXA 4S04A 2DK5A 4EMSA 4ETSA 2BBYA 2VC1A 2HQNA 2YPRA 1L3LA 3V7CA 2IPQX 2G7HA 4L9TA 2VBXA 3KP6A 2BEOA 1P92A 2HTSA 2OAZA 1KQ9A 3HSEA 4MGRA 2P4WA 4KNYA 1YIOA 3JTHA 3GEZA 3TO6A 2HKOA 1W5TA 2LKPA 1FPQA 1J75A 5H6QA 2DPDA 2O6GE 5K5RA 3TOAA 2FBKA 4OIPF 3ZMSA 1FP2A 2NS0A 2IA1A 2EK5A 4G7HF 2STTA 1SD4A 4Y17A 2HDCA 4P96A 3EQLF 4GYGA 1Z1DA 1IN5A 3FXQA 4OIRF 3DV8A 1XMAA 4G7OF 3M8FA 2VOPA 2RDPA 2F5EA 5FFXA 4B8XA 2XRNA 3BPXA 3MWMA 1P4XA 1MGTA 1JHFA 1TW2A 1F1ZA 1OYIA 2EA4A 1T39A 2Y0MA 1XDSA 1IUYA 1G3YA 3ZMDA 4EM2A 4UUVA 4ZH4F 3GW2A 5BOXA 2FU4A 3DF8A 3BY6A 4I0BA 5F64A 1V4RA 4CO8A 2IT0A 2VXZA 4LB6B 2HYFA 1SFUA 3CTAA 1WQ2A 1P4WA 4KICA 3K2ZA 1MDMA 2FNAA 5FD6A 1YW9A 1R5HA 1W7PB 3J81Z 5JHUA 4CICA 1DUXC 4Z2YA 4MTEA 2GIVA 4G6QA 1KYZA 3JW4A 4U88A 3WG9A 1MD0A 1IN6A 2O03A 3VFZA 2ESNA 1XSXA 4HDVA 3FM5A 4G6DA 1R22A 3TO9A 3O3KA 1U6GA 3RTRA 3ZP5A 1ZGAA 3ECHA 4ENJA 1RNLA 5E1XA 4Y13A 5HOOA 4RGRA 4NQWA 2CWEA 3WTYC 1ONVA 5K5OA 3SXYA 3HSRA 3IC7A 2PN6A 1OKRA 4IPAA 2H27A 2E1NA 2DPUA 3IWFA 3DFGA 2A5YB 4L9JA 4JQFA 1MJBA 2VBYA 4F7ZA 4ESFA 3SZTA 3WGHA 3D5LA 1F5TA 4P55A 2Y48A 2UWMA 5CJ9A 1R1VA 3QOPA 3TO7A 5LLQA 1USSA 2KJCA 4RS8A 1C0WA 2WV0A 2NAZA 1FSHA 3F8NA 2HGCA 3CUQC 4IF4A 3RKWA 4RGSA 5LHGA 1U78A 4LFUA 3QPTA 5CVJA 4O5VA 4Q47A 1HKTA 1P6RA 4XBFA 3NEUA 5LEKA 5BPIA 1R1UA 2L01A 5D4RA 2RV8A 3AAFA 1G3TA 3HYIA 3WU1B 4WCGA 4PCQA 2NRAC 2CFXA 3ABUA 3JTGA 5JI6A 3K69A 3WU0A 3LSTA 1JXSA 1BOAA 2GXGA 2QBYA 3RYRA 1K6OA 4BAYA 1HW5A 3BZ6A 1HKQA 1Z91A 5IT3A 2NYXA 1R1TA 3J80Z 2XASA 3RKYA 2ADUA 3WTZA 5D8LB 2XAGA 1DDNA 5J8CA 4WF2A 4YFXF 3FXRA 5D5WB 3HHHA 1JGSA 1TNTA 1WWXA 2R7FA 3BJOA 2KJBA 1O57A 5E1WA 1U3EM 1ON2A 2ZMEB 5LHIA 1DP7P 4L0ZB 1UHMA 4A5MA 2JT1A 1I27A 1YG2A 4WXCA 3FF5A 5LGUA 1FOKA 5HLGA 4HQEA 2LSOA 2VE9A 4OOIA 2OBPA 1TBXA 3PFIA 1B6AA 2K4BA 4Y15A 3I5UA 2FXAA 3TDZC 1USTA 2G7UA 2YR2A 1H0MA 4KYWA 4U7DA 2RKHA 1QNTA 2BV6A 4EQQA 4UNOA 2UXNA 3MAJA 2OQGA 4RAYA 2CW0F 2OD5A 2WWYA 1IN8A 4UVBA 5DCFA 3E3VA 2PQ8A 3QP5A 3T0YA 4A0ZA 2VE8A 3F3XA 3KP3A 4HX4A 1K79A 3KLOA 1B59A 5ILVA 4ENMA 3HRSA 4CYDA 5CYVA 3SQNA 1EH7A 5L3CA 3P9KA 1LQ1A 3I64A 2EWNA 1QZZA 2B0LA 3FMSA 3DPLC 2MA3A 5FFZA 2W24A 4OINF 4MHGA 1MZBA 4LGWA 2DFIA 4Q4ZF 2ISYA 3LA2A 2WC2A 3TDUC 1IXCA 3FMQA 1IZ1A 2PBIA 3DQVC 3G3ZA 4O6JA 1HW2A 2KRFA 3BJ6A 4WX9A 2RNJA 1D5VA 4D0PA 1HSTA 1OYWA 4OU0A 4IRGA 2OU2A 1LEAA 3RYPA 3ZMVA 3E97A 1SAXA 3C1DA 3V8JA 4ENKA 1LDDA 2DQRA 2M5WA 4L18B 3U1DA 2V6CA 2HZTA 2P5KA 1XCVA 3IKVA 1HW1A 3WTXC 1BI3A 4M9ZA 4HV6A 1MJAA 2GA1A 2VC0A 4PGHA 5D5XB 4RB2C 1ZYRF 2LNBA 1ZH5A 4LK1F 2IA2A 4HV5A 1XN7A 2EFPA 1ZGJA 5FO5A 3B73A 5DV5A 2KIMA 2QQ9A
chains in the Genus database with same CATH superfamily
3IUOA 2TDXA 1PJSA 2MKDA 2NNNA 4EJVA 4JI6E 1A6QA 4DR5E 4XLFA 2R7XA 5LRRA 1U5TB 4IQ4A 2WAFA 4ASNA 1DU6A 2EOSA 2V1DA 3F6GA 3L09A 2YTOA 4RA2A 2PEXA 5FLXC 3HRUA 1TN9A 2DT5A 1R71A 2R7QA 1IXSB 1PUFA 5E8GA 2QQBA 5BPDA 2LKXA 3ZQ7A 3CUQA 1CF7B 4BUPA 4HEIA 4IJDA 3H1CA 4OMZA 1ZRDA 3HOTA 2D1HA 2V1UA 1DGRM 4HZFA 3I59A 2EBIA 2FEZA 4BKXA 1A5JA 2N8XA 4X1EA 5CPRB 3WU2C 3F0CA 2R7WA 1KA8A 2XV4S 4CCJA 1QHGA 1KZHA 1XMXA 1QU3A 2K86A 5F0HA 2LR8A 5ICGA 2J5OA 2HQRA 2Q0OA 1BB8A 5D4SA 2LO3A 4U7BA 3MN2A 2CV1A 4IRHA 2WAEA 3MFKA 1ZU1A 5IWAE 1W5SA 3IWDA 5HS7A 1BM9A 3ZQQA 1Q1HA 3GLLA 1XDUA 4GO1A 3ML6A 1YJ9I 3BC8A 4R2SA 4LMYA 4BU2A 2ME0A 2V9VA 4IZZA 4BE0A 5KL5A 3VK6A 2HVSA 2YSOA 3OS1A 4KDPA 1AU7A 3TW7A 2R7ZJ 4RHBB 3WTTC 2W25A 2Z99A 2F2EA 1UB9A 4OMYA 1FT9A 3C2GA 5CVIA 2LUPB 1YYVA 2FX0A 2I10A 1OISA 5FKKA 2M8GX 5BNGA 5L3EA 2HC5A 2HKXA 2ZMEC 3LFKA 3G4SI 4Q5SF 2GAUA 3I53A 2V88A 5IYDJ 1XB4A 1MSEC 4M3DA 1FOYA 3J7YJ 2YTJA 3KX2A 3QU3A 4BMJA 2PX9A 3RJPA 4ZYDA 3IV5A 4IOCF 1RUOA 5IP9J 1N75A 4R2QA 2W7NA 1SANA 2DODA 4ESJA 4NDLA 2YU9J 1FEXA 2WBSA 4BHBA 2X9DA 3FZVA 4DR6E 1T8IA 1I1GA 3JAMC 3GX4X 2MLKA 3OS0A 2FRHA 3H3ZA 4A3BJ 2GHFA 1E3HA 3V4GA 1Y8RB 3MHSC 4WYQB 2UUCE 4HOBA 1MMGA 5KL2A 5DEQA 4DNCA 1D1BA 3FK6A 1TWCJ 3DTKA 3OY9A 1YRNA 1TZLA 1EH6A 2ELHA 3ASOH 1I50J 1X1AA 3Q0WA 2IVMA 4M72A 3SEZA 1O3QA 4HTGA 4LF6E 1X48A 1IDZA 2YX7A 2BY0A 2EQRA 4HRIA 2ZKZA 1U0JA 1PKPA 2DOEA 2XAFA 3DLLF 1NG7A 5HVQC 2ISZA 1FY7A 2RS6A 1JI8A 5JFRA 3J7AG 4YFNF 4C9YA 2E34A 3I58A 3CJNA 5IT9K 2VBZA 1RC9A 3K4MA 2X1EA 3P1XA 3DEUA 1Z7UA 4AWXB 1LVAA 4QWQA 4BS9A 1EA3A 3BP8A 3E6BA 1QRYA 1BN5A 2WTEA 3HUGB 4PSWA 4WPYA 2EV6A 3CLOA 4HX7A 1YSAC 1RUNA 3CMEI 2EFWA 5AIQA 2HWVA 3FKJA 2B3TB 2BW3B 1WHUA 2X85A 3FXJA 2Y69H 3T1HE 1WSUA 4JOMA 1YJNI 2FGGA 1A1FA 4IVNA 4LG0A 4AU7A 2GM4A 4FX0A 2HOTA 1HSJA 2IP2A 4ENNA 4ESBA 4HX8A 4NB5A 4DBRA 2UXBE 4K2EA 2V6EA 5AC5A 3KIOA 3CO7C 5FLXK 1HNXE 3WE2A 3KETA 4HAMA 2CUEA 4HBLA 4LK0F 5ED4A 5M5WJ 2PMZA 1W7PA 4UY8I 2LCEA 1UFMA 5TRDA 1TNSA 3F6VA 3M8EA 1GXQA 2AHQA 1CGPA 2F5FA 2BGCA 5JVTA 3ASNH 1OR7A 1FNNA 4LF9E 1DI2A 1BR2A 1FX7A 4RLQA 5F6FA 2DFEA 4AIHA 4LG0B 4ZDOA 2KOUA 1JKQC 2RC4A 4GDFA 2A05A 4GGGA 2R7DA 1WJCA 2JA6J 2LK2A 3M8JA 4XM3A 4N4NB 2PI0A 2LBFA 4DR2E 1MBGA 3B02A 3DCFA 3RQ4A 5HS9A 3EUHA 1T2KA 2R5YA 2L9SA 2E2IJ 2Z3YA 3HIFA 2VQFE 5J3LA 3K4KA 4N4OB 1NH3A 1I1SA 3ABKH 2UXCE 3H36A 3CCMI 2EOOA 2DK8A 3N4MA 4DR7E 4IHSA 1ZELA 2FQ3A 2BZTA 4DV7E 1WI3A 3BG6A 4A6DA 4IHVA 3F23A 4EGZA 4Y7NJ 3ZMTA 3Q9VA 3PM1A 1Z9CA 2LE2A 5J47A 4NUBA 2ENHA 4O3MA 2HDDA 1NTCA 4KUMA 2X1CA 2MD0A 2R76A 1K7AA 2JN6A 5DCMA 3OMLA 2LJHA 4RGXA 1YW8A 3G71I 1WRJA 3BR6A 5KHDA 1YUJA 4LU9A 2EMIA 2P6SA 4OAZA 3JAMK 2BHZA 1X3ZB 3UK3C 1S5LC 4CYCA 2JPCA 5B66C 3QRFF 4KN4X 2H6CA 1B8IA 2ELZA 2JA5J 2HQAA 2Y0SN 2JA2A 4BJTA 1LE8A 1GTKA 2ZSHB 1R6RA 2IGOA 1F9NA 2LRDA 4BQAA 5DNYA 4KMUX 2QM3A 2XSJC 1BI0A 4A3IJ 2CSHA 1SEUA 1QPMA 4RB3C 3KP7A 2DYRH 1JTXA 1N78A 5L3DA 2OJED 5DCMB 1GV2A 3GF2A 2UUZA 2LY1A 4BDYA 4WWCA 3I4NJ 4AQYE 1G8XA 1B9NA 3MKWB 2K27A 1R58A 3D5RC 2JY9A 2EZKA 3OYGA 1A1LA 3FKIJ 1Z77A 4C3IJ 2EPZA 2FE3A 1DPRA 2CW7A 2YRMA 4LF7E 3HJEA 3OIOA 3S8PA 4AIJA 1EJ9A 3CMMA 3LSKA 3G1LA 1G3SA 1Q1VA 4FASD 2V8QB 1TT5B 3OYMA 3IHUA 4UXNA 3JR9A 1JUSA 1I6XA 1WJFA 1U5TC 4BHPA 2OTJI 4P78A 3ERED 1FSEA 2W4SA 3SEQA 4KN7X 5DM7F 1YLFA 1YS7A 4BE2A 4JI0E 3B6CA 4M9XA 2CRGA 1LJ9A 3OOUA 3GFMA 1V55H 4E7SA 3C6MA 1B9MA 2VPRA 3AL0B 2YT4A 4DKKA 5GTIC 1OCPA 3BTIA 1V5EA 2L9RA 2KIUA 2F4IA 3LA3A 4X66E 2BE5F 3OOPA 2XAHA 4P9UA 1KU7A 2ZO4A 1OCOH 2MC5A 1ZGWA 3PQKA 5FD5A 1ETKA 4P1WA 1IBKE 3PSFA 2GQQA 3CO6C 1ETYA 2F48A 3OYDA 2WB1N 5HS8A 1KQ0A 3F8FA 4ZYGA 2M9HA 1YFHA 4DYRA 2DA6A 2HPMA 4JI4E 5FRMA 2X4HA 3CP8A 1IRZA 5A2QC 4FHTA 1LFPA 2PMHA 3M4OJ 1YTYA 4FT8A 1FOXA 3K0LA 1FBUA 5J40A 3R61A 2YTDA 4XRSA 3SDBA 3HXLA 2XHKA 3OWTA 4BC9A 1T38A 3T5XA 2K9LA 1T6SA 2XGEA 4GCVA 2KHMA 2JVGA 2VT2A 3FMRA 4KMFA 3EPKA 2E5LE 2A5WA 2D2WA 3ULQB 3EDPA 4HLYA 1LB2A 3JRAA 1P2FA 3BG3A 4HDUA 5H20A 4OOGC 3S1MJ 4B47A 3AV0A 3K1NA 2XKOA 2RQPA 4ZYAA 1V3FA 4FTHA 1QPIA 4LD5A 2MBFA 4KIBA 2EP3A 2VQLA 5EZGA 2CQ7A 2XKPA 4OAYA 2DLQA 5LGNA 5B1BH 1A1JA 1ZG3A 1RETA 2UV1A 2EN3A 1QQIA 4U87A 5IOYA 2YSRA 3K1MA 4N9HA 2DI3A 3G73A 2HYJA 2I8DA 4WSPA 3ROUA 5ILUA 3SZGA 2WBTA 2E1MC 3MD2A 4DJAA 2LYCA 2DFFA 2HVQA 1X6FA 1SD6A 2STWA 2QLZA 1PDNC 4BQNA 3TL4X 4DV4E 3M9AA 4IQJA 2HJJA 3PQJA 5AE1A 2XF7A 1RESA 5CQGA 1RI7A 4PFOA 5DS9A 2FJ1A 3OIQA 5IV8B 1R7JA 2EINH 2L3CA 3NARA 4L9VA 5DDGA 3VYSB 5KL4A 4JP0A 3J7AY 1HNWE 4P9FA 1Z05A 4LLLA 2EM2A 3H3UA 4H0EA 5GPCA 4YIFA 1Y1VJ 3ZMZA 4CXFA 1RRJA 4M71A 3EQ1A 3KFWX 4EJUA 5A69A 2EFOA 1HDDC 4Q28A 3SYTA 2XGCA 2I13A 4U0VA 5F1JA 2GZWA 2FBIA 3EUAA 1E17A 1MW7A 5D8KB 2VODA 5FKLA 2DA3A 2NS8A 2ZMEA 4BXXJ 2YTIA 4ZYEA 1LUJB 1LFBA 2O7OA 2ZJQF 5KL3A 1HC8A 2DTRA 1JGGA 2YTEA 1TQPA 3CCEI 3P7NA 4M3BA 2NVYJ 4XR6A 1IXRC 2VRDA 3W2AA 3WHBA 3DTEA 3WGGA 4XOPA 4DZJA 3DPTA 5A6KA 1I3QJ 2CW8A 1D8JA 2K7LA 3BG7A 3ERMA 4FQGA 4PDKA 1EKEA 2BY3A 3LWFA 4G94A 4TV7A 1APLC 3JTZA 1X3WB 3W6KB 5DUKA 5KK1A 3GZ6A 2M45A 2XGDA 4GFBA 4XLAA 1Z6RA 1B69A 3O2PE 5TJJA 1PUEE 1TWHJ 4U0WA 3TGNA 1HCRA 4IL6C 4HF2A 4IHWA 3FWEA 3JCUC 1HNZE 2GXBA 1UAAA 3BR0A 2L9VA 2L54A 2DAOA 5CFFE 1Z1BA 4KT6A 2HFHA 3S14J 1OMIA 2DLKA 3A01B 2VF1A 3E5UA 1R5GA 5KAFC 1Z7LA 2M1SA 1TTYA 5A2QK 3HDDA 1OQYA 3ZN0A 3HOYJ 1FOWA 3BCAA 2KL4A 2X51A 2K9SA 3H5AA 3VSLA 2Y75A 4M73A 1ULYA 4MTDA 2VKHA 5E3LA 2CFOA 2HXOA 4DBQA 1U8RA 1M1EB 1W4MA 1OCZH 1RR7A 1RZ4A 2DMTA 1WJDA 2JA8J 4BBYA 5A6AA 1V5GA 1K78B 3ZMUA 2M8EA 1R49A 1RQ0A 3GFLA 1N34E 4E4HA 1BA5A 3I3LA 1IC8A 3GWZA 2GWRA 2YU3A 4NBQA 2L7FP 2Z33A 2O3FA 3CCSI 4MO7A 3KEOA 2ID6A 4R79A 2Z9OA 4CSWA 2DDAA 1O7FA 4HW0A 1ODDA 4E7KA 5BQTA 1Z67A 3DBLB 2JR1A 2RQLA 2FMYA 1D8KA 2V79A 3QPLA 5M3MJ 4GXOA 2Q8KA 4KIFA 1IW7F 3CZ6A 3VYRB 3J81C 1FYMA 1ZREA 4OWRB 3N97A 4U0YA 4I98B 1YQAA 2WV1A 4I01A 3I4PA 1FJGE 2KZVA 2W00A 2L7KA 3A0HC 2ME6A 4BXUA 1GV5A 4G8XA 4AVPA 1AKHA 2RVCA 4RB1A 1X1BA 3PO3J 1SD7A 1IG7A 4WXDA 1GUUA 4YIIA 3FK7A 1IRGA 1UCRA 1N25A 3J7AO 3JSOA 2ECBA 3CC7I 2NXNB 5ICEA 1HQCA 1UHWA 2IBDA 4A0XA 2RREA 1F4KA 5BS6A 1KJKA 3JSPA 2P5LC 1ZRCA 4EVIA 3O6BB 3S2HJ 4HF0A 2PMZN 2ZJRF 1BBOA 1S8NA 1T95A 2QGUA 3V7RA 1O3TA 1B72B 2EMLA 2EPCA 3A4CA 3GFIA 2J5PA 2XAUA 1ZARA 1H89C 3F6OA 2A6EF 3LQQA 2EE8A 5EGOA 2GPIA 2EPNA 4ZDLA 1MMNA 1YUIA 3T1BA 4EATA 2EJRA 3F9KA 4E7ZA 1IV8A 1K61A 1G2FC 4EEFG 5FKNA 2K9NA 4JI8E 3BCBA 1SFXA 2FNPA 2HVRA 1HLVA 3VB2A 4EM0B 1IQSA 4M9VC 2EZIA 2ELYA 5LMUE 1S6LA 4UUSA 1ZRFA 2LV2A 3BR3A 2VQEE 3U1KA 2YRHA 2VONA 3CCYA 1XD7A 3CESA 3RZOJ 2L2NA 4UV8A 3AL0C 3HRMA 3KP4A 4DR4E 3NQOA 1LNWA 2FMLA 3PL8A 2Q1ZB 1V54H 2XB5A 1X49A 3DBRB 4WK8F 1J2XA 1Y8QB 4BGDA 4UHTA 9ANTA 1FBSA 2EPKX 4G7ZF 3S1QJ 2DA7A 3FHZA 2RPCA 2WY7Q 4PZJA 1E3PA 4NHRA 1ETXA 2DJNA 2WB1A 3HRTA 4JI7E 2PFBA 3IWZA 1J0RA 2LREA 5FGMA 4F3QA 3HZJA 5DM6F 3E6DA 3LSJA 2NNYA 3Q5FA 5HDNA 1X1DA 1MIJA 3COAC 2EMGA 5KL6A 3C18A 2ODRC 3VOEA 2DN0A 3Q9SA 3P5JA 5EEAA 3CCQI 3EPHA 2O61A 4XSZF 4DIQA 1R23A 2A6HF 2QYOA 1OFCX 1AHDP 3AG3H 5IYBJ 2OCEA 2QA4I 1N32E 4KT5C 3PFYA 4B3AA 2OQRA 4MEYF 1PYVA 2P7VB 2IXSA 3ECOA 1SMYF 1WKMA 3E0JB 2KRCA 1W36C 3RPUA 2IS4A 5E17F 1J9IA 1PP7U 3HPSA 1XNQE 1VQ4I 2K7IA 3R0JA 5EJCA 1YX5A 1PP8F 1DQ3A 1YE9A 4XKCA 4AC0A 1FYKA 1V5FA 2P5VA 4A3DJ 2K85A 2P8TA 3E1SA 1YHQI 1SVLA 3DPUA 5J1YA 1IRFA 1SR9A 4E7LA 2ZXHA 3PO2J 1U5TA 1P4AA 4HEA2 2LLKA 3KEQA 4I76A 2MW8A 1ETWA 4KITB 1UN6B 3S1NJ 2QKMB 4JBAA 1E3OC 4FE4A 4C2MJ 5F08A 2LJUA 2LMZA 1CF7A 2V4JC 3LSIA 3KZIC 4JK1X 1YO5C 4EV0A 1S72I 5EG0B 4LFAE 2LC2A 1ZQ3P 5AONA 5DUIA 1ERDA 1MBEA 1WHNA 3J81K 1KU2A 1HBXG 3CP2A 1R9TJ 2ZC2A 4JYKA 3SFZA 2EMZA 5HLIA 2IA0A 4F93B 3KLNA 3NRVA 4X6AJ 2GLIA 4LITA 5JR3A 3LAPA 1WI9A 2CUFA 4JV5E 1MBHA 2Z2SB 1TF3A 1A04A 3CDHA 4L9NA 2JUCA 4A3CJ 4H4KC 3T8TA 4HPQA 1SVOA 3C4BA 3R6SA 2EIMH 3V8LA 1FZPB 2L8TA 1WCMJ 2HYGD 3C7JA 2PJRB 4LFCE 2ZXJA 2EN8A 1ZTRA 3PNTA 2M9AA 1FKAE 3TOBA 1WZ2A 1XMOE 4BE1A 2GXAA 1ZBTA 3HM5A 3JRHA 3GTKJ 1QA6A 1YYKA 1MBJA 4B3SE 1X6HA 4M6XA 4DUYE 3I4MJ 2JYAA 3WTVC 2P7CB 5E18F 3T8RA 5C3EJ 3M07A 5L3GA 2Y30A 4YFKF 3CCUI 4KZSA 4DGWB 3OIPA 3MZHA 3J80C 2LBSB 5E3MA 2DFHA 1MMAA 3IKTA 4J19A 3GVAA 1WFXA 2BYVE 5IY5H 4A93J 4V2GA 2ELKA 4R2PA 3RDIA 2JJ7A 2B9SA 1IUFA 2JPBA 2Q2EB 3BOQA 1SD5A 2DMNA 3DP7A 2IS6A 3GTQJ 1L0OC 4EJWA 2ZFWA 4EGYA 3ONQA 4GYIA 1VQ6I 2E72A 2QSGX 4PJNA 2HR3A 3Q0UA 4C3JJ 4PJJA 1I5ZA 2YTGA 2DA1A 1LDKB 2F4OB 3H09A 2XAQA 3HTXA 2DSYA 1KU3A 1FLIA 1S29A 1MNDA 1AA7A 2FA5A 4BEHB 3L2CA 1VQOI 2EMWA 2WCC3 1J26A 1S7AA 2IEKA 4LF5E 2DOFA 2JWTA 3A0BC 2EM5A 1MNMC 1KU9A 2EOZA 2E1MB 2KHXA 2Z5UA 4P7DA 4KFCA 1YX3A 3VPRA 2EOEA 2P0WA 5AASA 3CCLI 2JA7J 3PUFA 2A61A 3BWGA 1OCRH 2DU9A 2DLLA 3MZYA 2XGXA 4GEQB 1T56A 3OYNA 2AS5F 3ISPA 4RDUA 3EYYA 2GLOA 1MEYC 1O3RA 3HUGA 1DGCA 2VT3A 3K4NA 2G9WA 3E7LA 1F43A 1XGMA 1ZAOA 3V7SA 2B7TA 5FLVA 3BZKA 1UG2A 3LSRA 2HU9A 4D5FA 2HNHA 4XL9A 2G0EA 2BW3A 1X3UA 1BL0A 2EM0A 3ZQIA 2ZSIB 4B48A 3QP6A 1KYQA 3K10A 4XSXF 4ABZA 3UKGA 2Y31A 3BR2A 3DTIA 4XICA 1BI1A 2MH9A 2EMCA 5F3WA 2OV7A 3D5SC 1XCBA 5A6BA 2NVTJ 5FRNA 1ZLJA 2XPVA 4PUSA 2JRMA 3ZQGA 2XIGA 2W85A 4HSTA 3ZPLA 1KONA 2E2HJ 1Y6IA 2KONA 1G3WA 6PAXA 1QO0D 1YZ9A 3UNGC 3K4JA 1RIOH 3QPHA 2BOLA 4HQMA 1KGSA 2M7BA 4DUZE 3RQIA 1U8BA 2XPUA 1EKZA 1HR0E 1GHCA 2HTJA 2OUMA 4BY7J 4BDZA 1H88C 3DF6A 5D5UB 1YIJI 3ADLA 3V8KA 1YS6A 4ZDPA 2QUFA 2E2JJ 1B1BA 2ZBKA 3L7WA 3ZQCA 3VODA 2FOKA 2EOYA 1UG0A 2OC6A 2EV0A 3FBNB 3DU6A 4XORA 1NG6A 4CH7A 1U9NA 1FYLA 2NVQJ 3LLHA 4I7HA 3RI4A 1T33A 4XQFA 3OYKA 3K70D 2VL8A 1HOMA 2LTSA 1XGNA 2ID3A 3K1PA 4PJMA 4F92B 4CHUA 3F22A 2Y9YA 1IAWA 4R2DA 3EPLA 1JK2A 5BMZA 3THNA 2R7UA 2HDWA 5HNFA 1JUMA 1VFCA 2VQHA 3WTUC 2LVHA 1IV6A 1KYWA 2V85A 1U2WA 5CVUA 2D9HA 2IGNA 2LUQA 1X3CA 3I54A 2AXLA 2JZYA 3J80K 2QENA 2EQ0A 2BHYA 1K6YA 2JWOA 4LTYA 2EL6A 4Y52J 1N33E 1POGA 5HDKA 3DEEA 4UV9A 2VN2A 1DQUA 3ZN1A 3R4KA 4D5CA 1NHAA 1QGPA 4FE7A 2FV4B 5CKTA 5C44J 2VB6A 3OSGA 2NOGA 4DR3E 4MNUA 4KJZA 2R5ZB 2D5VA 3GFJA 4XLCA 1EH8A 2WBMA 3K4CA 2W1OA 4ZZLA 4CUGA 1IN4A 2GOXB 2D1VA 2E36A 3MMYB 1LFUP 3ZOBA 3W6VA 5CVRA 2EM8A 3VHTB 1G4DA 5J6XA 4UVAA 3JRCA 5ERIA 2X6XA 5GAGJ 4B43A 1FP1D 2EFNA 3PIPF 3E5QA 3FM3A 3HSFA 2K4JA 3DKWA 2CSOA 1MH3A 2IRFG 3FXLA 1ORKA 2VJJA 2HZDA 2M0CA 3O8HA 4BBRJ 3P9CA 3SJMA 1R4NB 2K02A 3L00A 2FQ4A 3TP0A 1EV7A 3JRFA 2QEXI 2R0QC 1Y39A 2EIKH 5CLSA 4DV2E 2EN4A 3OV8A 1LEBA 2MFZA 1MDMB 2EOMA 4JI1E 2FUG2 1JUPA 1JHHA 5D6EA 4LFBE 4RBOA 1I94E 1QHHD 1OCTC 4N0BA 4DYCA 2NUFA 1S3JA 2ICWG 2X1DA 4EJTA 4N9IA 2CJJA 4HF1A 2O8XA 3X2QH 1ZBQA 4M30A 3FXUA 3W6JB 4A6EA 2YX4A 3JRDA 2QQAA 2EOXA 1ETOA 1HKSA 1TP4A 2L4AA 2KRHA 3CCRI 4F6MA 3J7Yp 1D1AA 1R00A 3L9FA 5D6FA 4JX5A 3W3CA 1BC7C 2KKOA 3KZYA 2WBUA 3ZQHA 2KISA 4IOAF 3FX3A 4I8OA 1IQOA 4M74A 2HOEA 5LD2C 4CGZA 3PJRA 3HTUA 3F21A 4FCYA 1ZG1A 3I55I 1BJZA 4I09A 4CDGA 2LVSA 5DD8A 4HLXA 2W57A 1JK1A 1OLTA 3H0DA 1FIAA 2DRPA 1WPKA 4AIKA 3RSNA 2E1CA 5LGTA 2CQKA 4A3KJ 5TSEA 3ADJA 3OYLA 4UB6C 1ON1A 1SFOJ 4OIQF 3DLAA 2P6TA 1ZG5A 1OPCA 1VNDA 2LMDA 1PJQA 3BIDA 5LFAA 1E2XA 4ZC3A 3ZQFA 3VYTB 2OA4A 4RM2A 2ZNYA 3DWLE 2KIFA 4AD9A 3ABMH 2VQCA 2EV5A 1ZN2A 3LA7A 1T98A 2NABA 5E8IA 1VQ5I 3T1YE 4BYYA 1W0TA 4B1RA 2O5RA 2QZ8A 1TQMA 4E70A 1X1PA 4PFPA 5K1YA 4D7MA 3OYFA 1T4NA 5JLXA 4O5GA 4NQWB 1T0FC 3E6MA 4A3FJ 5BR8E 5CQEA 3GTJJ 1QZYA 1JE8A 4RLFA 1O0WA 2PLYA 1ZHFA 3HOVJ 3M1EA 2NVXJ 2EPLX 3S2WA 1H9GA 2GOMA 2EA2A 1XGOA 2MYSA 5TISC 4EJOA 2LY9A 4YG2F 1O3SA 2DB2A 4OX9E 2GBYA 2ZJPF 4R8HA 2YTNA 2UXXA 4S05A 5ICCA 2YTFA 2V1NA 3W2VA 3HGGA 2KQRA 4A69C 4ZTFA 1XSDA 4FK5C 3ADIA 5FROA 2LF7A 2XF5A 2VXDA 2VKVA 2XUBA 3GTLJ 4IXAA 1DPUA 2ACJA 5L3BA 5LBQA 1F36A 1TF6A 2QWWA 5IT9Z 4YELA 5B5EC 2LOOA 3CQZJ 3KZZA 4ON0A 2EQ1A 2FF4A 1AOYA 3CMAI 3H9GA 2AO9A 1STZA 1XNRE 2H8WA 1Y1WJ 2LT7A 2COMA 4AM3A 1FBQA 4E7HA 2M2EA 4R1HA 4B09A 4M9SA 4LB5A 4M6YA 3KP5A 1HA8A 2E7XA 4L0YB 2CQNA 4DYQA 2F4VE 3IL2A 2EORA 2XRLA 4DW6A 4XLNF 1JT6A 1OJLA 4IJAA 2MC6A 2FD5A 3E5XA 2DIXA 2KP6A 2TRTA 4IRIA 3KE2A 3GZNB 2NS7A 3G2BA 2CG4A 4A12A 4RAZA 5FLXZ 2RTXA 2ZFUA 5KNLA 1J5YA 3F8MA 1WH7A 2PJPA 4DQ2A 2EMBA 5CVVA 1HF0A 2UU9E 3KP2A 3O8GA 2MLGA 4FX4A 2F5DA 2YTPA 3GUDA 3F8BA 3VYUB 1IN7A 4X65E 3CDLA 3DKYA 1ITYA 1SC7A 4D1QA 3S3MA 2VOOA 3BLYA 5AE2A 3BROA 1TLHB 2O0YA 3H9QA 2IAIA 4HA8A 5L3FA 2UXDE 5H6RA 1XMQE 3A02A 3LAJA 3A01A 3EYIA 2L3JA 4L5IA 4Q35B 3GXOA 1BBYA 1SMTA 4P5OA 5F04A 3F72A 2VBWA 2LDUA 4MQ9F 4DV3E 3IH2A 4XLPF 1RPWA 2LY2A 2EPUA 5ADZA 4M3FA 4C2UA 2ESHA 2H09A 3CF5F 1R5ID 2VJ4A 4DV6E 5LEJA 3RPUD 2MABA 4BH9A 2DQLA 4L5NC 4UB8C 3MCZA 4YRVA 3S17J 3BTLA 1K78A 3K2AA 3DXJF 1RKTA 2UZKA 3BT9A 2WADA 3QAHA 2QBYB 2MH2A 4I02A 4CCMA 2EOQA 4X8WA 2H6BA 2R4GA 4GKJE 1CQTA 1PDAA 3WE3A 2DA5A 2L02A 1IDYA 3ABTA 3ELKA 1KQ8A 2CUJA 5M5YJ 1STUA 2EB7A 4MFDA 3K9TA 2EN6A 2EPMX 3VEPA 4PGGA 3MEXA 3JAMZ 1REPC 3E6CC 2ZNZA 2ETHA 1QBJA 2X0LA 4ZYHA 1TQIA 2MD5A 2NUGA 4E6KG 3HTSB 3FDYA 1H8AC 2DOAA 4E7JA 3GLXA 1D3YA 2W48A 3KPHA 2YU8A 2M30A 2WAQA 2FBHA 2QQ8A 1X2MA 3AUZA 4I99C 4UVCA 2EOIA 2XAJA 2M4KA 4XRFA 2R93J 1UJ8A 3OSFA 1IF1A 2CTDA 4X9JA 2XF6A 4JX6A 3QYFA 5J8FA 4HYEA 4B44A 2EOFA 1A1GA 3NAUA 3VYXA 2RNGA 3VWBA 3BGHA 3CUOA 3WODF 1VQ7I 4F9BB 3TQNA 1O7LA 5DTDA 2H1KA 1K4TA 2XROA 3DU5A 3G1OA 3QQAA 3HKZN 4BHCA 1B72A 1HDPA 2OF7A 2OZUA 4LLGF 5HLHA 2DYSH 3OS2A 3REOA 4BQOA 4M2ZA 1AH5A 2M1BA 3QWLA 5LRSA 3UR3C 5LHHA 4MFEA 2XVCA 4G9YA 4J01A 3WTWC 2V7FA 3P9IA 2L5QA 1G6NA 3BG9A 2DO7A 2HI3A 2MC3A 2RGVA 2ZCWA 2R3SA 4MLQA 2F5CA 1WJ5A 4F54A 2K9QA 2R1FA 2EMFA 2IJLA 2XB0X 4A2UA 3ECRA 1BIBA 4ZZDA 1D0ZA 2H1LA 1Z3YA 4F2JC 1BI2A 3CJQB 3HEFA 2AQEA 2AQFA 3HHGA 3R0AA 4MQVA 2GA2A 2RS7A 2DA2A 2BVMA 5D5VB 2LTPA 2L92A 1MJ9A 1E0EA 2RSMA 3U9GA 4X62E 4KA4A 1ETVA 1XTAA 2ZJ2A 4YIRX 2FSWA 3RZDJ 1FTZA 2V1XA 4RB0A 3S3NA 5FB2A 1PVEA 3BR5A 1RMDA 4LIUA 5ICFA 3CJRB 3A03A 4ITVA 3KEYA 4A0YA 2A69F 1WJBA 2EPPA 3GTGJ 4BXFA 1TW3A 1D0XA 2MSYA 3R60A 2CQQA 2VASA 1MKMA 4R2RA 2EL4A 1K83J 4JYAE 3LNQA 5DD4A 3FISA 1A1HA 4QLCU 1D0YA 3OR2C 4KISA 3L2WA 4A3GJ 3SZPA 2R7SA 2C6YA 1NCSA 1VTNC 2JSCA 3BJAA 3RPQA 3TW6A 3HOSA 5GTHC 5F27A 5K7ZA 2W82A 1A36A 1VQLI 3BDDA 2A25A 5EEHA 1GVJA 3QU6A 3A1YA 4UUTA 1TWAJ 4NXNE 2CO5A 2K3PA 4F9AB 4TUGA 4BL0B 1FWZA 2EPOA 1TT0A 2MG4A 4NHJA 2A3SA 2PMUA 2TCTA 4F55A 3H35A 4M6VA 5GP9A 1S7OA 4QSHA 4R03A 3WGIA 3BQZA 2IHR1 5A6BD 3OYCA 2Z16A 2ELJA 2E5ZA 2I9IA 3C2BA 2EFQA 2L3DA 2ZXIA 2HEOA 1X6EA 5GAEJ 2QVOA 5KVRA 2DBBA 3MQ0A 2RN7A 5B3SH 4CZZA 5EG0A 1XGSA 3WTSC 2JRTA 2JVHA 1IJWC 1SFEA 1FC3A 3TMOA 4OIOF 1XSVA 2DA4A 1VF9A 2NOJB 1GVDA 1QVUA 4W1UA 1Z0XA 3I0TA 4X0GA 4K0KE 2V86A 1J59A 4L5JA 1GXPA 3C3WA 2LF8A 3H5RA 3H92A 1AWCA 2IW5A 2CYYA 1B4AA 2CGPA 4Q48A 5DYMA 2V26A 1N77A 5M5XJ 4WSGA 2EZHA 4RM3A 3CF2A 3MKZA 3ZGKA 1J7KA 2B63J 4WXHA 3GYHX 2JOXA 1R36A 3GCMA 4A3JJ 3SHFA 1PJTA 2VUMJ 5E1ZB 2PJRA 4IHTA 1W7PD 4M0VA 4XLHA 5IP6A 3FXKA 3KCCA 3TBIA 3OYJA 4I2OA 5HNHA 1OYYA 3K4LA 1X2NA 3GO5A 3EPJA 2RSIA 3K4BA 3IRQA 2A6TA 2M4IA 2OZ6A 4EM1A 1SVMA 4XK4A 4FETA 1EF4A 3TKYA 3BZCA 3RKQA 2Z1DA 3BPVA 3HGYA 3BR1A 1ZLKA 4RGUA 2DW4A 5EEGA 3RIRA 4IX7A 2PRTA 3IRRA 3D0SA 1T0FA 1BIAA 1LDJA 1UELB 2H94A 2L9NA 2BBGA 2EMKA 5ILSA 1Y0UA 2L6MA 3LL7A 1BJAA 2PG4A 4LJZF 2Q2EA 4QIWN 1HXDA 4WFTA 1TWGJ 4KIGA 5E20A 2JTVA 2YRKA 2JMWA 2ZB9A 2N3GA 5HDGA 3JRIA 5AIPA 5K5QA 3VDXA 1Z6TA 1XMKA 3K6QA 2QSFX 3GZ5A 3I56I 2YZTA 5A2QZ 4HNUA 3U2RA 3ZXSA 3RCOA 4S0HB 4BEHA 2D45A 3EETA 3WG7H 1BC8C 1D5YA 3HPHA 2VIXA 4R2EA 2GIZA 3CD6I 4XIDA 4BNCA 4BC7A 3I71A 4GRIA 2E1MA 4R8OA 4LLNA 2EILH 1FJLA 4MEXF 1Y0NA 2IS1A 2A68F 5EDNA 1FIPA 5KAIC 4Y33A 3KYCB 2DXIA 3S16J 3EUKL 4I0AA 2W84A 1A35A 2YSPA 5C4XJ 1YW7A 2L4MA 3F8CA 2KMUA 2V87A 2M7QA 5F1RA 1PUFB 1YYWA 2WA0A 4HG2A 3CUQB 4TUIA 4M3EA 3M7GA 1H9TA 4A5NA 4JI3E 2M4GA 3I59B 5E3OA 2A07F 1VQNI 2E7WA 3LQRA 5H2FC 2E60A 2HS5A 2M87A 3RKXA 4S04A 2DK5A 4EMSA 4ETSA 2BBYA 2VC1A 2HQNA 2YPRA 1L3LA 3MHHC 3V7CA 1F2IG 3U21A 4XKWA 5IOZA 2IPQX 3IWCA 1G59A 1RC7A 2G7HA 2CT1A 1J5EE 1LPQA 4L9TA 4B4CA 2VBXA 3KP6A 5IPAA 1IRXA 2JK3A 2BEOA 5J1RA 1LVKA 1P92A 2HTSA 4XKVA 1WH5A 1MH4A 3S1RJ 2OAZA 2V9PA 2VJ5A 1KQ9A 3NWTA 3HSEA 3OYHA 5EF6A 2NA2A 4MGRA 2P4WA 3H5NA 4KNYA 2ODRD 1YIOA 3BQYA 3JTHA 1Y56A 3GEZA 5FLMJ 3TO6A 1UHSA 5KCMA 2HKOA 1W5TA 3MZ8A 2LKPA 5JLWA 4YY3E 2EM4A 1FPQA 1J75A 1OCCH 4XMYA 4NXME 5GPAA 5H6QA 2DPDA 2XDVA 1W36D 2O6GE 5K5RA 3TOAA 3TQMA 1LLMC 2FBKA 1YYOA 3AG4H 3LMLA 2LG4A 3L2UA 1BR1A 3EPZA 3OR1C 4OIPF 3ZMSA 1FP2A 4CCKA 3HKZA 3GMEA 2NS0A 2UUBE 2NUEA 2IA1A 4XLEA 3FIWA 4CCOA 5GAHJ 2EK5A 4G7HF 1VQPI 4BJ5C 2STTA 4J8ZA 4XONA 1SD4A 3IAM2 2VI6A 4Y17A 4P96A 3AG2H 2HDCA 2JOBA 1MSFC 1G2HA 1WJAA 3EQLF 2FOWA 2VJIA 3W2WA 4GYGA 1Z1DA 4B3RE 4PJ0C 1IN5A 5AC4A 3FXQA 4OIRF 3DV8A 1YRNB 1WVRA 1XMAA 4II2A 4E7IA 1WXRA 2HQ5A 4G7OF 3M8FA 2VOPA 2O9LA 4BACA 2DJIA 2RDPA 4GKKE 2F5EA 4V2FA 5FFXA 4B8XA 1W5CC 4KHPE 2XRNA 1MNEA 3M1CA 4CZCA 5GADJ 3PSIA 2N8GA 3BPXA 3PUBA 3MWMA 2WZOA 1BR4A 2EN7A 1P4XA 1P7JA 1XS9A 1MGTA 2R5ZA 1JHFA 2EPXA 2HOAA 1TW2A 1F1ZA 1G2DC 1OYIA 2EA4A 2R7VA 2JUGA 3DJWA 1T39A 4GZNC 2Y0MA 1XDSA 2B9DA 1IUYA 1UMQA 2MKNA 1U9OA 5JVGF 5LMNE 1FMWA 1G3YA 3ZMDA 2WAQN 4EM2A 2CUZA 1VI0A 4LF8E 3CDIA 1X4PA 3DBHB 4UUVA 4ZH4F 2CV0A 3GW2A 5BOXA 2FU4A 3ZOQB 3DF8A 3BY6A 4I0BA 5F64A 2XSDC 1ZR2A 1P9QC 1V4RA 2HOSA 4BJ6C 4CO8A 2IT0A 1UHZA 1ZR9A 2F8BA 4RH8A 2V83A 4II3A 4CCNA 2VXZA 2R7OA 1I39A 4LB6B 1VQKI 2HYFA 1SFUA 3CTAA 1WQ2A 1P4WA 4KICA 3ZQLA 3K2ZA 2LH9A 1MDMA 5J4VA 3HPZA 1T4LB 2K3FA 2FNAA 4DOZA 5FD6A 1IGNA 2QSHX 5M3FJ 1YW9A 1R5HA 1W7PB 4AYBA 3LSPA 2CU7A 4C30A 2K5CA 5JHUA 3J81Z 1GQEA 4XRSG 4CICA 3C4TA 1ENHA 4RMNA 1DUXC 1VQMI 4Z2YA 2YPNA 1LKXA 2EH3A 4MTEA 3VYYA 3LSGA 2GIVA 1I3AA 4G6QA 4D7NA 1KYZA 3JRBA 3JW4A 4IHXA 4U88A 3HG9A 3WG9A 1NK3P 3G1MA 5HODA 2JXPA 1GT0C 2X48A 4XN0A 2LBFB 1MD0A 1IN6A 2KDZA 2O03A 2BB8A 3VFZA 2R5YB 3BBGA 3S32A 2ESNA 1XSXA 4F91B 4HDVA 2P81A 2KZGA 3C6KA 4DMIA 1VZ0A 3FM5A 4G6DA 1R22A 4NC6A 3TO9A 2EPRA 4DV0E 3O3KA 3ESWB 3DKXA 2JVAA 1U6GA 1BW6A 1VQ9I 4BBSJ 4DV1E 2E35A 3LFUA 3RTRA 3ZP5A 1SFKA 1ZGAA 3ECHA 3MVPA 1ZR4A 3BTCA 1A31A 4W97A 4ENJA 2AXTC 3H9JA 4B3XA 1VQ8I 3TP3A 1RNLA 4MIMA 4N4RB 1ZAAC 5E1XA 1FMVA 2BY1A 2RAEA 3DEWA 3QOEA 4Y13A 5HOOA 1I6HJ 2UUAE 4F6NA 3L1PA 2CQXA 4AIDA 3L2VA 4BY1J 1IBME 2CMPA 2VKEA 4RGRA 4NQWA 1RKWA 5F0FA 1MBKA 2CWEA 3WTYC 3JREA 1ONVA 1YJWI 5K5OA 1JKRC 4CYCB 1RR8C 3MSWA 2L7MP 3SXYA 4NC7A 3ABLH 1LE8B 1B8IB 3C2HA 3HSRA 4XKBA 3HOZJ 4X64E 2EMYA 3IC7A 2BXYA 5FKMA 2PN6A 1BOBA 4O24A 4IKFA 3H0GJ 1OKRA 2EM6A 3I9V2 4IPAA 1N3GA 2B7VA 2H27A 5IXMB 2EMAA 2E1NA 2DPUA 3Q0VA 2KLOA 3IWFA 3DFGA 2A5YB 4L9JA 4JQFA 3RMPA 1MJBA 1GLNA 2VBYA 1X19A 3ZRGA 4ESFA 3SZTA 4F7ZA 1WJPA 2YWQA 2XC7A 3WGHA 5C4JJ 3GTOJ 3D5LA 3KYLA 2EN1A 4R2AA 1F5TA 1GZ6A 1MBFA 2EPFA 1XC5A 4P55A 2LKSA 5FJ8J 2NVUB 2L0KA 3K7AJ 2Y48A 2UWMA 3M99B 5TGTA 5CJ9A 2COBA 2EM9A 1R1VA 3QOPA 4G12A 2M34A 3TO7A 4YEJA 2EMHA 5LLQA 3Q3SA 1USSA 2KJCA 4RS8A 2J7JA 1C0WA 3FXOA 3CC2I 3BF2A 2WV0A 3PNYA 2NAZA 4NC8A 1FSHA 4DR1E 1DGWY 3F8NA 2HGCA 3N05A 1ZKGA 2H36X 3L2RA 3CUQC 2X6YA 3HPGA 2MGQA 4IF4A 5E79C 3RKWA 4RGSA 3S2DJ 2F6CA 2E71A 5LHGA 1U78A 3J7ZI 3L2QA 1ETQA 4LFUA 2VLAA 5K7FA 1BBGA 2KIQA 3QPTA 5CVJA 4O5VA 3JRGA 4Q47A 1HKTA 1P6RA 2R7TA 1MMSA 4XBFA 2KFDA 4O4KA 2E19A 3NEUA 4KWYA 4NZVA 5LEKA 4AVZA 1O4XA 4G6TB 4DV5E 5EZHA 4IEJA 2L2MA 5BPIA 3M3YJ 2HHHE 1UBDC 4FISA 1R1UA 2L01A 3S93A 5D4RA 3LMMA 2O8KA 2RV8A 2HPIA 3AAFA 1JTYA 4JX4A 1G3TA 4B3ME 4JI2E 3HYIA 2EWLA 3HBLA 3IP4B 3WU1B 4WCGA 4PCQA 2NRAC 2IGMA 2CFXA 3A2KA 3ABUA 3HC7A 3OL4A 3JTGA 5JI6A 3BTJA 3K69A 3S3OA 2VE7C 3WU0A 2ZM6E 3LSTA 2YTQA 4XNFA 1JXSA 1BOAA 2OTLI 5K7HA 1XX5A 3QODA 1NK2P 2GXGA 2EM3A 4QTRA 2QBYA 3RYRA 2DDBA 2M7AA 1K6OA 3PNVA 2CV2A 4BAYA 2B7EA 2L7ZA 3WHCA 1HW5A 3BZ6A 1HKQA 1Z91A 5IT3A 2NYXA 3HB9A 1R1TA 3J80Z 2ADRA 2EZLA 2XASA 3FHNA 4ZJZA 2MDGA 3MKLA 3RKYA 3HOUJ 1JJ8C 3IAS2 2ADUA 4CCLA 2HXIA 4Z6YA 3WTZA 2F5VA 5D8LB 2IGKA 2XAGA 4M3GA 3MKYB 2MC4A 5J8CA 1DDNA 1DP3A 4WF2A 1NEIA 4YFXF 2YS9A 2FTXB 2EL5A 3FXRA 5D5WB 2YU5A 4DZPA 2ECCA 3HHHA 1JGSA 4NNJA 1L4SA 3BG5A 3HOXJ 4QPOA 3AKZA 1TNTA 1WJEA 1WWXA 2BY2A 2R7FA 3K6GA 4MLOA 3BJOA 4IS1C 2DMQA 2XPWA 3CCJI 2KJBA 1N36E 1O57A 2EOJA 4BCAA 5E1WA 2CH0A 3AFHA 4A3EJ 3THOB 3IWBA 1AAYA 1P47A 1YITI 3LSHA 1U3EM 3OYIA 1ON2A 2ZMEB 2DT7B 1X58A 5LHIA 2CPNA 5LL6R 3ZR8X 2QCOA 1DP7P 4BQQA 4L0ZB 1UHMA 3OYEA 4A5MA 2OPTA 2JT1A 4C2TA 1I27A 1YG2A 4WXCA 5F0CA 3FF5A 2EQ3A 4J00A 1IMUA 1YOVB 5LGUA 1D1CA 4LG3A 4ZTJA 1FOKA 4JI5E 2CS3A 5HLGA 4HQEA 1XPXA 3KWRA 3IH3A 2LSOA 2K9MA 1J09A 4C3HJ 2DMPA 4Y3OA 2VE9A 4Y4RA 4OOIA 2LTRA 3KYDB 1A1KA 5J1UA 1K4SA 3CC4I 2OBPA 1TBXA 3FXMA 3PFIA 2EM7A 2VPLA 1B6AA 4IO9F 1R4MB 2LD5A 2Y9ZA 1YPNA 2K4BA 4Y15A 3I5UA 2FXAA 3TDZC 1UILA 1USTA 2G7UA 2YR2A 1H0MA 4KYWA 4LIVA 3OYAA 2ENAA 4PJLA 2RKHA 4PK4A 4U7DA 4AUXA 2V9KA 2V89A 1QNTA 1JJ6C 3VSKA 1OR7C 3TEDA 2BV6A 4A3LJ 1QZEA 4EQQA 4UNOA 2EPAA 2UXNA 2X6WA 3MAJA 3CLQA 2OQGA 3QPSA 4XOTA 5E3NA 1FTTA 1SAUA 1X1CA 1S7EA 1JT0A 2H8RA 5J4YA 5AE3A 3GTPJ 4RAFA 4RAYA 2CW0F 3EUHC 2VQGA 3IH4A 1A6IA 3HOWJ 3OYBA 2OD5A 1IN8A 2LP0A 2M3AA 4UVBA 5DCFA 2WWYA 4O43A 2EMXA 2ZXWH 2PQ8A 3E3VA 3QP5A 3T0YA 5A6JA 3JU0A 4A0ZA 5HLTA 2VE8A 3F3XA 3KP3A 5T6JA 4B3TE 4HX4A 1K79A 5KL7A 3CJTB 3KLOA 2WY8Q 1B59A 2BVLA 2DCEA 5ILVA 3B6AA 4LOCA 3HRSA 4CYDA 4ENMA 5CYVA 2YUSA 3SQNA 3GTMJ 1EH7A 3ZCOA 1IBLE 3QYEA 4CA0A 3SDGA 5L3CA 1GDTA 3P9KA 1LQ1A 1A1IA 4F9CB 3I64A 4PSXA 2EWNA 1DU0A 5EYRA 2Y0SA 2KDOA 1QZZA 2B0LA 2K40A 3FMSA 4QPQA 4D9JA 1QVTA 1XG1A 3DPLC 3QYBA 5B1AH 2MA3A 3OMYA 1ACIA 5FFZA 2W24A 4OINF 4MHGA 3H3VK 1JKOC 3F6HA 1W1WE 1MZBA 4V19K 1QU6A 2BXZA 4LGWA 1AKHB 2DFIA 2K4VA 1TC3C 1X47A 4Q4ZF 4XN3A 2N3HA 2ISYA 4ANJA 3LA2A 2EJ4A 2WC2A 3TDUC 2VKDA 3LSMA 3AG1H 4HNVA 2DMYA 4MLVA 1WGXA 1IXCA 1Z21A 2X6OA 3NWSA 4L5EA 3FMQA 3HQ1A 2DT6A 1IZ1A 2PBIA 3DQVC 3G3ZA 1W0UA 2QF7A 4O6JA 3CMYA 4AYBN 1HW2A 2KRFA 3BJ6A 4WX9A 2RNJA 2Q8UA 1D5VA 4D0PA 2RQQA 1T08B 3ADGA 2KT0A 1HSTA 3S15J 1OYWA 2LRSA 1Z3XA 4IRGA 4OU0A 4LF4E 3FIGA 2OU2A 1LEAA 2Y2ZA 5IYCJ 5EGOB 1T4OA 2DMIA 3RYPA 3ZMVA 3E97A 1SAXA 3C1DA 2HGHA 4I6ZA 4HNTA 2EN2A 2R7RA 4UUSB 1ZK8A 1IO2A 1TL8A 2JP9A 3V8JA 5JHFA 4ENKA 3GBGA 2M0MA 1LDDA 2DQRA 2M5WA 2OCCH 2DGCA 4L18B 3SFIA 3U1DA 2R92J 2V6CA 1BW5A 2HZTA 2P5KA 2EIJH 1XCVA 1WHQA 4A3MJ 3IKVA 1YI2I 1HW1A 1MMDA 4F52A 3WTXC 2JSPA 4XRMA 1S9HA 2EOHA 1X5WA 2L2OA 5FKOA 1TWFJ 1X4OA 4HSRA 1JKPC 2F4MB 1BI3A 2I5UA 4YHHE 4M9ZA 2LFBA 4HV6A 1MJAA 2GA1A 2MDRA 2IS2A 2VC0A 1PJRA 3OL3A 4PGHA 2DTZA 5D5XB 2E1OA 5IT9C 4RB2C 1ZYRF 3QG5C 2LNBA 1ZH5A 2JPAA 2QKLB 1UZCA 4LK1F 2IA2A 3LOCA 3OTOE 4HV5A 5IP7J 1XN7A 2EFPA 3FBIB 3HL2A 4L8NA 1ZGJA 2L33A 5FO5A 3CCVI 3PIOF 2EZ6A 3V42A 4R2CA 4RAGA 3B73A 2E5NA 2KPMA 2L2KB 2JQ7A 2DMUA 3D1NI 5DV5A 2ENCA 1P7IA 2KIMA 3K70C 4IHYA 3G6EI 2QQ9A
chains in the Genus database with same CATH topology
2TDXA 2NNNA 4EJVA 5LRRA 1U5TB 4ASNA 2V1DA 3L09A 2PEXA 3HRUA 2DT5A 1IXSB 5E8GA 2QQBA 5BPDA 1CF7B 3ZQ7A 3CUQA 4OMZA 1ZRDA 3HOTA 2D1HA 2V1UA 4HZFA 3I59A 2FEZA 1KA8A 2XV4S 2K86A 5ICGA 2J5OA 2HQRA 2Q0OA 5D4SA 4U7BA 4IRHA 3MFKA 1W5SA 5HS7A 1BM9A 1Q1HA 1XDUA 4GO1A 3ML6A 4LMYA 2V9VA 4KDPA 3WTTC 2W25A 2Z99A 2F2EA 1UB9A 4OMYA 1FT9A 5CVIA 1YYVA 5L3EA 2HKXA 3LFKA 4Q5SF 2GAUA 3I53A 1XB4A 3QU3A 3RJPA 4ZYDA 1RUOA 4ESJA 4BHBA 3FZVA 1I1GA 3GX4X 2MLKA 2FRHA 3H3ZA 3V4GA 4HOBA 5DEQA 4DNCA 1EH6A 2ELHA 4M72A 2IVMA 1O3QA 2YX7A 2ZKZA 2XAFA 5HVQC 2ISZA 1FY7A 5JFRA 4YFNF 3I58A 3CJNA 5IT9K 2VBZA 3DEUA 1Z7UA 4AWXB 1LVAA 4QWQA 3BP8A 3E6BA 1BN5A 2WTEA 2EV6A 3CLOA 4HX7A 1RUNA 2EFWA 5AIQA 2HWVA 1WSUA 4IVNA 4LG0A 4FX0A 1HSJA 2IP2A 4ENNA 4ESBA 4HX8A 4NB5A 4K2EA 3CO7C 5FLXK 3WE2A 3KETA 4HAMA 4LK0F 4HBLA 5ED4A 1W7PA 1UFMA 5TRDA 1TNSA 3F6VA 3M8EA 1GXQA 1CGPA 2F5FA 2BGCA 5JVTA 1OR7A 1FNNA 1FX7A 5F6FA 4AIHA 4LG0B 2RC4A 4GGGA 2R7DA 2PI0A 3B02A 5HS9A 3EUHA 1T2KA 2Z3YA 3HIFA 1I1SA 2DK8A 3N4MA 4IHSA 2FQ3A 4A6DA 3F23A 4EGZA 3ZMTA 3Q9VA 1Z9CA 4O3MA 4KUMA 1K7AA 5DCMA 4RGXA 1YW8A 1WRJA 2P6SA 3JAMK 2JPCA 3QRFF 4KN4X 2H6CA 1F9NA 4BQAA 4KMUX 2QM3A 1BI0A 1QPMA 4RB3C 3KP7A 5L3DA 5DCMB 3GF2A 4WWCA 1B9NA 2K27A 1R58A 2FE3A 1DPRA 4AIJA 1G3SA 3IHUA 4UXNA 1I6XA 1U5TC 4BHPA 3ERED 1FSEA 4KN7X 1YLFA 1YS7A 4M9XA 1LJ9A 3GFMA 1B9MA 2KIUA 3LA3A 2BE5F 3OOPA 2XAHA 4P9UA 1KU7A 2ZO4A 3PQKA 5FD5A 2GQQA 3CO6C 5HS8A 1KQ0A 3F8FA 4ZYGA 1YFHA 2X4HA 4FHTA 2PMHA 1YTYA 4FT8A 3K0LA 1FBUA 3R61A 2XHKA 1T38A 3T5XA 1T6SA 4GCVA 2VT2A 3FMRA 4KMFA 2D2WA 3ULQB 3EDPA 4HLYA 1LB2A 1P2FA 4HDUA 5H20A 3K1NA 2XKOA 2RQPA 1V3FA 4LD5A 2MBFA 4KIBA 2XKPA 5LGNA 1ZG3A 1QQIA 2YSRA 3K1MA 4N9HA 2DI3A 3G73A 3ROUA 5ILUA 1SD6A 2STWA 2QLZA 1PDNC 3M9AA 3PQJA 1RI7A 1R7JA 4L9VA 5DDGA 4P9FA 1Z05A 4LLLA 3H3UA 4H0EA 4YIFA 3ZMZA 4CXFA 4M71A 3KFWX 4EJUA 2EFOA 4U0VA 2GZWA 2FBIA 1E17A 5D8KB 2VODA 2ZMEA 4ZYEA 2DTRA 1TQPA 3P7NA 1IXRC 3WGGA 3DPTA 1D8JA 2K7LA 4PDKA 4G94A 3LWFA 4TV7A 3W6KB 5DUKA 5KK1A 3GZ6A 2M45A 1Z6RA 3O2PE 5TJJA 1PUEE 4U0WA 3TGNA 4HF2A 3FWEA 2GXBA 2L54A 2DAOA 2HFHA 1OMIA 3E5UA 1R5GA 1TTYA 5A2QK 3ZN0A 2Y75A 4M73A 1ULYA 4MTDA 1U8RA 1W4MA 1RZ4A 1K78B 3ZMUA 2M8EA 3GFLA 3GWZA 2GWRA 2YU3A 2Z33A 2O3FA 3KEOA 4R79A 2Z9OA 1O7FA 4HW0A 1ODDA 5BQTA 2FMYA 1D8KA 2V79A 4GXOA 2Q8KA 4KIFA 1IW7F 1FYMA 1ZREA 3N97A 4U0YA 4I98B 1YQAA 4I01A 3I4PA 4BXUA 4G8XA 4AVPA 2RVCA 4RB1A 1SD7A 4WXDA 4YIIA 1IRGA 1UCRA 3J7AO 3JSOA 5ICEA 1HQCA 1UHWA 4A0XA 1F4KA 5BS6A 3JSPA 2P5LC 1ZRCA 4EVIA 3O6BB 4HF0A 1S8NA 1O3TA 3V7RA 3GFIA 2J5PA 1ZARA 3F6OA 2A6EF 3LQQA 3T1BA 2EJRA 1SFXA 2FNPA 3VB2A 4EM0B 1S6LA 1ZRFA 2VONA 1XD7A 4UV8A 3HRMA 3KP4A 3NQOA 1LNWA 2FMLA 4WK8F 1J2XA 4UHTA 1FBSA 4G7ZF 3FHZA 4PZJA 3HRTA 2PFBA 3IWZA 1J0RA 5FGMA 2NNYA 3E6DA 3Q5FA 5HDNA 3COAC 3C18A 3VOEA 3Q9SA 2O61A 4XSZF 1R23A 2A6HF 2QYOA 4KT5C 2OQRA 4MEYF 2P7VB 3ECOA 1SMYF 1WKMA 3RPUA 5E17F 1J9IA 1PP7U 3R0JA 1PP8F 1FYKA 2P5VA 2P8TA 1IRFA 1U5TA 1P4AA 3KEQA 4JBAA 1CF7A 4JK1X 1YO5C 4EV0A 5AONA 5DUIA 3J81K 1KU2A 1HBXG 3SFZA 5HLIA 2IA0A 3KLNA 3NRVA 5JR3A 3LAPA 1WI9A 1A04A 3CDHA 4L9NA 3T8TA 3R6SA 1FZPB 3V8LA 2HYGD 3C7JA 2ZXJA 3TOBA 4M6XA 3WTVC 2P7CB 5E18F 3T8RA 5L3GA 4YFKF 3MZHA 3IKTA 3GVAA 2BYVE 3RDIA 2JPBA 3BOQA 3DP7A 1SD5A 1L0OC 4EJWA 2ZFWA 4EGYA 4GYIA 2HR3A 1I5ZA 1LDKB 2XAQA 1KU3A 1FLIA 1S29A 2FA5A 3L2CA 1S7AA 1KU9A 2Z5UA 4KFCA 2A61A 3BWGA 2DU9A 2DLLA 3MZYA 2XGXA 2AS5F 3ISPA 3EYYA 1O3RA 3HUGA 2VT3A 2G9WA 1XGMA 1ZAOA 3V7SA 1X3UA 3QP6A 4XSXF 1BI1A 2MH9A 1XCBA 1ZLJA 2XIGA 2W85A 3ZPLA 1G3WA 6PAXA 1QO0D 1RIOH 3QPHA 4HQMA 1KGSA 1GHCA 2HTJA 5D5UB 3V8KA 1YS6A 2QUFA 1B1BA 2ZBKA 3L7WA 3VODA 2FOKA 2EV0A 1FYLA 4I7HA 3RI4A 1XGNA 4CHUA 3K1PA 3F22A 1IAWA 5BMZA 3WTUC 1KYWA 1U2WA 5CVUA 3I54A 2AXLA 3J80K 2JZYA 2QENA 5HDKA 4UV9A 2VN2A 3ZN1A 3R4KA 1NHAA 1QGPA 4MNUA 3GFJA 1EH8A 4ZZLA 1IN4A 2D1VA 5CVRA 1G4DA 5J6XA 4UVAA 5ERIA 1FP1D 2EFNA 3E5QA 3FM3A 3HSFA 2K4JA 3DKWA 2CSOA 2IRFG 3P9CA 2K02A 3L00A 1EV7A 5CLSA 3OV8A 1LEBA 1MDMB 1JHHA 5D6EA 4N0BA 1S3JA 4EJTA 4N9IA 4HF1A 2O8XA 3FXUA 3W6JB 4A6EA 2YX4A 2QQAA 1HKSA 2L4AA 1R00A 3L9FA 5D6FA 1BC7C 2KKOA 3KZYA 3FX3A 4M74A 2HOEA 4CGZA 3HTUA 3F21A 1ZG1A 4I09A 4CDGA 5DD8A 4HLXA 2W57A 4AIKA 2E1CA 5LGTA 2CQKA 1ON1A 4OIQF 2P6TA 1ZG5A 1OPCA 1E2XA 2OA4A 2ZNYA 2KIFA 4AD9A 2EV5A 1ZN2A 3LA7A 1T98A 5E8IA 4BYYA 2QZ8A 1TQMA 4E70A 5K1YA 3E6MA 1QZYA 1JE8A 2PLYA 1ZHFA 3M1EA 3S2WA 1H9GA 2EA2A 1XGOA 4YG2F 4EJOA 1O3SA 4R8HA 2UXXA 4S05A 5ICCA 1XSDA 2LF7A 2XUBA 4IXAA 1DPUA 2ACJA 5L3BA 5LBQA 2QWWA 5IT9Z 3KZZA 4ON0A 2FF4A 1AOYA 1STZA 2COMA 1FBQA 4R1HA 4B09A 4M9SA 4LB5A 4M6YA 3KP5A 2E7XA 4L0YB 3IL2A 4XLNF 4IJAA 3E5XA 4IRIA 3KE2A 2CG4A 4A12A 4RAZA 5FLXZ 1J5YA 3F8MA 2PJPA 4DQ2A 5CVVA 3KP2A 4FX4A 2MLGA 2F5DA 3GUDA 3F8BA 1IN7A 2VOOA 3BROA 1TLHB 2O0YA 5L3FA 4HA8A 5H6RA 3LAJA 3EYIA 4L5IA 3GXOA 1BBYA 1SMTA 4P5OA 3F72A 2VBWA 2LDUA 4MQ9F 4XLPF 2ESHA 2H09A 5LEJA 4BH9A 2DQLA 3MCZA 1K78A 3DXJF 2UZKA 3QAHA 2QBYB 2MH2A 4I02A 2H6BA 3WE3A 2L02A 3ABTA 3ELKA 1KQ8A 2EB7A 3K9TA 3VEPA 4PGGA 3MEXA 3JAMZ 1REPC 3E6CC 2ZNZA 2ETHA 1QBJA 2X0LA 4ZYHA 1TQIA 2MD5A 3HTSB 3GLXA 1D3YA 2M30A 2FBHA 4UVCA 2XAJA 4XRFA 1IF1A 5J8FA 4HYEA 3CUOA 3WODF 3TQNA 1O7LA 2XROA 4BHCA 2OZUA 4LLGF 5HLHA 3REOA 2M1BA 5LRSA 5LHHA 2XVCA 4G9YA 3WTWC 3P9IA 1G6NA 2DO7A 2MC3A 2RGVA 2ZCWA 2R3SA 2F5CA 2IJLA 4A2UA 1BIBA 4ZZDA 1BI2A 3HHGA 3R0AA 4MQVA 2GA2A 5D5VB 1MJ9A 3U9GA 4KA4A 2ZJ2A 2FSWA 2V1XA 4RB0A 5FB2A 5ICFA 4A0YA 2A69F 1TW3A 3R60A 1MKMA 5DD4A 4QLCU 3SZPA 2C6YA 1VTNC 2JSCA 3BJAA 3RPQA 3HOSA 3BDDA 5EEHA 1GVJA 3QU6A 2CO5A 1FWZA 4NHJA 2A3SA 2PMUA 1S7OA 3WGIA 2EFQA 2L3DA 2HEOA 2QVOA 5KVRA 2DBBA 3MQ0A 2RN7A 4CZZA 1XGSA 3WTSC 2JRTA 1FC3A 1SFEA 4OIOF 1XSVA 3I0TA 1J59A 4L5JA 1GXPA 3C3WA 2LF8A 1AWCA 3H92A 2IW5A 2CYYA 1B4AA 2CGPA 4Q48A 5DYMA 1J7KA 4WXHA 3GYHX 1R36A 3SHFA 5E1ZB 4IHTA 1W7PD 3KCCA 4I2OA 1OYYA 3GO5A 3IRQA 2OZ6A 4EM1A 3TKYA 3BPVA 1ZLKA 4RGUA 2DW4A 5EEGA 3RIRA 3IRRA 3D0SA 1T0FA 1BIAA 1LDJA 2H94A 5ILSA 1Y0UA 1BJAA 2PG4A 4LJZF 2Q2EA 1HXDA 4KIGA 5E20A 2JTVA 5HDGA 5AIPA 5K5QA 1Z6TA 1XMKA 3GZ5A 5A2QZ 3U2RA 2D45A 3EETA 1BC8C 4BNCA 3I71A 4LLNA 4MEXF 2A68F 4I0AA 2W84A 1YW7A 2L4MA 3F8CA 5F1RA 3CUQB 3M7GA 1H9TA 4A5NA 3I59B 2A07F 2E7WA 3LQRA 2HS5A 2M87A 3RKXA 4S04A 2DK5A 4EMSA 4ETSA 2BBYA 2VC1A 2HQNA 2YPRA 1L3LA 3V7CA 2IPQX 2G7HA 4L9TA 2VBXA 3KP6A 2BEOA 1P92A 2HTSA 2OAZA 1KQ9A 3HSEA 4MGRA 2P4WA 4KNYA 1YIOA 3JTHA 3GEZA 3TO6A 2HKOA 1W5TA 2LKPA 1FPQA 1J75A 5H6QA 2DPDA 2O6GE 5K5RA 3TOAA 2FBKA 4OIPF 3ZMSA 1FP2A 2NS0A 2IA1A 2EK5A 4G7HF 2STTA 1SD4A 4Y17A 2HDCA 4P96A 3EQLF 4GYGA 1Z1DA 1IN5A 3FXQA 4OIRF 3DV8A 1XMAA 4G7OF 3M8FA 2VOPA 2RDPA 2F5EA 5FFXA 4B8XA 2XRNA 3BPXA 3MWMA 1P4XA 1MGTA 1JHFA 1TW2A 1F1ZA 1OYIA 2EA4A 1T39A 2Y0MA 1XDSA 1IUYA 1G3YA 3ZMDA 4EM2A 4UUVA 4ZH4F 3GW2A 5BOXA 2FU4A 3DF8A 3BY6A 4I0BA 5F64A 1V4RA 4CO8A 2IT0A 2VXZA 4LB6B 2HYFA 1SFUA 3CTAA 1WQ2A 1P4WA 4KICA 3K2ZA 1MDMA 2FNAA 5FD6A 1YW9A 1R5HA 1W7PB 3J81Z 5JHUA 4CICA 1DUXC 4Z2YA 4MTEA 2GIVA 4G6QA 1KYZA 3JW4A 4U88A 3WG9A 1MD0A 1IN6A 2O03A 3VFZA 2ESNA 1XSXA 4HDVA 3FM5A 4G6DA 1R22A 3TO9A 3O3KA 1U6GA 3RTRA 3ZP5A 1ZGAA 3ECHA 4ENJA 1RNLA 5E1XA 4Y13A 5HOOA 4RGRA 4NQWA 2CWEA 3WTYC 1ONVA 5K5OA 3SXYA 3HSRA 3IC7A 2PN6A 1OKRA 4IPAA 2H27A 2E1NA 2DPUA 3IWFA 3DFGA 2A5YB 4L9JA 4JQFA 1MJBA 2VBYA 4F7ZA 4ESFA 3SZTA 3WGHA 3D5LA 1F5TA 4P55A 2Y48A 2UWMA 5CJ9A 1R1VA 3QOPA 3TO7A 5LLQA 1USSA 2KJCA 4RS8A 1C0WA 2WV0A 2NAZA 1FSHA 3F8NA 2HGCA 3CUQC 4IF4A 3RKWA 4RGSA 5LHGA 1U78A 4LFUA 3QPTA 5CVJA 4O5VA 4Q47A 1HKTA 1P6RA 4XBFA 3NEUA 5LEKA 5BPIA 1R1UA 2L01A 5D4RA 2RV8A 3AAFA 1G3TA 3HYIA 3WU1B 4WCGA 4PCQA 2NRAC 2CFXA 3ABUA 3JTGA 5JI6A 3K69A 3WU0A 3LSTA 1JXSA 1BOAA 2GXGA 2QBYA 3RYRA 1K6OA 4BAYA 1HW5A 3BZ6A 1HKQA 1Z91A 5IT3A 2NYXA 1R1TA 3J80Z 2XASA 3RKYA 2ADUA 3WTZA 5D8LB 2XAGA 1DDNA 5J8CA 4WF2A 4YFXF 3FXRA 5D5WB 3HHHA 1JGSA 1TNTA 1WWXA 2R7FA 3BJOA 2KJBA 1O57A 5E1WA 1U3EM 1ON2A 2ZMEB 5LHIA 1DP7P 4L0ZB 1UHMA 4A5MA 2JT1A 1I27A 1YG2A 4WXCA 3FF5A 5LGUA 1FOKA 5HLGA 4HQEA 2LSOA 2VE9A 4OOIA 2OBPA 1TBXA 3PFIA 1B6AA 2K4BA 4Y15A 3I5UA 2FXAA 3TDZC 1USTA 2G7UA 2YR2A 1H0MA 4KYWA 4U7DA 2RKHA 1QNTA 2BV6A 4EQQA 4UNOA 2UXNA 3MAJA 2OQGA 4RAYA 2CW0F 2OD5A 2WWYA 1IN8A 4UVBA 5DCFA 3E3VA 2PQ8A 3QP5A 3T0YA 4A0ZA 2VE8A 3F3XA 3KP3A 4HX4A 1K79A 3KLOA 1B59A 5ILVA 4ENMA 3HRSA 4CYDA 5CYVA 3SQNA 1EH7A 5L3CA 3P9KA 1LQ1A 3I64A 2EWNA 1QZZA 2B0LA 3FMSA 3DPLC 2MA3A 5FFZA 2W24A 4OINF 4MHGA 1MZBA 4LGWA 2DFIA 4Q4ZF 2ISYA 3LA2A 2WC2A 3TDUC 1IXCA 3FMQA 1IZ1A 2PBIA 3DQVC 3G3ZA 4O6JA 1HW2A 2KRFA 3BJ6A 4WX9A 2RNJA 1D5VA 4D0PA 1HSTA 1OYWA 4OU0A 4IRGA 2OU2A 1LEAA