4ZYDA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
LVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPAHRVIAENGIGGYSRGVKLKRALLELEGVKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 38
structure length 149
sequence length 149
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zydA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zydA01
3FHZA 2X4HA 2HYFA 3P9IA 3WGIA 3R0JA 4I98B 3KEOA 2MLKA 4FHTA 4P55A 3J80Z 3BPXA 4M71A 2XROA 4HF0A 3TOBA 1QNTA 3F72A 2LF7A 2FRHA 3HSFA 2UWMA 1KYZA 4ASNA 1B59A 3ABTA 2V1DA 3RPUA 3TGNA 4HDVA 4KMFA 1IF1A 2WV0A 3SXYA 4ZZDA 5DCFA 2CFXA 2V79A 4MQVA 5DD4A 5ICEA 4MEXF 1V4RA 3IC7A 4JBAA 1MGTA 4M6YA 5CVIA 3IRQA 4RB3C 5FFXA 2QYOA 1FX7A 3RKYA 4EJTA 5CJ9A 4Y13A 4ZYDA 5K1YA 1FLIA 2O0YA 3IKVA 2G7HA 3MWMA 1B9MA 3GXOA 3I54A 2Z33A 1O3TA 4OMYA 3ECOA 1BC8C 5L3DA 1KU9A 3TDZC 3R60A 4BHCA 3G3ZA 4I02A 3VODA 3JAMK 4KFCA 4EJUA 3V8LA 1PDNC 1ZGAA 3ABUA 3H92A 1HKTA 1W4MA 5E20A 3QPHA 4LG0B 2ZJ2A 1K7AA 1XDUA 4LK1F 3DEUA 5AIPA 2VE9A 4ZH4F 1FP1D 2P7CB 2GQQA 2V6CA 2QBYB 5F1RA 2JSCA 5IT9K 2FA5A 3T0YA 4M9XA 2HTSA 1W5SA 4L0ZB 2MH9A 1UHWA 5HDGA 4KIBA 1LDDA 1O57A 1QO0D 1T2KA 1XSVA 2OZUA 1F5TA 3F8BA 1P4XA 1R7JA 1BI3A 5ED4A 1FY7A 3WTYC 1H9TA 4Q48A 2ETHA 1SAXA 3ZN0A 4UV8A 1WRJA 3R6SA 2DU9A 1BM9A 3C18A 4CICA 2D1HA 3CUQC 4KA4A 3VOEA 5ILSA 5D5VB 1U5TA 2PLYA 2BGCA 2KJBA 5LLQA 4GO1A 1XGSA 4IXAA 4ESFA 2HR3A 2D2WA 5FFZA 5K5RA 1F9NA 1U5TB 4EGYA 4UV9A 1MJBA 2DW4A 1BN5A 1R58A 1YS6A 2VE8A 1XB4A 4HX7A 3GLXA 4KDPA 5JFRA 3QOPA 2DTRA 2JRTA 5DUKA 1FNNA 1EV7A 2R7FA 2ZNYA 5CVUA 1GHCA 1TBXA 5LEJA 3LA7A 1JE8A 2QVOA 1R5HA 4M9SA 1KQ8A 1ON2A 4HYEA 5TJJA 1FWZA 1KQ0A 2HWVA 5HVQC 4BHBA 2K7LA 2E7WA 2DLLA 3E3VA 4G9YA 1FSHA 1BIAA 3NQOA 1G3TA 2EFOA 3E6DA 3LAJA 1G3SA 3R4KA 3KP3A 5CVRA 2PG4A 2DO7A 1XSDA 4BAYA 3KP2A 1YG2A 2F5EA 3CUOA 4LJZF 1X3UA 1J9IA 3R0AA 1JXSA 1QZZA 3F8NA 4KN4X 3KP5A 3VEPA 1EH8A 5LGUA 4UUVA 3CO7C 1IN4A 3WTTC 4MNUA 3WU0A 3HOTA 3K69A 3L00A 4HZFA 4IJAA 4I7HA 1H0MA 5L3EA 2OZ6A 4A5NA 5A2QZ 1U2WA 3IRRA 2A69F 4NHJA 1PP7U 1DPUA 1Q1HA 3IWFA 3J7AO 5LGTA 1FYKA 3TO9A 2O03A 1P4WA 3N97A 2DT5A 3DKWA 2FBKA 4Q47A 2FF4A 1LQ1A 4PDKA 1R1TA 1HBXG 3RYPA 1J7KA 1G6NA 5D5UB 3K1PA 1Z7UA 4U7DA 1E17A 1R1UA 1BI2A 2F5FA 3QP5A 4I0AA 3HIFA 4DNCA 5BS6A 2MA3A 3DFGA 3GW2A 2V9VA 1I5ZA 1SD7A 2Q0OA 2IW5A 3E97A 5AIQA 5J8CA 4ESBA 1T0FA 1MJAA 1HQCA 4U88A 4LK0F 2FE3A 3MQ0A 4I09A 3JSOA 5CVVA 5LGNA 1LNWA 2XHKA 2D45A 2LKPA 2DBBA 4CZZA 3ZMUA 2RDPA 4PCQA 5A2QK 1E2XA 2G9WA 3FF5A 1TNTA 2Y75A 1G3WA 4AWXB 4OIOF 5LBQA 4WXCA 2EV5A 2B0LA 1HSTA 3ZMSA 4P9UA 3HRUA 4LMYA 1IN7A 3ZMVA 4WX9A 2ZXJA 1LEBA 4RAZA 2V1XA 4A2UA 1REPC 2FEZA 1JGSA 2QWWA 3H3ZA 3GEZA 1RZ4A 2VBXA 3JAMZ 4HX8A 1R23A 2P5KA 4DQ2A 4A0ZA 2XAJA 3BP8A 2F2EA 1K78A 4OINF 4P9FA 1D3YA 3BDDA 5HOOA 3DPLC 1U5TC 5E18F 4HAMA 4XLPF 4XBFA 2D1VA 3LQQA 2RV8A 2ZFWA 2EB7A 1D5VA 4K2EA 1LEAA 2IT0A 3F6OA 4UVCA 3I58A 2XAHA 2QQBA 1FBSA 4M9ZA 5IT9Z 2P5VA 1FYLA 3LA3A 4AIHA 1YTYA 2BE5F 2RN7A 2WTEA 3CDHA 3ULQB 4A12A 5J6XA 2BYVE 1L0OC 1ZRCA 3KP4A 3IHUA 4WCGA 2HTJA 2XAQA 1QZYA 4PZJA 5FLXK 1HW1A 2P4WA 4BXUA 5FO5A 3MAJA 3MZHA 3SZTA 1IN6A 1TQPA 5HLGA 1AOYA 3WTWC 3V7CA 5E17F 5BMZA 2FXAA 2HS5A 2LF8A 4HA8A 2OQGA 2EWNA 3JTHA 2PN6A 5LHHA 3IWZA 1KYWA 1S29A 2NNYA 1UHMA 2IA0A 2CO5A 4PGGA 2RGVA 1O7LA 2OA4A 1CF7B 1ZLKA 3FXUA 2QLZA 4OIRF 2V1UA 2PMHA 2CSOA 4NQWA 4U0WA 2FQ3A 3TO6A 3RTRA 2EK5A 1V3FA 1J2XA 3W6JB 2K02A 3ZMDA 4YFKF 2FNPA 1USSA 1Z6TA 3QP6A 4I01A 2VBWA 3I59A 3F23A 2XKOA 1FT9A 1LJ9A 3P9CA 1TW3A 4Q4ZF 2RKHA 2W84A 1A04A 4EM1A 1IXSB 2O3FA 2XAFA 1ZN2A 2XV4S 3WU1B 1I1GA 3P7NA 4EJVA 2QQAA 3D0SA 4FX0A 3TOAA 1AWCA 1R36A 4IRGA 2K86A 4WXHA 3I53A 3HTSB 4IHSA 2RNJA 4HV5A 3GX4X 2ZNZA 1D8JA 3LWFA 1OYWA 4AD9A 1ZLJA 5F64A 4RGSA 3C1DA 4M74A 5EEGA 1ODDA 1OMIA 3FMSA 3VB2A 2FU4A 2ZBKA 5FGMA 5ICFA 4A0YA 2O8XA 4AIKA 1SMTA 1TQMA 4EVIA 5FD6A 1IXRC 1YW7A 3WGGA 1RIOH 5L3GA 5HDKA 4OMZA 1RNLA 1OYYA 4MHGA 4ENKA 3ZMTA 3BROA 2QM3A 1FBQA 3TQNA 4XSZF 3U1DA 1U8RA 2Z5UA 3F3XA 4YIIA 1UCRA 3H3UA 3ROUA 4BQAA 1U6GA 1BIBA 2JPCA 4KYWA 1UB9A 2HKXA 5HDNA 1XGNA 5D5XB 2E7XA 2STTA 2A07F 2M1BA 2FNAA 5E1XA 4RGXA 5AONA 4ENMA 4QWQA 2GZWA 4UNOA 3KE2A 4I0BA 1IAWA 2JZYA 1W7PD 4U7BA 4LLNA 5BPDA 1XN7A 2KIFA 4G94A 3FWEA 4HW0A 4B8XA 3I71A 4HQEA 4HV6A 2YPRA 3K1NA 5BOXA 1OPCA 1HKQA 1K6OA 2KKOA 4ENJA 2O61A 2Y48A 3O3KA 2P6TA 1O7FA 3K2ZA 1GVJA 1Z6RA 4ZZLA 2IVMA 4CXFA 3HHGA 5D4SA 2NS0A 3TKYA 1ON1A 1S3JA 4G7HF 1GXPA 1J5YA 3G73A 5FLXZ 5D4RA 1HSJA 1BI1A 4L18B 5TRDA 2F5CA 2C6YA 1VTNC 5IT3A 2P8TA 4BH9A 2MLGA 4Z2YA 2H94A 2QBYA 1UFMA 4L9VA 4XSXF 3T8RA 3S2WA 3RPQA 5HS8A 4WF2A 2NRAC 1MKMA 3K0LA 2M87A 2W25A 1TW2A 4EGZA 4LB6B 2W24A 2UXNA 5FD5A 4A0XA 3GFIA 1WKMA 2P6SA 4RGUA 5H20A 3NEUA 4M6XA 4NB5A 4A5MA 2IA2A 1ZARA 2HEOA 3SHFA 4L9NA 1I27A 2XRNA 2A5YB 1W7PA 3JSPA 4KMUX 3OV8A 2JT1A 1ZH5A 1XMAA 4A6DA 2ZKZA 2HQNA 1JHFA 2LNBA 1XGOA 3EQLF 4YFXF 2UXXA 1O3QA 4B09A 3DQVC 3V7RA 3W6KB 5E1ZB 5D8KB 2HGCA 1XMKA 4CHUA 5D6FA 2DAOA 2W57A 2ESHA 4LG0A 1H9GA 2A61A 1MZBA 4AVPA 3KFWX 1K78B 1OYIA 3O6BB 3GWZA 4EV0A 2DPUA 5LHGA 5L3BA 1BBYA 2ADUA 4RGRA 1WI9A 3QAHA 1YFHA 1FYMA 3PFIA 3T1BA 4HQMA 2MH2A 2P5LC 4YFNF 1TTYA 4GYGA 2LDUA 4EJWA 1R5GA 3LFKA 3ECHA 1R22A 2X0LA 1J0RA 3BJ6A 4BYYA 3GUDA 4KT5C 4KN7X 2M45A 5FB2A 3FMRA 3GZ5A 4N9HA 1KU3A 1P92A 2L02A 1GXQA 3BY6A 2O6GE 2KJCA 4OIPF 1TNSA 3WTZA 2KIMA 4OIQF 4ZYHA 4KICA 1SD6A 4O6JA 3F22A 3IKTA 4MEYF 3ZQ7A 3KZYA 2PFBA 2Z9OA 2K4JA 4Y15A 4KIFA 3DXJF 5HLHA 5HLIA 2ESNA 4CYDA 1NHAA 3LA2A 3Q5FA 3F6VA 1YS7A 2EJRA 3QPTA 1OR7A 5ILVA 5L3FA 1OKRA 1SMYF 2GWRA 4GYIA 1CF7A 2E1CA 2E1NA 2IJLA 1SFXA 3O2PE 4OU0A 1MDMA 2Y0MA 3N4MA 1FC3A 1R00A 3COAC 2PJPA 3DF8A 4RB0A 4GCVA 5KVRA 3I59B 1BJAA 1P6RA 1P4AA 3F8FA 2DI3A 3J81K 1QPMA 2NNNA 2XAGA 3I5UA 3PQJA 1R1VA 2ISZA 2XUBA 1BOAA 3EYIA 2A6EF 2H09A 3ML6A 4LGWA 1KU2A 2BEOA 3IL2A 3WODF 2HQRA 2UZKA 3V4GA 4HOBA 2VOPA 3E6CC 1LDJA 2MBFA 5DYMA 2HDCA 4HBLA 1O3SA 4TV7A 3M7GA 5EEHA 4RAYA 1IXCA 3SFZA 1QBJA 5LRSA 3GVAA 2HZTA 3KCCA 2PBIA 3E5QA 3WE3A 3KP6A 3FMQA 2K27A 3M8FA 4M72A 1HXDA 2L4MA 4PGHA 2PI0A 3EYYA 3LAPA 4ENNA 1K79A 5LRRA 1I6XA 2FBIA 2RVCA 4I2OA 1YW8A 2RQPA 5E1WA 3T5XA 3GF2A 3E6MA 4G6DA 5KK1A 4U0YA 5D6EA 3CLOA 3R61A 2ZO4A 4ETSA 1Z9CA 3V8JA 2OQRA 3I64A 4L5IA 1B6AA 4QLCU 4ESJA 2EFPA 3L9FA 3M9AA 1FSEA 3E5XA 2ZMEA 5JR3A 2H27A 3DPTA 2GXGA 5BPIA 1DP7P 1S6LA 2A68F 5JHUA 1W7PB 5DCMB 4RS8A 3WG9A 3C7JA 3FM5A 3F8CA 5H6RA 4RB1A 4R8HA 4LLLA 2DPDA 2L54A 5J8FA 1SFEA 2COMA 2J5PA 3HYIA 3L7WA 1BC7C 1IRGA 2L4AA 4CGZA 2ZMEB 4IVNA 4G6QA 4WXDA 3CJNA 2VC0A 5E8IA 1JHHA 3E5UA 4ZYGA 3HTUA 5ICCA 2KRFA 4LD5A 3REOA 3HRSA 5K5QA 5CYVA 2AXLA 3GYHX 1DUXC 3HRMA 3WTXC 2RC4A 1XGMA 1P2FA 2JTVA 3KLNA 1MJ9A 3JTGA 2A6HF 2IA1A 3OOPA 4UVBA 2ELHA 1IW7F 2IPQX 1D8KA 1WWXA 2R3SA 4EQQA 3GFMA 5E8GA 2XASA 4U0VA 2F5DA 3KP7A 2HKOA 4IRIA 2YX7A 1KGSA 3Q9VA 2CWEA 5BQTA 1ZRDA 3D5LA 1YLFA 3L09A 2VBZA 1FOKA 4AIJA 4LB5A 2A3SA 2WWYA 1B1BA 3CUQB 4ZYEA 4E70A 1KQ9A 4G7OF 1ONVA 3HSRA 2CGPA 5DUIA 2FMLA 2GA2A 3QU3A 2H6BA 3K9TA 2OAZA 2HFHA 2OBPA 3MEXA 4HLXA 1WQ2A 4S04A 4GXOA 3C3WA 1XDSA 1T38A 3K1MA 1KU7A 1T98A 2IRFG 1ZAOA 3F8MA 1IN8A 3GZ6A 2EA2A 3BJAA 3WE2A 1G4DA 4IPAA 3SQNA 4A6EA 5DCMA 3RKWA 1S7AA 3WGHA 5JVTA 4MTDA 3RDIA 3U2RA 1L3LA 2GA1A 2GIVA 3BJOA 3DV8A 2BBYA 1ZG3A 2VXZA 3V8KA 3HSEA 1CGPA 4KUMA 3M8EA 4H0EA 1XCBA 2NYXA 4Y17A 3HUGA 3J81Z 1SD4A 2M30A 1IRFA 1ZG5A 4KNYA 1J59A 1F1ZA 3KZZA 1Z05A 2QQ9A 4OOIA 2EFWA 3ISPA 3U9GA 3WTUC 1SFUA 2P7VB 4UVAA 2OD5A 5CLSA 2XIGA 5JI6A 5ILUA 2XVCA 1ZYRF 2HYGD 1T6SA 1DPRA 1EH6A 1I1SA 1ULYA 4HDUA 4ON0A 5D5WB 4FT8A 1WSUA 3MFKA 1XCVA 3RKXA 1FBUA 3NRVA 1C0WA 2PQ8A 2K4BA 3B02A 2Q8KA 4LFUA 4HLYA 5DDGA 3ELKA 3Q9SA 3HHHA 4P96A 1ZGJA 2QZ8A 2KIUA 3T8TA 2DQLA 2XKPA 1LVAA 3GFJA 4BHPA 1ZG1A 2FMYA 2EV0A 4LLGF 3FZVA 4CDGA 3J80K 1DDNA 2FOKA 4S05A 5H6QA 1ZREA 2H6CA 2CQKA 1QGPA 1YO5C 3BZ6A 1FPQA 1PUEE 2LSOA 1B4AA 2XGXA 3KLOA 4GGGA 3F21A 4JK1X 3SZPA 4MTEA 1STZA 5DD8A 2ISYA 1ZRFA 3EETA 3QU6A 3EDPA 2VC1A 4G8XA 1Z91A 3HRTA 5LHIA 1SD5A 6PAXA 1PP8F 2MD5A 3RJPA 2QENA 5HS9A 1LB2A 2CYYA 2STWA 2CG4A 3RYRA 3P9KA 3RI4A 3WTSC 5ICGA 3ZPLA 1QQIA 2MC3A 2ZCWA 3CTAA 3JW4A 1XSXA 4HF1A 5ERIA 4HF2A 2AS5F 1HW5A 2CW0F 4Q5SF 4R1HA 1W5TA 1FP2A 2EFNA 3B73A 3RIRA 4YG2F 5L3CA 4L9JA 4EM2A 1U3EM 5LEKA 2EA4A 3MZYA 1HKSA 3AAFA 2IP2A 5CVJA 5DV5A 4UHTA 1USTA 2TDXA 4HX4A 2DQRA 2J5OA 2YSRA 5HS7A 3FXQA 1J75A 1YQAA 4L9TA 1TQIA 1LDKB 3I4PA 2Z3YA 2QUFA 4EMSA 2VN2A 1G3YA 2Z99A 4KIGA 3E6BA 4MQ9F 3LQRA 3HOSA 5DEQA 2NAZA 4MGRA 5K5OA 3TDUC 2PMUA 2YX4A 3I0TA 1Z1DA 4XRFA 2ACJA 4WK8F 4O3MA 4L5JA 1FZPB 3V7SA 1ZHFA 2EFQA 3LSTA 4JQFA 3BWGA 2GAUA 5F6FA 2G7UA 4BNCA 4L0YB 1YYVA 3PQKA 3KETA 3CO6C 3BOQA 3WTVC 1U78A 3TO7A 2YR2A 2R7DA 4WWCA 3MCZA 4YIFA 2L3DA 2WC2A 4P5OA 3CUQA 3ZN1A 1YW9A 2DK5A 1O3RA 1B9NA 2DK8A 1MD0A 3FM3A 1YIOA 2M8EA 2W85A 1RUNA 2HOEA 2Q2EA 3FX3A 4EJOA 2FSWA 1KA8A 2PEXA 2JPBA 2L01A 4FX4A 1EH7A 1TLHB 3L2CA 4G7ZF 3ZP5A 1IUYA 2M5WA 4M73A 1HW2A 4XLNF 1RUOA 2VOOA 4RB2C 1RI7A 4EM0B 1IN5A 3M1EA 2VT2A 3BPVA 3ERED 4CO8A 3DP7A 3VFZA 4O5VA 1T39A 2OU2A 1S8NA 4IF4A 1IZ1A 3GO5A 3EUHA 2YU3A 2FBHA 3QRFF 2VT3A 2BV6A 1Y0UA 2DFIA 4D0PA 4N9IA 4IRHA 1BI0A 4R79A 2VBYA 5D8LB 2VODA 4N0BA 3FXRA 4F7ZA 1F4KA 1S7OA 2EV6A 3GFLA 3ZMZA 1MDMB 4IHTA 1XD7A 3KEQA 4UXNA 2GXBA 2VONA
chains in the Genus database with same CATH superfamily
3FHZA 2X4HA 2HYFA 3QPSA 4DR3E 4LF7E 1SVOA 2DOEA 3P9IA 3WGIA 4WFTA 1TT5B 1X4PA 3R0JA 3KEOA 4I98B 2L8TA 1DGWY 2OV7A 2UXCE 3BQZA 2ID3A 3L2RA 3OIQA 2MLKA 4JX4A 4G6TB 4FHTA 4P55A 5C3EJ 2EPZA 2B9SA 4F6NA 1K6YA 4Q28A 3WHBA 3AKZA 3J80Z 3BPXA 2R7OA 4CCNA 2CFOA 5J40A 5IOZA 1Y8RB 1UILA 3A2KA 4M71A 2XROA 4HF0A 3TOBA 1A1KA 1XPXA 1QNTA 3F72A 3FK7A 2VPLA 2LF7A 2XF5A 1FOYA 1Q1VA 2FRHA 3HSFA 3PSIA 2CV2A 2JXPA 2UWMA 9ANTA 3KYCB 1KYZA 4ASNA 4QTRA 4XNFA 3OS2A 2H1LA 1B59A 3ABTA 4AIDA 2V1DA 3RPUA 3M3YJ 2DSYA 3SJMA 3TGNA 4HDVA 4KMFA 4KJZA 1IF1A 1T0FC 4GKKE 2WV0A 2PRTA 4LG3A 3Q3SA 2EM6A 2EMYA 2EMGA 1SC7A 3SXYA 3SFIA 4ZZDA 4WPYA 5C4JJ 2HOTA 2MGQA 2R5YB 5DCFA 1O0WA 2CFXA 2V79A 3LSGA 4MQVA 5DD4A 3J7ZI 5ICEA 5F0HA 4MEXF 1V4RA 3IC7A 4JBAA 1R4NB 2BHYA 2EOMA 1MGTA 2K7IA 4DIQA 4M6YA 1X19A 2FJ1A 1A31A 3B6CA 5CVIA 1K61A 2E5LE 3IRQA 1HNXE 5IP9J 4RB3C 1BB8A 3BG6A 1VQKI 2EOXA 5FFXA 5ADZA 5EDNA 3E7LA 5HLTA 2FTXB 3PFYA 1X58A 2LYCA 2QYOA 4RDUA 1D1AA 3CMAI 4MLQA 1FX7A 2EN2A 1UMQA 3RKYA 3ERMA 3OIPA 1M1EB 2DA5A 3ONQA 4EJTA 5CJ9A 4Y13A 4BQQA 2LUPB 4RA2A 2X9DA 4ZYDA 5K1YA 3EPKA 1FLIA 1JJ6C 1PUFB 4JX5A 2O0YA 2IS6A 2Z1DA 3IKVA 2G7HA 3MWMA 2UUCE 1B9MA 3GXOA 1RETA 3I54A 2O8KA 2Z33A 2LUQA 1O3TA 4OMYA 3ECOA 2R93J 1BC8C 2M0MA 4PFPA 3VYXA 1B69A 5L3DA 1VQNI 4IKFA 1N33E 1KU9A 3TDZC 2DA6A 1VQLI 3R60A 4XN3A 4BHCA 3A0BC 1ETYA 3G3ZA 1TZLA 2OC6A 4I02A 3VODA 2GPIA 2YUSA 3JAMK 2DMIA 5E79C 4KFCA 2VKHA 3HGGA 3CCVI 3GLLA 4EJUA 3V8LA 1L4SA 2JA5J 2WAQA 5LFAA 3HKZA 1TT0A 4JI5E 1U9OA 2WY7Q 4NXME 1PDNC 1MBGA 1ZGAA 3TP0A 3ABUA 3DF6A 2JOBA 3H92A 3LSRA 1HKTA 2X6OA 1AHDP 1W4MA 3C2BA 5E20A 5J1RA 3FK6A 3B6AA 3VYYA 1ETWA 2XF6A 4UUTA 3QPHA 1P7JA 4MO7A 4LG0B 1K83J 2ZJ2A 2V9PA 2HPMA 2E2HJ 2ZJPF 3H09A 1K7AA 1HA8A 1XDUA 4LK1F 1TP4A 3DEUA 4XM3A 1X3ZB 3P5JA 5AIPA 2VB6A 2VE9A 5IOYA 4ZH4F 2NVTJ 1FP1D 2F4IA 2L7FP 2EL4A 1HOMA 4ITVA 4AQYE 1N25A 3CCUI 2P7CB 4R2AA 3CMEI 1WGXA 2GQQA 2NS7A 2V6CA 5J4VA 1A36A 2EPKX 5KL6A 2QBYB 5F1RA 2JSCA 5IT9K 4OWRB 2CV1A 1YYKA 4BY7J 2FA5A 1ZQ3P 2W00A 2CJJA 3H9JA 3T0YA 4M9XA 5JVGF 2CQQA 2HTSA 4ZTJA 1ZU1A 4A3IJ 1W0TA 2EQ3A 1W5SA 2L9SA 2DFFA 4L0ZB 2MH9A 1UHWA 5HDGA 4NZVA 3S3NA 4KIBA 1LDDA 3S2DJ 1Z21A 1O57A 1QO0D 1T2KA 1XSVA 2DA7A 3BZKA 4F6MA 2YPNA 2OZUA 1F5TA 1SEUA 5M3MJ 1W0UA 2EOSA 2BW3B 3F8BA 2KONA 2B9DA 2UXDE 1D0ZA 1P4XA 1R7JA 1BI3A 5ED4A 1FY7A 3HPHA 2KRHA 3WTYC 2QF7A 2LOOA 1H9TA 4Q48A 2R1FA 2ODRD 2ETHA 3PM1A 1SAXA 3ZN0A 2GXAA 1D0XA 1JUPA 4BXFA 3VYUB 3OY9A 3ECRA 3OL3A 1YJ9I 4UV8A 3BG9A 1WRJA 2LV2A 1DGRM 3R6SA 2DU9A 1BM9A 3C18A 4CICA 4X64E 2D1HA 1IDYA 2MC5A 2N3HA 4LF8E 1SFOJ 3CUQC 4KA4A 3A1YA 1VQ7I 2DLKA 3VOEA 5ILSA 5IYCJ 5D5VB 1U5TA 2TRTA 2R5ZB 4BEHA 2PLYA 2BGCA 2KJBA 4J8ZA 2N8XA 3M1CA 5LLQA 4GO1A 4CCKA 1XGSA 2L92A 4YIRX 4C2UA 4IXAA 4ESFA 3PSFA 2HR3A 3OYHA 2I5UA 2RS6A 1RESA 4IX7A 3SZGA 2D2WA 2FV4B 5FFZA 5K5RA 2UU9E 2BOLA 3BG7A 2F4MB 5CQGA 1F9NA 1U5TB 4A3DJ 2VF1A 1V5EA 4EGYA 2M7QA 4JI7E 4UV9A 2GOXB 4XICA 1MJBA 1PJSA 1IMUA 2DW4A 1BN5A 1R58A 3ZQCA 1YS6A 2VE8A 2Y9ZA 2HDWA 1QPIA 1XB4A 2LREA 3RQIA 3HPZA 1TF3A 3AL0C 1Y6IA 3TEDA 4HX7A 3GLXA 4KDPA 3MD2A 4BJ5C 3FXMA 3QOPA 2DTRA 5JFRA 1IGNA 4IHWA 2IXSA 1BJZA 3CESA 2JRTA 5DUKA 1FNNA 2KHXA 3S3OA 1EV7A 2YRMA 2KDOA 5FKKA 2JVGA 1MBFA 2NUEA 1WJDA 3MKWB 4Y3OA 2R7FA 2L9NA 4DR1E 2RS7A 3MHSC 2ZNYA 4XONA 1KZHA 5CVUA 4XKWA 1GHCA 3ZQHA 1TBXA 5LEJA 3LA7A 1JE8A 2DA1A 2QVOA 1R5HA 4M9SA 1OCPA 1KQ8A 1ON2A 4XLEA 1G2HA 1VQ8I 4HYEA 4IHYA 1GQEA 5TJJA 2JVAA 4DMIA 3HBLA 2EN3A 1FWZA 1KQ0A 2HWVA 5HVQC 5CKTA 2RQQA 4BHBA 2K7LA 2E7WA 4LITA 3QYFA 2DLLA 1X1AA 3E3VA 3BQYA 1ETKA 2LR8A 4G9YA 1B8IB 1FSHA 1BIAA 2BBGA 3NQOA 1G3TA 1N75A 2YTGA 2EFOA 4DUZE 3E6DA 3W2WA 4R2PA 3LAJA 3TQMA 2A05A 3PJRA 4BE1A 5E3MA 1G3SA 3R4KA 4GFBA 3KP3A 5CVRA 2PG4A 2L2MA 3LSPA 3EPHA 2DO7A 1XSDA 4BAYA 4D5CA 3KP2A 3TL4X 1SFKA 1WJEA 1YG2A 2F5EA 4IOAF 3CUOA 4LJZF 1X3UA 2EOIA 3H5NA 1J9IA 3R0AA 2OTLI 1JXSA 5LMNE 1MH4A 1QZZA 3F8NA 1IO2A 3CCRI 2EINH 4KN4X 4AYBA 3KP5A 4BACA 2Q8UA 3VEPA 2R7UA 3G1LA 1EH8A 5LGUA 2EM2A 2Y0SN 2L5QA 3BR0A 4UUVA 3ADGA 3OYGA 1FOXA 1D5YA 2V6EA 4X62E 4ZJZA 4EATA 4A3FJ 5AE1A 1X47A 3CO7C 1IN4A 3WTTC 4B1RA 2W48A 3CP8A 4MNUA 3WU0A 3HOTA 2LVHA 2LY1A 3K69A 1A6QA 2AQFA 3L00A 3S14J 4HZFA 4C3JJ 5IWAE 4IJAA 2LFBA 3CP2A 4FETA 4I7HA 1H0MA 5L3EA 1TWCJ 1G59A 2OZ6A 3OWTA 1TWHJ 4DV3E 2XSDC 1IRXA 4A5NA 1LE8B 5A2QZ 4JI1E 1U2WA 2Z2SB 1B72A 1IJWC 4II3A 1DU6A 2E71A 5A6KA 3IRRA 2A69F 2VIXA 4NHJA 1GZ6A 2NUFA 4IS1C 1PP7U 2QKMB 1DPUA 1WH7A 2EIJH 3F0CA 1Q1HA 1R9TJ 2M7BA 3IWFA 3J7AO 2GOMA 5LGTA 1FYKA 1WZ2A 4DV2E 1G2DC 2ELKA 3TO9A 4FE7A 2O03A 1P4WA 3N97A 4PJ0C 4YELA 2WZOA 2DT5A 2VJIA 3DKWA 3VSLA 2FBKA 1VFCA 3RQ4A 4Q47A 3GTOJ 2CUJA 4M6VA 1K4TA 2LG4A 1MEYC 2FF4A 2ENCA 2EPUA 1LQ1A 1DGCA 2LBFB 4PDKA 1R1TA 2DDBA 1GV5A 4BBSJ 3TBIA 3WG7H 5A2QC 1YOVB 1HBXG 4M30A 3HOZJ 1X4OA 3HOXJ 3RYPA 2JA8J 4ZDOA 1J7KA 1G6NA 2MABA 1T4LB 1FOWA 1SANA 3BCBA 5D5UB 4S0HB 2V86A 1XMQE 1BBGA 3K1PA 2EN6A 4E4HA 1Z7UA 3LNQA 2JJ7A 4DW6A 4U7DA 1E17A 1R1UA 4Y52J 5K7HA 1BI2A 3BG5A 2F5FA 3K4NA 3QP5A 4I0AA 3HIFA 4DNCA 5BS6A 2MA3A 3DFGA 4M3EA 4NNJA 3GW2A 2V9VA 1ETOA 4ZDPA 1I5ZA 1SD7A 2Q0OA 4B4CA 3NAUA 1CQTA 3CC4I 2IW5A 3E97A 4IZZA 5AIQA 4DV0E 4A3GJ 2R7QA 1MNMC 4CUGA 5J8CA 2LO3A 4ESBA 1OISA 1NH3A 3PNYA 1T0FA 1R71A 1HC8A 2MC6A 2ZJQF 1A1GA 4B3SE 1MJAA 5F04A 1HQCA 2B7EA 4U88A 3K70D 3OR2C 4LK0F 2FE3A 3MQ0A 4I09A 3VSKA 3C2GA 5CVVA 5FKNA 3JSOA 1ZELA 3A01B 4ZYAA 5LGNA 2KP6A 1LNWA 2XHKA 4C2MJ 4LIUA 4NC6A 5E3NA 2D45A 2EOFA 1A1IA 3Q0UA 2LKPA 3GBGA 2DBBA 2L9VA 1FIAA 1PKPA 3K10A 4CZZA 3ZMUA 2RDPA 4PCQA 5A2QK 3HUGB 3M8JA 2EMHA 4V19K 1E2XA 2BHZA 2G9WA 1TN9A 3FF5A 1TNTA 2MKDA 5A6BD 1E3OC 2Y75A 1G3WA 4AWXB 4OIOF 3SEZA 3BR6A 5LBQA 4WXCA 4DGWB 3HKZN 2LVSA 2EV5A 1JUMA 1HSTA 2B0LA 3ZMSA 4P9UA 2BY2A 1T8IA 1GDTA 5M5XJ 3HRUA 1OR7C 4DV4E 4LMYA 3OTOE 1IN7A 3IWCA 1ACIA 5BNGA 3ZMVA 4WX9A 2ZXJA 2VQFE 1LEBA 2CQXA 1TWGJ 2EN7A 1T33A 1J09A 2LRDA 4HRIA 3CF2A 4RAZA 4KZSA 2V1XA 4ABZA 4A2UA 1REPC 2FEZA 1JI8A 3BGHA 1NTCA 3C4TA 1A1LA 1YRNB 1JGSA 2QWWA 2L2OA 3H3ZA 3GEZA 1RZ4A 2VBXA 4E7KA 3JAMZ 4HX8A 4TUGA 1YPNA 2ZB9A 1R23A 2JUGA 2P5KA 1Z0XA 4DQ2A 2DMTA 2IS1A 2R92J 4DV6E 1YYWA 1G2FC 3K4MA 3S8PA 4XLHA 2LTPA 1B72B 4B44A 3LFUA 4A0ZA 2XAJA 4QPQA 1LFBA 2W82A 2VXDA 2X1DA 4BDZA 3BP8A 2F2EA 1K78A 2DMPA 4OINF 4P9FA 1VQ6I 2BW3A 1D3YA 2HXIA 1PJTA 2EMKA 3BDDA 5HOOA 3KWRA 2K9SA 3BTIA 3DPLC 3SDBA 1U5TC 5E18F 4HAMA 5TISC 5IPAA 4R2EA 4CYCB 4XLPF 4XBFA 2D1VA 3LQQA 3A03A 1MMDA 3OYKA 3VHTB 2RV8A 1S72I 2EPXA 2ZFWA 1QHHD 2EB7A 3ZQLA 4RM2A 3DLLF 1D5VA 2ENAA 4K2EA 1LEAA 3ZRGA 2E1OA 5EJCA 2IT0A 3F6OA 2LBFA 5AE2A 4UVCA 2EOQA 2V87A 2LCEA 1HDDC 4NHRA 1H8AC 4X65E 1F2IG 2IGMA 2VQCA 3QODA 3JRAA 2A6TA 4B3XA 3I58A 4R2DA 2XAHA 2QQBA 5IP6A 3MSWA 1YE9A 1FBSA 1OLTA 1UELB 2GIZA 4M9ZA 5J4YA 1IQSA 5IT9Z 2P5VA 1FYLA 1R49A 2UUAE 2CUZA 3LA3A 4A3EJ 4AIHA 5DS9A 1YTYA 1Y0NA 4DYCA 2LY2A 4DV7E 2KLOA 3H0GJ 1I3AA 2BE5F 2RN7A 2R5YA 1Y1WJ 2WTEA 3CDHA 3LSKA 3ULQB 4XLCA 4A12A 1HCRA 5J6XA 5T6JA 2BYVE 1L0OC 3F6HA 1ZRCA 3S32A 2WB1A 1EA3A 1Z77A 4ZTFA 3KP4A 2NA2A 4F9CB 1POGA 1AKHB 2CUEA 3IHUA 2HVSA 1QVTA 1QHGA 2HTJA 4WCGA 2XAQA 1QZYA 4PZJA 3ASOH 5FLXK 1HW1A 2KHMA 2P4WA 4F55A 1DP3A 4BXUA 4LF4E 5FO5A 3MAJA 5FROA 3MZHA 3SZTA 1IN6A 2RPCA 3C6KA 4Y7NJ 3GTMJ 2MD0A 2GLIA 4AC0A 3ABKH 1XNRE 2QCOA 1WJPA 1X48A 1TQPA 2J7JA 2EPOA 2F6CA 4XK4A 1MBKA 1HNWE 5EEAA 5HLGA 1AOYA 1B8IA 1BR1A 3WTWC 1RR7A 3N05A 3V7CA 1YYOA 5E17F 5BMZA 2YWQA 2FXAA 1PVEA 4DZJA 4R8OA 2HS5A 4FTHA 4A3JJ 4XLAA 2LF8A 4HA8A 5M3FJ 5KL2A 1IBLE 2EZLA 2EWNA 2OQGA 2YSPA 2B7VA 2ENHA 3CCYA 3EPZA 2JMWA 3SYTA 3IH4A 3AG4H 1UJ8A 3JTHA 2PN6A 2Y2ZA 3IWZA 5LHHA 1KYWA 2K9MA 1YI2I 1FEXA 1S29A 2EMWA 2NNYA 1OQYA 1UHMA 2IA0A 2LKSA 4PSXA 3IH3A 4UUSB 3MKLA 1X1PA 2CO5A 4PGGA 4ANJA 1H89C 3K7AJ 2RGVA 1MMGA 1IC8A 1O7LA 2HXOA 5IXMB 2OA4A 3OYFA 1CF7B 4JI8E 1ZLKA 1MNEA 3FXUA 2ECBA 2QLZA 2UUBE 4OIRF 2V1UA 2PMHA 2CSOA 2YTOA 4NQWA 4U0WA 2FQ3A 4BJ6C 2X6YA 4PJJA 3AUZA 3TO6A 5E3OA 3RTRA 1VQ4I 2EK5A 1V3FA 1MBEA 1J2XA 4KHPE 3W6JB 2K02A 3ZMDA 3W2AA 3GTLJ 2GM4A 4YFKF 2VL8A 4QPOA 4BL0B 1PDAA 2FNPA 1USSA 2KQRA 4DR7E 1Z6TA 3QP6A 4I01A 4NQWB 1P7IA 2VBWA 2HDDA 2PX9A 3ZQFA 3I59A 3F23A 2XKOA 3HGYA 2EPLX 3ASNH 3MVPA 1YIJI 2GBYA 1YHQI 1FT9A 1OFCX 2L9RA 1LJ9A 3P9CA 3THOB 1TW3A 3O8GA 4ZC3A 4Q4ZF 4MLVA 2RKHA 2W84A 3FBIB 1A04A 2O7OA 3K4LA 4EM1A 3JRDA 4CSWA 1IXSB 4JI4E 3DPUA 2O3FA 2DCEA 2XAFA 1ZN2A 2XV4S 2VJ5A 3L2VA 2IBDA 2BB8A 2VKEA 3WU1B 4AYBN 3JREA 1I1GA 4Y33A 4BGDA 4A3CJ 3P7NA 4N4NB 4EJVA 2EOJA 2QQAA 3D0SA 4FX0A 3TOAA 1AWCA 2HJJA 2KZVA 1R36A 1BR2A 4LF5E 1RC7A 1XMXA 3U21A 4IRGA 5GTHC 4YHHE 2K86A 4WXHA 3I53A 3HTSB 4IHSA 2MDGA 2E1MC 3H9GA 3ZR8X 5B1AH 2LMZA 2EPCA 3G2BA 2RNJA 1OCOH 2XAUA 2KT0A 4HV5A 3I56I 3GX4X 1V5FA 3QOEA 4BC9A 2VQEE 2ZNZA 2RREA 2LY9A 1D8JA 2XB0X 3LWFA 3DKXA 1OYWA 3H1CA 4AD9A 1ZLJA 2DT6A 2FD5A 5F64A 1XNQE 2TCTA 4RGSA 3C1DA 3CCQI 4F2JC 4M74A 3BIDA 5EEGA 1ODDA 1J26A 1OMIA 3FMSA 2EOOA 1T95A 3D5RC 3VB2A 3A0HC 1N32E 2FU4A 1JKRC 4B3TE 2HNHA 2ZBKA 5FGMA 5ICFA 4A0YA 1R6RA 1ZBTA 2RSMA 4YRVA 2YTPA 2VE7C 3TW7A 2O8XA 4AIKA 1SMTA 1ZBQA 3THNA 3QQAA 1TQMA 2DJIA 3ZCOA 1VF9A 4EVIA 5FD6A 2EOZA 1IXRC 1YW7A 2HOSA 3WGGA 1RIOH 5L3GA 1DU0A 5HDKA 4JV5E 4XOPA 4OMZA 1LE8A 1RNLA 3GZNB 2ME6A 4XRMA 2WB1N 1OYYA 4DYRA 2DA3A 2K9QA 5EGOB 5IYDJ 3OMLA 1NK3P 2EQRA 3TP3A 3PL8A 4MHGA 4ENKA 4XN0A 3ZMTA 3BROA 2QM3A 1FBQA 2RNGA 3TQNA 4UY8I 3S93A 3P1XA 4XSZF 1YZ9A 4F3QA 3I55I 4NC7A 3U1DA 3BR3A 1U8RA 2EPMX 2Z5UA 3WU2C 2ZMEC 3JRBA 3F3XA 3L1PA 4YIIA 1UCRA 1G8XA 3H3UA 3ROUA 4BQAA 4LFAE 2DB2A 4L5NC 3SDGA 2LD5A 4BXXJ 1U6GA 2ODRC 1BIBA 2COBA 2X6XA 3JRFA 2R7VA 2JPCA 4KYWA 2EN4A 1JKQC 2JA7J 3AL0B 1UB9A 2FQ4A 2HKXA 5HDNA 2EMFA 1GUUA 1XGNA 5D5XB 4XIDA 1T56A 2E7XA 5EZGA 2STTA 1KYQA 2A07F 4A93J 2M1BA 3MMYB 2FNAA 2V85A 1JTYA 3IAS2 4C30A 5E1XA 4F9BB 4XLFA 1I94E 2OCCH 2VQGA 4NXNE 4RGXA 1ITYA 5AONA 4ENMA 4QWQA 2JQ7A 2WBSA 2IS2A 2HU9A 2GZWA 4UNOA 1UG0A 3KE2A 4I0BA 1IAWA 3RMPA 3BR5A 2V88A 1MMNA 2JZYA 2IGNA 2IHR1 1W7PD 4NBQA 2EJ4A 5F0FA 2MG4A 3BCAA 4U7BA 4LLNA 3IV5A 2B3TB 3SEQA 5BPDA 4N4RB 3K6QA 1XN7A 4DV1E 2RSIA 2KIFA 3HOUJ 2X1EA 1A1JA 4F92B 2YRKA 4G94A 1PJRA 2G0EA 3FWEA 1IBME 4HW0A 5E3LA 3CQZJ 1HLVA 4B8XA 3I71A 2EPNA 2M0CA 4PJMA 3G6EI 4HQEA 1WJAA 4L5EA 1QU6A 5A6BA 3PIPF 4C9YA 3KIOA 4HV6A 2YT4A 2YPRA 3H5RA 2F4OB 3DU6A 3K1NA 5BOXA 1OPCA 4JYAE 1HKQA 1K6OA 4IHVA 3J7YJ 2KKOA 1WCMJ 4R03A 2WBUA 3CCJI 4ENJA 3TMOA 2O61A 1X6EA 4GRIA 4D1QA 3LMLA 3NWSA 3HL2A 2Y48A 1P9QC 2EOYA 3O3KA 4B48A 3JTZA 2P6TA 3RCOA 2IEKA 2CH0A 1O7FA 4YY3E 3C2HA 2M9AA 3K2ZA 4CA0A 1GVDA 2OPTA 1GVJA 3ZGKA 1Z6RA 5JHFA 2EOHA 2EM0A 2EMBA 4ZZLA 2IVMA 2WAQN 4CXFA 3NARA 3HTXA 3HHGA 5D4SA 4P78A 2NS0A 2M7AA 3TKYA 2K4VA 1ON1A 2AO9A 1EKZA 1S3JA 1IQOA 2DMYA 4G7HF 1GXPA 3BBGA 1J5YA 3KX2A 1ZAAC 1R4MB 3G73A 2XDVA 1V5GA 4LF6E 3HXLA 4E7SA 2XGEA 5FLXZ 5D4RA 1W36D 1HSJA 2E1MA 1OCTC 1BI1A 4L18B 3HOWJ 5TRDA 2DMQA 5GADJ 2F5CA 2Y69H 1FJLA 2C6YA 3HOYJ 1VTNC 5IT3A 2E72A 4EEFG 2P8TA 5F27A 2FOWA 4BH9A 2MLGA 2VJJA 2H94A 4Z2YA 2QBYA 3ZOBA 1UFMA 4GEQB 4L9VA 4M3DA 2VQHA 2OTJI 4JI6E 1Y8QB 4XSXF 2OUMA 3CF5F 3T8RA 2IAIA 4MIMA 4BY1J 3S2WA 4W1UA 3RPQA 1FIPA 1N34E 2W7NA 5HS8A 4F91B 1EF4A 4WF2A 3J7Yp 4PJNA 2NRAC 1X3CA 2KIQA 5FKOA 1MKMA 2AQEA 2R7TA 3K6GA 3K0LA 2M87A 4DUYE 4XKBA 2W25A 5GAEJ 2HPIA 1TW2A 4EGZA 3JRGA 2NOGA 2JA6J 1YUJA 4LB6B 3K4JA 4F52A 2W24A 2JWTA 2UXNA 2M9HA 5FD5A 1D1BA 2VRDA 4WYQB 4A0XA 1NG6A 1HF0A 3GFIA 1WKMA 3K4BA 4X9JA 2P6SA 4BKXA 1QRYA 4RGUA 5H20A 1VQ5I 1MSFC 4OAZA 2E2IJ 4I76A 1PJQA 3NEUA 1MIJA 2EZKA 4M6XA 3FISA 2ID6A 4NB5A 1UHSA 4A5MA 2EPPA 3MN2A 2YTDA 4HSTA 2CQ7A 2KISA 2IA2A 1ZARA 2HEOA 3ZQGA 4BMJA 3SHFA 5M5WJ 4L9NA 4FISA 1I27A 2XRNA 2A5YB 1JT6A 4QSHA 1W7PA 3JSPA 4KMUX 2CPNA 4UB6C 3OV8A 3DBHB 1X1BA 2JT1A 1HNZE 1ZH5A 1XMAA 4A6DA 2ZKZA 2HQNA 1JHFA 2LNBA 3FXJA 4J00A 3J81C 1XGOA 3EQLF 4YFXF 2UXXA 1O3QA 2L0KA 3DQVC 4B09A 1JTXA 2DDAA 5KL7A 3V7RA 1I39A 3W6KB 3FDYA 5E1ZB 5D8KB 2HGCA 4DBQA 1XMKA 2L2NA 3OL4A 2JP9A 3ADLA 4CHUA 5D6FA 1ETVA 3JCUC 1N36E 3PUFA 2DAOA 2O5RA 1Z1BA 5GAHJ 4RAFA 3GTPJ 4X6AJ 1TWAJ 1BA5A 1QZEA 3AG3H 4PUSA 1BW5A 2W57A 2N3GA 3KPHA 2OJED 2ESHA 1W1WE 2W4SA 1H9GA 2A61A 4LG0A 5EG0B 2R0QC 2M8GX 1YUIA 2DYRH 1RRJA 4NUBA 3K70C 2EWLA 1MZBA 4AVPA 3KFWX 5BR8E 1K78B 1RPWA 1RC9A 3TW6A 1OYIA 3O6BB 2EQ0A 4A3KJ 3GWZA 4BC7A 4EV0A 2X85A 1T08B 3CLQA 3Q0VA 2DPUA 2M4IA 5LMUE 1HDPA 2ZXWH 5LHGA 5L3BA 3L2WA 3IWBA 1BBYA 2YU5A 2ADUA 3HQ1A 1Y39A 3S17J 2I13A 3ZOQB 2L3CA 4RGRA 2L2KB 1WI9A 2WY8Q 3IH2A 3QAHA 1YFHA 1FYMA 3PFIA 3T1BA 1SVMA 4HQMA 2MH2A 3ZQIA 2P5LC 1UG2A 1TTYA 4YFNF 4GYGA 2ZFUA 2LDUA 4R2CA 4EJWA 1LVKA 1R5GA 3LFKA 2DODA 3ECHA 1R22A 5LD2C 1X5WA 1WHUA 2X0LA 1J0RA 1ZK8A 4BDYA 3DTKA 3BJ6A 2JSPA 3CJQB 4BYYA 3GUDA 1LUJB 4KT5C 3LMMA 4XRSG 1SVLA 3QPLA 3VYTB 4KN7X 2M45A 2CMPA 3Q0WA 5FB2A 3FMRA 1JK2A 3GZ5A 4N9HA 4BEHB 2DIXA 1KU3A 3FHNA 1P92A 2L02A 3L2UA 1AKHA 3OR1C 1GXQA 1BR4A 2R7SA 2R7XA 3BY6A 3OSGA 4V2GA 5EGOA 1VQOI 2O6GE 2KJCA 4OIPF 1TNSA 3WTZA 2KIMA 2XGCA 2QQ8A 4XOTA 1MSEC 1EJ9A 2ZJRF 4M3BA 4OIQF 5A6AA 1BOBA 2Y0SA 4L8NA 3HPGA 4ZYHA 2QEXI 4KICA 3OYCA 1SD6A 4O6JA 3OYJA 3F22A 4RLQA 3OSFA 2RAEA 2BVLA 3IKTA 2A5WA 3BG3A 5CPRB 5B66C 3OYEA 2HQAA 4MEYF 3ZQ7A 3KZYA 2DMUA 2PFBA 1KJKA 4OX9E 2Z9OA 2I8DA 4BU2A 1GT0C 2K4JA 4Y15A 4KIFA 2VKVA 4RMNA 2VLAA 5FRNA 2Y31A 3DXJF 4BBYA 4D9JA 5HLHA 5HLIA 4XMYA 3V42A 2H36X 4NC8A 2ESNA 2YU9J 2NVUB 1FKAE 3LA2A 1NHAA 4CYDA 3JRHA 2DMNA 3Q5FA 3F6VA 2KMUA 1K4SA 1JKPC 4RHBB 1YS7A 2EJRA 3QPTA 4CCOA 1OR7A 5ILVA 3S15J 5L3FA 1XG1A 2O9LA 2V26A 3OYDA 1OKRA 1SMYF 2GWRA 4GYIA 1CF7A 2MYSA 3HC7A 1GV2A 4FE4A 2WADA 2E1CA 2E1NA 2DGCA 2IJLA 1OCZH 1SFXA 1IV6A 2YU8A 3O2PE 4OU0A 1MDMA 2DYSH 2Y0MA 2ZXIA 3N4MA 2BZTA 4PSWA 3CDIA 4E7HA 1FC3A 1R00A 4BUPA 5B5EC 3S1NJ 4AM3A 1LFUP 3COAC 2PJPA 3UNGC 4BJTA 3VDXA 3HM5A 3DF8A 3C4BA 4R2RA 2DFHA 4X1EA 2M2EA 2QSGX 4RB0A 3CMYA 1MNDA 1T4OA 2CTDA 4GCVA 5KVRA 3I59B 1BJAA 1P6RA 4UB8C 5C44J 5LL6R 3D1NI 1P4AA 2Q1ZB 3F8FA 5FLMJ 5EG0A 1Z7LA 2DI3A 2BY0A 3J81K 1QPMA 2NNNA 3VPRA 4OOGC 2XAGA 4JI0E 3I5UA 3PQJA 1R1VA 1U0JA 1NCSA 1OCRH 3OS0A 2ISZA 2XUBA 1T4NA 1BOAA 3A02A 3EYIA 2A6EF 4MLOA 5KAFC 4RM3A 3GTKJ 3KYLA 1BW6A 3I4MJ 1VI0A 2H09A 3ML6A 3LL7A 4LGWA 1X6FA 2LE2A 4KT6A 1KU2A 3H35A 1IG7A 3J7AG 4DJAA 2BEOA 3IL2A 3JR9A 3RZOJ 3WODF 2HQRA 1X2MA 2XGDA 3M07A 2UZKA 3CJTB 3V4GA 4HOBA 1U8BA 4JX6A 4UUSA 3MKYB 2IGKA 2VOPA 1F43A 4JOMA 2LJUA 3E6CC 1LDJA 1JGGA 2V8QB 4J01A 5K7ZA 3E0JB 2MBFA 5DYMA 2HDCA 4HBLA 5F1JA 3OYBA 1O3SA 1MH3A 4IJDA 4TV7A 1YX3A 2YTFA 3M7GA 3MZ8A 5EEHA 1ZR4A 2XSJC 4RAYA 2MDRA 2MFZA 3K2AA 1IXCA 4D7MA 2L33A 4M3GA 3W6VA 1WH5A 1A5JA 4LTYA 3SFZA 4DR2E 3AFHA 1QBJA 5LRSA 2JN6A 4F54A 2K5CA 3GVAA 1X1DA 2HZTA 4IOCF 2EM5A 3F6GA 2V7FA 3KCCA 2XPVA 2PBIA 2LTRA 1APLC 3E5QA 2EMCA 3WE3A 3KP6A 1MMAA 3FMQA 4K0KE 2JY9A 2K27A 1N78A 3M8FA 3A4CA 4M72A 3CC2I 1HXDA 2L4MA 4PGHA 2PI0A 2OCEA 4M0VA 1A1HA 4DKKA 3EYYA 3LAPA 4ENNA 2FGGA 1K79A 5LRRA 1I6XA 2FBIA 2RVCA 3T5XA 1YW8A 2RQPA 5E1WA 4I2OA 4V2FA 1A35A 3GF2A 2XF7A 3E6MA 3FKJA 4G6DA 5A6JA 5KK1A 4U0YA 2XPUA 2ELJA 1WI3A 5D6EA 3CLOA 3R61A 2DA4A 3RZDJ 2A25A 2ZO4A 4ETSA 5HNFA 1Z9CA 2LKXA 2W1OA 4LOCA 3V8JA 2R5ZA 2OQRA 2JYAA 4B3AA 3GTGJ 2RQLA 3I64A 4L5IA 1B6AA 4QLCU 1UAAA 2DLQA 4ESJA 2DT7B 2L7KA 2EFPA 3L9FA 5DTDA 3M9AA 2JWOA 1FSEA 1ZKGA 2CW7A 2XPWA 3BTCA 3E5XA 2XC7A 3J7AY 2ZMEA 5JR3A 2I9IA 2H27A 1S9HA 3DPTA 2GXGA 2EMXA 5BPIA 1DP7P 1S6LA 2A68F 5JHUA 3H3VK 1W7PB 5J47A 5B3SH 5DCMB 4HEIA 1QVUA 4RS8A 3W2VA 2F4VE 2DJNA 2VQLA 5F0CA 1YJWI 3ABMH 4IHXA 1ZGWA 2HVQA 3WG9A 3I4NJ 1GLNA 3CCMI 2H8RA 2DOAA 2E1MB 3C7JA 3FM5A 1RKTA 3F8CA 5H6RA 4RB1A 4R8HA 4LLLA 5IP7J 5GAGJ 2DPDA 2L54A 2PMZA 5J8FA 4X66E 2M4GA 3EQ1A 1ETQA 3GMEA 1SFEA 2COMA 5AC4A 3GCMA 2J5PA 3VYRB 2JVHA 3S2HJ 2ME0A 2NVXJ 3HYIA 3L7WA 1BC7C 3HG9A 1IRGA 2L4AA 2ZSIB 4CGZA 3DKYA 2ZMEB 3OOUA 4A3BJ 4IVNA 4G6QA 4WXDA 3CJNA 3FIGA 2EBIA 2VC0A 3LSMA 5E8IA 2MKNA 2CV0A 1JHHA 2MW8A 5IT9C 3E5UA 4ZYGA 3HTUA 4MFEA 5ICCA 2EP3A 2KRFA 4LD5A 3REOA 2B7TA 3HRSA 3F9KA 4HPQA 3CCLI 5K5QA 5CYVA 3J80C 2AXLA 2VPRA 1NEIA 2LBSB 3OYAA 1AH5A 4XRSA 2KL4A 3QWLA 3DBLB 3FBNB 3GYHX 1DUXC 3HRMA 1FTZA 4B3ME 2CRGA 3WTXC 2RC4A 3JRCA 1XGMA 1P2FA 2JTVA 3KLNA 3T1HE 5EF6A 1MJ9A 3JTGA 2CT1A 1JKOC 4DR5E 2HVRA 2A6HF 2IA1A 3OOPA 1STUA 3AG2H 4UVBA 3EUKL 5GP9A 2ELHA 1IW7F 2EH3A 2IPQX 1D8KA 1WWXA 2R3SA 4EQQA 3GFMA 1AU7A 1RQ0A 5E8GA 5HODA 2QSHX 2XASA 4U0VA 2F5DA 5DM6F 1UHZA 4FK5C 2Y30A 3KP7A 3QG5C 4R2SA 2HKOA 5J3LA 2E5ZA 4IRIA 4AU7A 1TL8A 1WHQA 2YX7A 1KGSA 3Q9VA 4CYCA 4HSRA 3HPSA 2CWEA 4MFDA 4CH7A 2HOAA 3W3CA 5BQTA 1ZRDA 3D5LA 1YLFA 2HI3A 3L09A 3JU0A 2EILH 2VBZA 1S7EA 1FOKA 5J1YA 2K40A 5EZHA 1O4XA 2E60A 4AIJA 4LB5A 3GTQJ 4WSPA 1F36A 1YX5A 3JRIA 3RKQA 2A3SA 2WWYA 1B1BA 1FMVA 2PMZN 2QKLB 3ABLH 4F93B 3CUQB 1ZTRA 1VQ9I 1E3HA 3PNVA 4ZYEA 2M3AA 5EYRA 4E70A 1KQ9A 4G7OF 4DR4E 1ONVA 2YS9A 3HSRA 5DUIA 3PNTA 2CGPA 2FMLA 2E19A 4P7DA 2GA2A 3VK6A 2E5NA 3QU3A 4PFOA 2H6BA 2NXNB 1LPQA 3K9TA 2OAZA 2HFHA 1ORKA 2OBPA 3RSNA 3MEXA 4HLXA 3UK3C 4BBRJ 3GTJJ 1WQ2A 1U9NA 2NOJB 4S04A 2UUZA 1S5LC 1YJNI 4GXOA 3C3WA 1XDSA 2F48A 1Z67A 1T38A 1NK2P 3K1MA 2X48A 1KU7A 1T98A 2IRFG 4PK4A 1ZAOA 3IAM2 5KL4A 3F8MA 1IN8A 1V54H 2N8GA 3AV0A 3GZ6A 2EA2A 4BE2A 4CCLA 3BJAA 2EIMH 3WE2A 1G4DA 4IPAA 2EMLA 5KAIC 4LFCE 3DBRB 3SQNA 1YITI 4A6EA 3PUBA 5DCMA 3IP4B 3RKWA 1A1FA 3H5AA 3DWLE 2KFDA 1S7AA 1Y56A 4E7LA 3VWBA 4E6KG 3WGHA 2EL6A 1WJCA 4E7ZA 5JVTA 4MTDA 3RDIA 4O4KA 5IYBJ 3U2RA 1L3LA 2EZ6A 2GA1A 2GIVA 3BJOA 3DV8A 4C3HJ 2DFEA 2BBYA 2R7ZJ 1X3WB 1FMWA 1ZG3A 5DM7F 2ELYA 2DOFA 3A01A 2ZSHB 2VXZA 1BL0A 3EUAA 2LTSA 3HEFA 3V8KA 4XQFA 2EZIA 1DQ3A 3HSEA 5KNLA 1CGPA 4M9VC 4KUMA 3M8EA 4M3FA 2BY1A 4H0EA 1XCBA 2NYXA 2R4GA 3PIOF 4Y17A 3HUGA 3I9V2 3MKZA 1WJ5A 3O8HA 1SD4A 3J81Z 5C4XJ 2LH9A 2M30A 3DTIA 3L2QA 1LLMC 5TGTA 1IRFA 2HQ5A 1ZG5A 4KNYA 1J59A 2E35A 2EM4A 1F1ZA 2XRLA 3KZZA 1Z05A 2QQ9A 4OOIA 2EFWA 3ISPA 3U9GA 2DRPA 3WTUC 3UKGA 5A69A 1SFUA 2P0WA 2NVYJ 2K9LA 4HNTA 2P7VB 4UVAA 2OD5A 5CLSA 3G71I 2ZM6E 2EZHA 2EQ1A 4DBRA 2YZTA 4J19A 2XIGA 1DQUA 5JI6A 1BBOA 1RKWA 4O43A 5ILUA 1LKXA 1XS9A 2XVCA 1ZYRF 4CCJA 4DZPA 1WJBA 4BQNA 2HYGD 2NABA 1WHNA 1T6SA 1DPRA 1EH6A 4FASD 2WAFA 4D7NA 3CMMA 2EMZA 3LSHA 1I1SA 4GKJE 3AG1H 1D1CA 2M4KA 3M99B 4BCAA 1X2NA 3D5SC 1FTTA 4X8WA 2B63J 1ULYA 4Q35B 2L3JA 2BXZA 4HDUA 1WJFA 3HDDA 3CCSI 4ON0A 2EE8A 5D5WB 2JOXA 2E34A 4FT8A 5FLVA 1WSUA 4XORA 3MFKA 2VUMJ 4E7JA 2L6MA 4I99C 2CU7A 2DA2A 1XCVA 3RKXA 1JK1A 1SR9A 2NVQJ 1JUSA 3BT9A 1FBUA 3NRVA 4H4KC 4ZDLA 1C0WA 4DYQA 2YTNA 2BY3A 4KWYA 1YSAC 2PQ8A 2K4BA 1N77A 3PO2J 3JAMC 3B02A 2Q8KA 4LFUA 4JYKA 5KL3A 3KYDB 3IUOA 1V55H 4IQ4A 4HLYA 2EM8A 1I3QJ 5DDGA 3ELKA 4Z6YA 2IGOA 5HNHA 3Q9SA 5DNYA 1MW7A 3OYMA 3HHHA 4F9AB 2X1CA 2H1KA 3ESWB 2MSYA 4P96A 4WSGA 1ZGJA 3RPUD 3OS1A 2K3PA 2QZ8A 3FIWA 2VKDA 3ADIA 5F08A 1UBDC 2KIUA 3NWTA 3T8TA 2DQLA 3DEWA 4LF9E 2XKPA 1LVAA 4NDLA 3GFJA 2CUFA 4DOZA 2WBTA 4BHPA 1ZG1A 5FJ8J 1H88C 2FMYA 2LRSA 3EPJA 1WVRA 2EV0A 1RR8C 2GHFA 4LLGF 3CDLA 3FZVA 4CDGA 3K4KA 3J80K 1DDNA 2YTEA 1J5EE 2FOKA 4Y4RA 3G1OA 2JPAA 2X6WA 1UZCA 3H0DA 4S05A 1GTKA 5H6QA 4RLFA 2V1NA 1ZREA 2WAEA 2H6CA 3BLYA 2CQKA 3BC8A 1QGPA 2E36A 1QU3A 1YO5C 5KL5A 1VQMI 3BZ6A 1FPQA 3HB9A 4I8OA 1JT0A 3WHCA 3H36A 4C2TA 1PUEE 2LSOA 3OYLA 4HG2A 5IV8B 1X1CA 4PJLA 1B4AA 2XGXA 3KLOA 4GGGA 3F21A 2EORA 4JK1X 4HTGA 2KZGA 3MHHC 3SZPA 4MTEA 1STZA 5DD8A 1I6HJ 4GZNC 2VASA 2ISYA 2KDZA 1ZRFA 5K7FA 4E7IA 2JRMA 4OAYA 3EETA 2BXYA 2V9KA 3ADJA 3QU6A 3EDPA 1OCCH 2VC1A 2NS8A 2H8WA 2M34A 2CQNA 4G8XA 1Z91A 3HRTA 5LHIA 2BVMA 2JK3A 5AC5A 1SD5A 3EUHC 6PAXA 3S1MJ 1P47A 1PP8F 2HHHE 4RAGA 4B3RE 2MD5A 2PJRA 3DTEA 3QYBA 3RJPA 4FCYA 2KOUA 1AAYA 2WV1A 1VQPI 1MBJA 2QENA 5HS9A 1LB2A 2X51A 4XKCA 2V4JC 3EPLA 2CYYA 2STWA 2CG4A 3RYRA 3P9KA 2DTZA 3RI4A 3WTSC 2FUG2 5ICGA 3ZPLA 1QQIA 2MC3A 2ZCWA 3CTAA 5F3WA 3G1MA 3JW4A 1XSXA 4HF1A 3DJWA 2ICWG 3H9QA 5ERIA 4HF2A 4YEJA 1HW5A 2AS5F 2Z16A 2D9HA 2CW0F 1R5ID 4Q5SF 4R1HA 1W5TA 1JJ8C 1FP2A 1X6HA 2YTQA 2EFNA 3LSIA 4XL9A 4X0GA 1VNDA 3FXOA 3B73A 3RIRA 2DXIA 4YG2F 3CD6I 1RMDA 5L3CA 2EM9A 2Y9YA 4L9JA 5CFFE 2QSFX 4LIVA 4EM2A 2DN0A 1U3EM 1PYVA 1X49A 4CZCA 5LEKA 3BF2A 3S16J 2EA4A 3MZYA 2YSOA 2D5VA 1HKSA 1ERDA 2VJ4A 3AAFA 3S1RJ 3M4OJ 2EM7A 2IP2A 5KCMA 2MC4A 3DCFA 5CVJA 2EOEA 3I3LA 5DV5A 2HYJA 4CCMA 4UHTA 1WFXA 2K85A 1USTA 5GPAA 2TDXA 4HX4A 5TSEA 3OYNA 2DQRA 2L7MP 2AHQA 2J5OA 3CCEI 1IDZA 1EKEA 2YSRA 5HS7A 3FXQA 1J75A 1YQAA 1E3PA 1ENHA 3CC7I 4L9TA 2QGUA 4BS9A 3DLAA 1YRNA 4LU9A 1TQIA 3HOVJ 1LDKB 2LJHA 3E1SA 3I4PA 2Z3YA 2M1SA 2EPFA 2QUFA 4DR6E 5JLWA 4EMSA 2VN2A 2EPRA 1G3YA 2K3FA 2EN1A 2LLKA 2WBMA 2Z99A 3DU5A 4I6ZA 1Z3YA 1TF6A 4KIGA 3E6BA 3U1KA 3ZXSA 3OYIA 4A3LJ 5FLXC 4MQ9F 2WA0A 3LQRA 2FX0A 3KEYA 2E2JJ 3HOSA 1SAUA 4B43A 5DEQA 2ZXHA 2NAZA 4MGRA 1VZ0A 5K5OA 3TDUC 2R7RA 2HZDA 2PMUA 2YX4A 3I0TA 3FXKA 4IL6C 4II2A 1Z1DA 2IS4A 4XRFA 2ACJA 5AASA 4WK8F 4O3MA 5FKMA 3FKIJ 4L5JA 4W97A 1FZPB 3V7SA 1ZHFA 1XC5A 4U87A 2ELZA 2V89A 2ECCA 2R76A 2EFQA 3LSTA 4JQFA 3BWGA 5GTIC 3G4SI 2GAUA 2HGHA 5F6FA 4RBOA 4GDFA 2EM3A 5KHDA 2KRCA 4JP0A 3HJEA 1MMSA 4R2QA 3OIOA 5FKLA 2G7UA 3ZQQA 4BNCA 4L0YB 1YYVA 3PQKA 4A69C 3KETA 4A3MJ 1IRZA 5B1BH 2RTXA 1QA6A 4LFBE 4O24A 4JI2E 3CO6C 3BOQA 3WTVC 4IQJA 1U78A 3TO7A 3X2QH 2YR2A 3VYSB 2YRHA 1DI2A 2EL5A 2Q2EB 2R7DA 3CZ6A 4WWCA 1E0EA 1IV8A 3MCZA 1IBKE 4YIFA 4BE0A 3KZIC 2L3DA 2YTIA 2WC2A 4P5OA 3CUQA 2VI6A 3C6MA 3BTJA 3ZN1A 1YW9A 2DK5A 4BQOA 3CJRB 4N4OB 1O3RA 1B9NA 4P1WA 2DK8A 4AUXA 1MD0A 5M5YJ 2EPAA 3FM3A 1YIOA 2M8EA 2W85A 4D5FA 2PJRB 2UXBE 2LMDA 3QYEA 1RUNA 2HOEA 1FJGE 2EIKH 1I50J 2Q2EA 3FX3A 1Y1VJ 2JR1A 1XX5A 4EJOA 1W5CC 5IY5H 4O5GA 2FSWA 3DEEA 1KA8A 1D0YA 2OF7A 2PEXA 3OMYA 4HEA2 4HNUA 2CSHA 4AVZA 4RH8A 2LP0A 2K9NA 2EMIA 2JPBA 2L01A 1Z3XA 2UV1A 3FXLA 2ADRA 1EH7A 1TLHB 2JUCA 4FX4A 3L2CA 4G7ZF 3ZP5A 1KONA 2M5WA 4C3IJ 4G12A 4M73A 1IUYA 4XKVA 1HW2A 1ETXA 4XLNF 2EMAA 3PO3J 2V83A 4TUIA 1RUOA 2VOOA 4RB2C 2LK2A 1RI7A 2HC5A 4EM0B 1IN5A 1LFPA 2EN8A 2L7ZA 2JA2A 3M1EA 2VT2A 2F8BA 3BPVA 3BTLA 3ERED 4CO8A 3DP7A 3VFZA 5AE3A 4O5VA 4FQGA 1T39A 2OU2A 1W36C 1PUFA 1IUFA 1S8NA 4IF4A 4QIWN 1IZ1A 3UR3C 1WXRA 2QA4I 1ZR9A 1NG7A 4M2ZA 3GO5A 3EUHA 2YU3A 2FBHA 5H2FC 3QRFF 3S3MA 3BR1A 2VT3A 2BV6A 1HR0E 2KPMA 1Y0UA 3LOCA 2DFIA 4HNVA 4XR6A 3S1QJ 1OJLA 1TWFJ 4D0PA 4DV5E 4N9IA 1XMOE 3BR2A 4IRHA 2LC2A 5CQEA 1BI0A 4KITB 3HZJA 1AA7A 1N3GA 4R79A 4IO9F 2F5VA 2I10A 2ZC2A 2CS3A 2VBYA 4JI3E 4KISA 1MBHA 5J1UA 5D8LB 2XB5A 4N0BA 5GPCA 2VODA 2YTJA 4B47A 3FXRA 2CW8A 3K4CA 3LLHA 2NUGA 1A6IA 5FRMA 4F7ZA 1XTAA 1UN6B 1F4KA 1ZR2A 1S7OA 3T1YE 2EV6A 1WPKA 3GFLA 1TC3C 3LSJA 3ZMZA 1MDMB 2GLOA 4IEJA 4IHTA 1XD7A 2LT7A 2AXTC 3KEQA 4UXNA 2GXBA 2R7WA 3BZCA 3IWDA 2WCC3 2P81A 5JLXA 2VONA
chains in the Genus database with same CATH topology
3FHZA 2X4HA 2HYFA 3P9IA 3WGIA 3R0JA 4I98B 3KEOA 2MLKA 4FHTA 4P55A 3J80Z 3BPXA 4M71A 2XROA 4HF0A 3TOBA 1QNTA 3F72A 2LF7A 2FRHA 3HSFA 2UWMA 1KYZA 4ASNA 1B59A 3ABTA 2V1DA 3RPUA 3TGNA 4HDVA 4KMFA 1IF1A 2WV0A 3SXYA 4ZZDA 5DCFA 2CFXA 2V79A 4MQVA 5DD4A 5ICEA 4MEXF 1V4RA 3IC7A 4JBAA 1MGTA 4M6YA 5CVIA 3IRQA 4RB3C 5FFXA 2QYOA 1FX7A 3RKYA 4EJTA 5CJ9A 4Y13A 4ZYDA 5K1YA 1FLIA 2O0YA 3IKVA 2G7HA 3MWMA 1B9MA 3GXOA 3I54A 2Z33A 1O3TA 4OMYA 3ECOA 1BC8C 5L3DA 1KU9A 3TDZC 3R60A 4BHCA 3G3ZA 4I02A 3VODA 3JAMK 4KFCA 4EJUA 3V8LA 1PDNC 1ZGAA 3ABUA 3H92A 1HKTA 1W4MA 5E20A 3QPHA 4LG0B 2ZJ2A 1K7AA 1XDUA 4LK1F 3DEUA 5AIPA 2VE9A 4ZH4F 1FP1D 2P7CB 2GQQA 2V6CA 2QBYB 5F1RA 2JSCA 5IT9K 2FA5A 3T0YA 4M9XA 2HTSA 1W5SA 4L0ZB 2MH9A 1UHWA 5HDGA 4KIBA 1LDDA 1O57A 1QO0D 1T2KA 1XSVA 2OZUA 1F5TA 3F8BA 1P4XA 1R7JA 1BI3A 5ED4A 1FY7A 3WTYC 1H9TA 4Q48A 2ETHA 1SAXA 3ZN0A 4UV8A 1WRJA 3R6SA 2DU9A 1BM9A 3C18A 4CICA 2D1HA 3CUQC 4KA4A 3VOEA 5ILSA 5D5VB 1U5TA 2PLYA 2BGCA 2KJBA 5LLQA 4GO1A 1XGSA 4IXAA 4ESFA 2HR3A 2D2WA 5FFZA 5K5RA 1F9NA 1U5TB 4EGYA 4UV9A 1MJBA 2DW4A 1BN5A 1R58A 1YS6A 2VE8A 1XB4A 4HX7A 3GLXA 4KDPA 5JFRA 3QOPA 2DTRA 2JRTA 5DUKA 1FNNA 1EV7A 2R7FA 2ZNYA 5CVUA 1GHCA 1TBXA 5LEJA 3LA7A 1JE8A 2QVOA 1R5HA 4M9SA 1KQ8A 1ON2A 4HYEA 5TJJA 1FWZA 1KQ0A 2HWVA 5HVQC 4BHBA 2K7LA 2E7WA 2DLLA 3E3VA 4G9YA 1FSHA 1BIAA 3NQOA 1G3TA 2EFOA 3E6DA 3LAJA 1G3SA 3R4KA 3KP3A 5CVRA 2PG4A 2DO7A 1XSDA 4BAYA 3KP2A 1YG2A 2F5EA 3CUOA 4LJZF 1X3UA 1J9IA 3R0AA 1JXSA 1QZZA 3F8NA 4KN4X 3KP5A 3VEPA 1EH8A 5LGUA 4UUVA 3CO7C 1IN4A 3WTTC 4MNUA 3WU0A 3HOTA 3K69A 3L00A 4HZFA 4IJAA 4I7HA 1H0MA 5L3EA 2OZ6A 4A5NA 5A2QZ 1U2WA 3IRRA 2A69F 4NHJA 1PP7U 1DPUA 1Q1HA 3IWFA 3J7AO 5LGTA 1FYKA 3TO9A 2O03A 1P4WA 3N97A 2DT5A 3DKWA 2FBKA 4Q47A 2FF4A 1LQ1A 4PDKA 1R1TA 1HBXG 3RYPA 1J7KA 1G6NA 5D5UB 3K1PA 1Z7UA 4U7DA 1E17A 1R1UA 1BI2A 2F5FA 3QP5A 4I0AA 3HIFA 4DNCA 5BS6A 2MA3A 3DFGA 3GW2A 2V9VA 1I5ZA 1SD7A 2Q0OA 2IW5A 3E97A 5AIQA 5J8CA 4ESBA 1T0FA 1MJAA 1HQCA 4U88A 4LK0F 2FE3A 3MQ0A 4I09A 3JSOA 5CVVA 5LGNA 1LNWA 2XHKA 2D45A 2LKPA 2DBBA 4CZZA 3ZMUA 2RDPA 4PCQA 5A2QK 1E2XA 2G9WA 3FF5A 1TNTA 2Y75A 1G3WA 4AWXB 4OIOF 5LBQA 4WXCA 2EV5A 2B0LA 1HSTA 3ZMSA 4P9UA 3HRUA 4LMYA 1IN7A 3ZMVA 4WX9A 2ZXJA 1LEBA 4RAZA 2V1XA 4A2UA 1REPC 2FEZA 1JGSA 2QWWA 3H3ZA 3GEZA 1RZ4A 2VBXA 3JAMZ 4HX8A 1R23A 2P5KA 4DQ2A 4A0ZA 2XAJA 3BP8A 2F2EA 1K78A 4OINF 4P9FA 1D3YA 3BDDA 5HOOA 3DPLC 1U5TC 5E18F 4HAMA 4XLPF 4XBFA 2D1VA 3LQQA 2RV8A 2ZFWA 2EB7A 1D5VA 4K2EA 1LEAA 2IT0A 3F6OA 4UVCA 3I58A 2XAHA 2QQBA 1FBSA 4M9ZA 5IT9Z 2P5VA 1FYLA 3LA3A 4AIHA 1YTYA 2BE5F 2RN7A 2WTEA 3CDHA 3ULQB 4A12A 5J6XA 2BYVE 1L0OC 1ZRCA 3KP4A 3IHUA 4WCGA 2HTJA 2XAQA 1QZYA 4PZJA 5FLXK 1HW1A 2P4WA 4BXUA 5FO5A 3MAJA 3MZHA 3SZTA 1IN6A 1TQPA 5HLGA 1AOYA 3WTWC 3V7CA 5E17F 5BMZA 2FXAA 2HS5A 2LF8A 4HA8A 2OQGA 2EWNA 3JTHA 2PN6A 5LHHA 3IWZA 1KYWA 1S29A 2NNYA 1UHMA 2IA0A 2CO5A 4PGGA 2RGVA 1O7LA 2OA4A 1CF7B 1ZLKA 3FXUA 2QLZA 4OIRF 2V1UA 2PMHA 2CSOA 4NQWA 4U0WA 2FQ3A 3TO6A 3RTRA 2EK5A 1V3FA 1J2XA 3W6JB 2K02A 3ZMDA 4YFKF 2FNPA 1USSA 1Z6TA 3QP6A 4I01A 2VBWA 3I59A 3F23A 2XKOA 1FT9A 1LJ9A 3P9CA 1TW3A 4Q4ZF 2RKHA 2W84A 1A04A 4EM1A 1IXSB 2O3FA 2XAFA 1ZN2A 2XV4S 3WU1B 1I1GA 3P7NA 4EJVA 2QQAA 3D0SA 4FX0A 3TOAA 1AWCA 1R36A 4IRGA 2K86A 4WXHA 3I53A 3HTSB 4IHSA 2RNJA 4HV5A 3GX4X 2ZNZA 1D8JA 3LWFA 1OYWA 4AD9A 1ZLJA 5F64A 4RGSA 3C1DA 4M74A 5EEGA 1ODDA 1OMIA 3FMSA 3VB2A 2FU4A 2ZBKA 5FGMA 5ICFA 4A0YA 2O8XA 4AIKA 1SMTA 1TQMA 4EVIA 5FD6A 1IXRC 1YW7A 3WGGA 1RIOH 5L3GA 5HDKA 4OMZA 1RNLA 1OYYA 4MHGA 4ENKA 3ZMTA 3BROA 2QM3A 1FBQA 3TQNA 4XSZF 3U1DA 1U8RA 2Z5UA 3F3XA 4YIIA 1UCRA 3H3UA 3ROUA 4BQAA 1U6GA 1BIBA 2JPCA 4KYWA 1UB9A 2HKXA 5HDNA 1XGNA 5D5XB 2E7XA 2STTA 2A07F 2M1BA 2FNAA 5E1XA 4RGXA 5AONA 4ENMA 4QWQA 2GZWA 4UNOA 3KE2A 4I0BA 1IAWA 2JZYA 1W7PD 4U7BA 4LLNA 5BPDA 1XN7A 2KIFA 4G94A 3FWEA 4HW0A 4B8XA 3I71A 4HQEA 4HV6A 2YPRA 3K1NA 5BOXA 1OPCA 1HKQA 1K6OA 2KKOA 4ENJA 2O61A 2Y48A 3O3KA 2P6TA 1O7FA 3K2ZA 1GVJA 1Z6RA 4ZZLA 2IVMA 4CXFA 3HHGA 5D4SA 2NS0A 3TKYA 1ON1A 1S3JA 4G7HF 1GXPA 1J5YA 3G73A 5FLXZ 5D4RA 1HSJA 1BI1A 4L18B 5TRDA 2F5CA 2C6YA 1VTNC 5IT3A 2P8TA 4BH9A 2MLGA 4Z2YA 2H94A 2QBYA 1UFMA 4L9VA 4XSXF 3T8RA 3S2WA 3RPQA 5HS8A 4WF2A 2NRAC 1MKMA 3K0LA 2M87A 2W25A 1TW2A 4EGZA 4LB6B 2W24A 2UXNA 5FD5A 4A0XA 3GFIA 1WKMA 2P6SA 4RGUA 5H20A 3NEUA 4M6XA 4NB5A 4A5MA 2IA2A 1ZARA 2HEOA 3SHFA 4L9NA 1I27A 2XRNA 2A5YB 1W7PA 3JSPA 4KMUX 3OV8A 2JT1A 1ZH5A 1XMAA 4A6DA 2ZKZA 2HQNA 1JHFA 2LNBA 1XGOA 3EQLF 4YFXF 2UXXA 1O3QA 4B09A 3DQVC 3V7RA 3W6KB 5E1ZB 5D8KB 2HGCA 1XMKA 4CHUA 5D6FA 2DAOA 2W57A 2ESHA 4LG0A 1H9GA 2A61A 1MZBA 4AVPA 3KFWX 1K78B 1OYIA 3O6BB 3GWZA 4EV0A 2DPUA 5LHGA 5L3BA 1BBYA 2ADUA 4RGRA 1WI9A 3QAHA 1YFHA 1FYMA 3PFIA 3T1BA 4HQMA 2MH2A 2P5LC 4YFNF 1TTYA 4GYGA 2LDUA 4EJWA 1R5GA 3LFKA 3ECHA 1R22A 2X0LA 1J0RA 3BJ6A 4BYYA 3GUDA 4KT5C 4KN7X 2M45A 5FB2A 3FMRA 3GZ5A 4N9HA 1KU3A 1P92A 2L02A 1GXQA 3BY6A 2O6GE 2KJCA 4OIPF 1TNSA 3WTZA 2KIMA 4OIQF 4ZYHA 4KICA 1SD6A 4O6JA 3F22A 3IKTA 4MEYF 3ZQ7A 3KZYA 2PFBA 2Z9OA 2K4JA 4Y15A 4KIFA 3DXJF 5HLHA 5HLIA 2ESNA 4CYDA 1NHAA 3LA2A 3Q5FA 3F6VA 1YS7A 2EJRA 3QPTA 1OR7A 5ILVA 5L3FA 1OKRA 1SMYF 2GWRA 4GYIA 1CF7A 2E1CA 2E1NA 2IJLA 1SFXA 3O2PE 4OU0A 1MDMA 2Y0MA 3N4MA 1FC3A 1R00A 3COAC 2PJPA 3DF8A 4RB0A 4GCVA 5KVRA 3I59B 1BJAA 1P6RA 1P4AA 3F8FA 2DI3A 3J81K 1QPMA 2NNNA 2XAGA 3I5UA 3PQJA 1R1VA 2ISZA 2XUBA 1BOAA 3EYIA 2A6EF 2H09A 3ML6A 4LGWA 1KU2A 2BEOA 3IL2A 3WODF 2HQRA 2UZKA 3V4GA 4HOBA 2VOPA 3E6CC 1LDJA 2MBFA 5DYMA 2HDCA 4HBLA 1O3SA 4TV7A 3M7GA 5EEHA 4RAYA 1IXCA 3SFZA 1QBJA 5LRSA 3GVAA 2HZTA 3KCCA 2PBIA 3E5QA 3WE3A 3KP6A 3FMQA 2K27A 3M8FA 4M72A 1HXDA 2L4MA 4PGHA 2PI0A 3EYYA 3LAPA 4ENNA 1K79A 5LRRA 1I6XA 2FBIA 2RVCA 4I2OA 1YW8A 2RQPA 5E1WA 3T5XA 3GF2A 3E6MA 4G6DA 5KK1A 4U0YA 5D6EA 3CLOA 3R61A 2ZO4A 4ETSA 1Z9CA 3V8JA 2OQRA 3I64A 4L5IA 1B6AA 4QLCU 4ESJA 2EFPA 3L9FA 3M9AA 1FSEA 3E5XA 2ZMEA 5JR3A 2H27A 3DPTA 2GXGA 5BPIA 1DP7P 1S6LA 2A68F 5JHUA 1W7PB 5DCMB 4RS8A 3WG9A 3C7JA 3FM5A 3F8CA 5H6RA 4RB1A 4R8HA 4LLLA 2DPDA 2L54A 5J8FA 1SFEA 2COMA 2J5PA 3HYIA 3L7WA 1BC7C 1IRGA 2L4AA 4CGZA 2ZMEB 4IVNA 4G6QA 4WXDA 3CJNA 2VC0A 5E8IA 1JHHA 3E5UA 4ZYGA 3HTUA 5ICCA 2KRFA 4LD5A 3REOA 3HRSA 5K5QA 5CYVA 2AXLA 3GYHX 1DUXC 3HRMA 3WTXC 2RC4A 1XGMA 1P2FA 2JTVA 3KLNA 1MJ9A 3JTGA 2A6HF 2IA1A 3OOPA 4UVBA 2ELHA 1IW7F 2IPQX 1D8KA 1WWXA 2R3SA 4EQQA 3GFMA 5E8GA 2XASA 4U0VA 2F5DA 3KP7A 2HKOA 4IRIA 2YX7A 1KGSA 3Q9VA 2CWEA 5BQTA 1ZRDA 3D5LA 1YLFA 3L09A 2VBZA 1FOKA 4AIJA 4LB5A 2A3SA 2WWYA 1B1BA 3CUQB 4ZYEA 4E70A 1KQ9A 4G7OF 1ONVA 3HSRA 2CGPA 5DUIA 2FMLA 2GA2A 3QU3A 2H6BA 3K9TA 2OAZA 2HFHA 2OBPA 3MEXA 4HLXA 1WQ2A 4S04A 4GXOA 3C3WA 1XDSA 1T38A 3K1MA 1KU7A 1T98A 2IRFG 1ZAOA 3F8MA 1IN8A 3GZ6A 2EA2A 3BJAA 3WE2A 1G4DA 4IPAA 3SQNA 4A6EA 5DCMA 3RKWA 1S7AA 3WGHA 5JVTA 4MTDA 3RDIA 3U2RA 1L3LA 2GA1A 2GIVA 3BJOA 3DV8A 2BBYA 1ZG3A 2VXZA 3V8KA 3HSEA 1CGPA 4KUMA 3M8EA 4H0EA 1XCBA 2NYXA 4Y17A 3HUGA 3J81Z 1SD4A 2M30A 1IRFA 1ZG5A 4KNYA 1J59A 1F1ZA 3KZZA 1Z05A 2QQ9A 4OOIA 2EFWA 3ISPA 3U9GA 3WTUC 1SFUA 2P7VB 4UVAA 2OD5A 5CLSA 2XIGA 5JI6A 5ILUA 2XVCA 1ZYRF 2HYGD 1T6SA 1DPRA 1EH6A 1I1SA 1ULYA 4HDUA 4ON0A 5D5WB 4FT8A 1WSUA 3MFKA 1XCVA 3RKXA 1FBUA 3NRVA 1C0WA 2PQ8A 2K4BA 3B02A 2Q8KA 4LFUA 4HLYA 5DDGA 3ELKA 3Q9SA 3HHHA 4P96A 1ZGJA 2QZ8A 2KIUA 3T8TA 2DQLA 2XKPA 1LVAA 3GFJA 4BHPA 1ZG1A 2FMYA 2EV0A 4LLGF 3FZVA 4CDGA 3J80K 1DDNA 2FOKA 4S05A 5H6QA 1ZREA 2H6CA 2CQKA 1QGPA 1YO5C 3BZ6A 1FPQA 1PUEE 2LSOA 1B4AA 2XGXA 3KLOA 4GGGA 3F21A 4JK1X 3SZPA 4MTEA 1STZA 5DD8A 2ISYA 1ZRFA 3EETA 3QU6A 3EDPA 2VC1A 4G8XA 1Z91A 3HRTA 5LHIA 1SD5A 6PAXA 1PP8F 2MD5A 3RJPA 2QENA 5HS9A 1LB2A 2CYYA 2STWA 2CG4A 3RYRA 3P9KA 3RI4A 3WTSC 5ICGA 3ZPLA 1QQIA 2MC3A 2ZCWA 3CTAA 3JW4A 1XSXA 4HF1A 5ERIA 4HF2A 2AS5F 1HW5A 2CW0F 4Q5SF 4R1HA 1W5TA 1FP2A 2EFNA 3B73A 3RIRA 4YG2F 5L3CA 4L9JA 4EM2A 1U3EM 5LEKA 2EA4A 3MZYA 1HKSA 3AAFA 2IP2A 5CVJA 5DV5A 4UHTA 1USTA 2TDXA 4HX4A 2DQRA 2J5OA 2YSRA 5HS7A 3FXQA 1J75A 1YQAA 4L9TA 1TQIA 1LDKB 3I4PA 2Z3YA 2QUFA 4EMSA 2VN2A 1G3YA 2Z99A 4KIGA 3E6BA 4MQ9F 3LQRA 3HOSA 5DEQA 2NAZA 4MGRA 5K5OA 3TDUC 2PMUA 2YX4A 3I0TA 1Z1DA 4XRFA 2ACJA 4WK8F 4O3MA 4L5JA 1FZPB 3V7SA 1ZHFA 2EFQA 3LSTA 4JQFA 3BWGA 2GAUA 5F6FA 2G7UA 4BNCA 4L0YB 1YYVA 3PQKA 3KETA 3CO6C 3BOQA 3WTVC 1U78A 3TO7A 2YR2A 2R7DA 4WWCA 3MCZA 4YIFA 2L3DA 2WC2A 4P5OA 3CUQA 3ZN1A 1YW9A 2DK5A 1O3RA 1B9NA 2DK8A 1MD0A 3FM3A 1YIOA 2M8EA 2W85A 1RUNA 2HOEA 2Q2EA 3FX3A 4EJOA 2FSWA 1KA8A 2PEXA 2JPBA 2L01A 4FX4A 1EH7A 1TLHB 3L2CA 4G7ZF 3ZP5A 1IUYA 2M5WA 4M73A 1HW2A 4XLNF 1RUOA 2VOOA 4RB2C 1RI7A 4EM0B 1IN5A 3M1EA 2VT2A 3BPVA