4ZYDA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
LVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPAHRVIAENGIGGYSRGVKLKRALLELEGVKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 38
structure length 149
sequence length 149
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zydA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zydA01
2BEOA 2BYVE 4RB1A 1XSXA 1QO0D 3GLXA 1LVAA 1ZH5A 1TQMA 4G7ZF 4A6DA 4BYYA 3RDIA 2HWVA 4F7ZA 1RZ4A 4HYEA 2Q8KA 2XROA 3RI4A 1D5VA 1Z1DA 3GZ6A 5JR3A 2BGCA 3QP6A 5CVRA 1B4AA 1HKTA 4EVIA 1V4RA 1P4AA 2HEOA 1BI1A 3J81K 4JBAA 1B59A 1WSUA 4YFXF 1YW8A 1CF7B 2BE5F 4ZYHA 4OINF 3KE2A 1LQ1A 3W6JB 3ECOA 1KU9A 2JPCA 1J59A 3T8TA 4S05A 3J7AO 3M7GA 5BMZA 5F6FA 3ZP5A 3JTGA 1BIAA 3TO6A 3QU3A 1RI7A 3E5XA 4G94A 1Z6TA 5TRDA 2FSWA 4HV6A 1T2KA 1IN4A 3PFIA 3ROUA 2AS5F 5D6EA 3IWZA 3D5LA 3WTYC 2OBPA 1G3SA 3K1MA 4P96A 1ZLJA 4NB5A 3WGGA 4A0XA 1OPCA 2L3DA 3KP4A 5BPIA 5FFXA 1PP7U 4UV8A 3BROA 1DPUA 4H0EA 3BPXA 3I4PA 5HDKA 1TNTA 1QQIA 2QQAA 2YSRA 2O8XA 2FBIA 1R1UA 2H6BA 2ZFWA 3O2PE 4IRGA 2A68F 2VE9A 2H6CA 3KLOA 3QRFF 3SFZA 1RUOA 3GVAA 4RAZA 2PLYA 2VT3A 4Y13A 2YU3A 1ZAOA 3HHHA 2EA2A 2W57A 2FF4A 3V8LA 1MD0A 4ZYGA 4ETSA 4IHSA 1S7OA 3M1EA 4MEYF 4A5MA 1SD4A 1RIOH 4R8HA 4BHBA 2VN2A 2W24A 5LRRA 3SZTA 1B9NA 3WGIA 3FMSA 5LLQA 2L02A 2L4AA 1VTNC 3R61A 3MWMA 4WX9A 2CQKA 3FF5A 4P55A 2RV8A 4IRHA 5HS8A 4CICA 3C1DA 3DPTA 2E1CA 3IKTA 1HKQA 3HSRA 4P9FA 3BJOA 1FZPB 2P5VA 1W5SA 2EFPA 1W7PA 3P9KA 3OV8A 4CZZA 4UHTA 1X3UA 1FT9A 3I54A 5ED4A 1TTYA 4YFNF 2LF8A 2IJLA 1D3YA 1WRJA 3VFZA 1Q1HA 5D4SA 1I27A 3SXYA 3H3ZA 4L9TA 3DQVC 3WTZA 1YW9A 5D4RA 1REPC 2HS5A 2QYOA 4HF0A 1FPQA 4ENKA 3L7WA 2CG4A 5HLHA 4A6EA 2F5CA 1YTYA 3JAMZ 5K5QA 2YPRA 2RN7A 3KEOA 1IAWA 2VBZA 4PGHA 3HUGA 5BPDA 3I59A 4KIFA 4AIHA 2VBWA 5L3FA 1OYIA 2JSCA 4KFCA 2OD5A 1TW2A 1TQIA 1I1GA 5IT3A 1U5TB 2HQNA 4G9YA 1AWCA 3SQNA 4A0YA 2RGVA 1UCRA 4BAYA 3T8RA 2IA0A 3GX4X 1PDNC 4Q47A 4NQWA 5LGUA 4I09A 1R58A 2YR2A 2DQLA 3DPLC 4MGRA 4MTEA 4U7BA 2VE8A 2HYFA 3RYRA 3ZN1A 2GAUA 1E2XA 2D45A 1MDMB 5L3CA 3IL2A 5K1YA 4LG0A 3BP8A 2ESNA 4LB5A 5E20A 3SHFA 3C7JA 4OIPF 3WTTC 1QZZA 3ERED 3Q9VA 4WK8F 5ICCA 3BWGA 5JFRA 2XAGA 5L3BA 2XAFA 2M30A 2IRFG 2CFXA 2IA1A 2HOEA 2H94A 2DFIA 1L3LA 1DPRA 2A6EF 4KIGA 2XAJA 4N9HA 4UUVA 3GF2A 4UVCA 4YIFA 4OMZA 5BS6A 1E17A 3L09A 1FP1D 5KK1A 1FC3A 2A5YB 3TO7A 4UVBA 3QPTA 3U9GA 2KJBA 2VXZA 4KIBA 3CUQC 2HTJA 4Y15A 5DCMB 4RB2C 4U0WA 4ASNA 4UNOA 2A6HF 5AIPA 5ICFA 4O5VA 1MKMA 2GA2A 2PBIA 1XGMA 4AVPA 2V1DA 2PQ8A 3ABTA 4OOIA 1OKRA 1B6AA 1ZRFA 3DXJF 3ZMSA 1G6NA 1U5TC 3MZHA 1SD7A 1HSJA 1O7LA 2EFNA 2V79A 2RDPA 1IN5A 3MCZA 3ZN0A 2BV6A 3ZQ7A 1F5TA 1LNWA 4OIRF 2FRHA 1UB9A 4ZZDA 4G6DA 3K9TA 2G7UA 3QP5A 3GFJA 1T98A 3KZZA 3ZMVA 1WWXA 3F8CA 1ON1A 4IPAA 3MFKA 1K79A 2UWMA 5ERIA 3HTUA 4KMUX 4LLLA 4Z2YA 2Q2EA 2PMHA 3F6OA 3N4MA 3EUHA 1FX7A 1TLHB 5H20A 3B02A 2A69F 4PDKA 4U7DA 2EA4A 2XV4S 3HYIA 3F8BA 5CVVA 4EJWA 2XGXA 1S29A 2CO5A 1CGPA 2HGCA 3F8MA 2Y75A 5CJ9A 1SAXA 3BZ6A 5ILUA 4IF4A 4EM2A 5JI6A 1TNSA 5K5OA 2K7LA 4M9SA 1K78A 2K02A 1QBJA 2PN6A 1XCBA 4XRFA 4G6QA 3HOSA 2P7VB 2JT1A 2ZJ2A 3LA7A 1SMYF 3ECHA 3KEQA 2ETHA 4I7HA 5D5VB 4GYIA 5DUKA 1S8NA 3F21A 4YG2F 3WGHA 5FLXK 3ZMDA 2A61A 1XN7A 4S04A 1FP2A 4A0ZA 4GXOA 2HR3A 3F6VA 2FA5A 2HDCA 2EJRA 3FZVA 2VODA 5DCFA 1EH8A 2O0YA 5F1RA 3I58A 2O6GE 2QWWA 4HX7A 4PZJA 4MHGA 1XGNA 2ZO4A 2QM3A 1R5GA 3EETA 2RNJA 4MNUA 3IKVA 2BBYA 1FSHA 1LEAA 2PFBA 2WV0A 2FMLA 1L0OC 2A07F 5H6QA 3I53A 2R7FA 1IRFA 1OR7A 4LMYA 1YIOA 4R1HA 1HKSA 4PCQA 3K1NA 3VEPA 2UZKA 3M9AA 4YIIA 2LSOA 3IHUA 1SD5A 3FM5A 5L3GA 2JTVA 4LB6B 1FYMA 4TV7A 1FNNA 3LQQA 1HW1A 1IN6A 2FU4A 3I64A 2F5FA 1HQCA 4WCGA 2F2EA 3P7NA 1FBUA 1ONVA 2Y0MA 2OAZA 2R7DA 1O3SA 3QAHA 4RB0A 2AXLA 5H6RA 2VT2A 1BC8C 1P92A 3E3VA 2DTRA 2Z5UA 3V8KA 3COAC 2JRTA 4R79A 2COMA 3I71A 4GYGA 2K4BA 3KLNA 1BM9A 3HSEA 2XVCA 2DLLA 1KYWA 2OZUA 1GXPA 2Y48A 3WTSC 1FBSA 1R7JA 2DK8A 2DAOA 1ZARA 2V6CA 3EYYA 3GWZA 5CLSA 1R22A 3W6KB 3E6CC 1GVJA 1AOYA 5LEKA 4RB3C 4A5NA 1XD7A 2PI0A 2KIUA 1KU7A 4KICA 3VB2A 5HDNA 2P4WA 3ABUA 5ICGA 3G3ZA 3LFKA 4ESFA 4RGSA 2A3SA 3GXOA 5E18F 3CJNA 3FMQA 3H92A 4FX0A 4B8XA 1P6RA 2QENA 4XBFA 2D1VA 4IHTA 2CYYA 3F23A 1USTA 1UFMA 3BDDA 4EJOA 3ULQB 4EM0B 1T6SA 1W7PB 2F5DA 3M8FA 2STTA 2E7WA 3V7CA 3DEUA 4OIOF 1YG2A 3WODF 1R5HA 4EJVA 1W4MA 1ZRCA 4B09A 2MLGA 3DFGA 5AIQA 3B73A 3D0SA 1O3RA 1KQ9A 1ULYA 3VODA 3J81Z 1T38A 2XASA 4LLNA 3TOBA 2IVMA 4M6XA 4UVAA 4EJTA 2X4HA 2ZMEB 1ZG1A 4XSXF 4OMYA 1XB4A 2ACJA 1ZREA 2EV5A 3CUQB 2STWA 1R36A 2ESHA 3KP6A 3KFWX 4JQFA 3C18A 4EMSA 2P6SA 3BJ6A 4I98B 4AIKA 3LWFA 3FXQA 5KVRA 2GZWA 5FB2A 3N97A 3GFLA 3BPVA 5E17F 2K4JA 2G9WA 2WC2A 5D6FA 3LA2A 2H27A 5K5RA 1HSTA 4HW0A 1BOAA 1SFXA 1S6LA 2XRNA 2M5WA 2ADUA 1U8RA 4KYWA 2CWEA 1O3TA 1U2WA 1ZG3A 1H9GA 3GO5A 1IF1A 2CW0F 3TKYA 2L4MA 5A2QK 3RIRA 1MJAA 2RKHA 5F64A 2UXXA 4HA8A 4LG0B 1LJ9A 5LHGA 3KP3A 4ENJA 2FNPA 2FMYA 3GFIA 4L9VA 3RKXA 4RGUA 2FQ3A 3CLOA 3K0LA 3RKYA 3K2ZA 3WU1B 1D8KA 3R0AA 5ILVA 1R1TA 4L5IA 5FO5A 4M74A 1YS6A 5HDGA 2ZKZA 3ZMZA 3PQJA 4ZH4F 3J80K 4UXNA 2L01A 1DP7P 3BY6A 4LGWA 3HRSA 2HQRA 2XAHA 3DF8A 2ZXJA 3R0JA 3WTVC 4UV9A 5HLGA 2OQRA 4G7OF 1G3WA 3LSTA 1GHCA 1S7AA 2J5OA 3EYIA 1O57A 3FX3A 2E7XA 1EV7A 2GXGA 2FBHA 4EQQA 2KKOA 1JHFA 3O6BB 3I5UA 2EV0A 5DUIA 2IPQX 5LGNA 5IT9K 1XMKA 3MEXA 1XGOA 1R23A 4HZFA 2XKOA 2V1UA 5TJJA 2MLKA 1J9IA 5D8KB 2EFWA 4MTDA 3TQNA 1OYYA 1USSA 2EFOA 4L18B 1IN7A 5LBQA 3P9IA 1XSDA 2VOPA 2ISYA 4L0ZB 2IW5A 1W7PD 4AWXB 3V4GA 2XAQA 2P6TA 2Z3YA 3FHZA 2P5LC 1ZLKA 2XIGA 1ZGJA 3RYPA 1OYWA 5DCMA 2FBKA 1LEBA 4CXFA 3WTUC 4M71A 2MC3A 5D5UB 1ZRDA 4GCVA 1BI2A 4P5OA 3JSPA 3LA3A 2KJCA 1MJBA 4QLCU 3TDUC 4Y17A 2OU2A 2QVOA 3K69A 2DK5A 1BI3A 3GFMA 4ENMA 2MH9A 1LB2A 3F8NA 2RC4A 3TO9A 1FYLA 2ISZA 2KIFA 2V1XA 6PAXA 2HKOA 2PJPA 1SD6A 2CSOA 1LDDA 3WE2A 2IT0A 3DKWA 4BHPA 2Z33A 5EEHA 5E1XA 3RTRA 2LNBA 1IUYA 1UHWA 2FOKA 4GGGA 2HKXA 3IRQA 3HOTA 3LAJA 4KA4A 3FXUA 1K78B 1KU3A 5D5WB 5E8IA 3MQ0A 5FD5A 2YX4A 4BNCA 2V9VA 1I1SA 4BH9A 3DP7A 4RGXA 2NS0A 4M73A 4I0AA 5EEGA 1FBQA 4U0YA 3KCCA 1XCVA 5DEQA 4BXUA 2JPBA 4YFKF 4HF1A 5AONA 2C6YA 1IZ1A 1F1ZA 2RQPA 4AD9A 3L00A 3HTSB 3KP7A 4L9NA 1TBXA 3FM3A 5HOOA 1JGSA 1ON2A 1P4XA 4EV0A 3ZMUA 4LK1F 5J8FA 1SFEA 1YS7A 1ZYRF 2KIMA 3TDZC 1WKMA 2R3SA 4XLNF 1Z91A 3AAFA 1FOKA 3CUOA 4N0BA 3F3XA 2DW4A 4M6YA 2GWRA 4ESJA 3REOA 4BHCA 4OU0A 2MD5A 3WTWC 2QBYA 3NQOA 5CVUA 2O61A 2Z9OA 3GZ5A 2ZNZA 1R00A 5CVIA 3O3KA 1FLIA 5DD8A 5E1ZB 1MJ9A 3CTAA 3JTHA 5HS9A 3RPQA 4O6JA 3G73A 1J2XA 4PGGA 1T39A 1J5YA 2VOOA 2G7HA 2JZYA 1FWZA 1BJAA 4CHUA 3K1PA 5ILSA 1IXRC 3RPUA 2K27A 3R4KA 1G3TA 1H0MA 3JSOA 2W85A 2DPDA 3IWFA 4HX8A 4QWQA 1YO5C 3T1BA 4KUMA 1J75A 5DV5A 3U2RA 1IW7F 4DQ2A 2HYGD 4IJAA 3U1DA 4OIQF 3Q5FA 2K86A 2LF7A 3ML6A 1G3YA 3GUDA 3FXRA 2NNYA 1IXCA 1YYVA 2QLZA 2FE3A 2DO7A 4I2OA 1MGTA 4LJZF 1SFUA 1J0RA 2IP2A 1CF7A 5DDGA 2WWYA 5J6XA 2D2WA 1LDKB 3JAMK 2NYXA 2ZBKA 2EV6A 1PP8F 3ELKA 4CDGA 2GQQA 1BC7C 4LD5A 3V7SA 1P2FA 1IXSB 3V8JA 3IRRA 4WXHA 4KNYA 1F4KA 4L0YB 2QQBA 2GXBA 4JK1X 4RGRA 5E8GA 1S3JA 4WWCA 3DV8A 4K2EA 1Z7UA 5HVQC 3V7RA 3HRMA 3C3WA 1B1BA 5BOXA 4HDVA 3CDHA 4CGZA 3TGNA 2WTEA 1IN8A 2XUBA 2EK5A 4AIJA 2MH2A 4EGYA 5D8LB 1SMTA 5FLXZ 2DBBA 2DU9A 5LHHA 2EWNA 5FFZA 2HFHA 5ICEA 4NHJA 2MA3A 3E6DA 3GYHX 2VC0A 1O7FA 5LEJA 1TQPA 1KA8A 3LAPA 3LQRA 1J7KA 5DD4A 1BIBA 1FSEA 2L54A 2UXNA 3Q9SA 4A12A 2YX7A 2RVCA 4ENNA 3R6SA 1YQAA 3OOPA 3EQLF 1G4DA 1XDSA 1BI0A 3L9FA 4LK0F 3F8FA 4MQVA 1XSVA 1WI9A 5LGTA 5JVTA 4ZYEA 3CO6C 5HLIA 3ISPA 2VBXA 4HF2A 4N9IA 3NEUA 1W5TA 4U0VA 1Z6RA 3RKWA 1U3EM 1A04A 2XKPA 3I59B 4EGZA 3R60A 2E1NA 1EH6A 1BN5A 2M8EA 1ZG5A 1ZN2A 1QNTA 4XLPF 3KZYA 4ESBA 1R1VA 4ZYDA 3GEZA 2B0LA 3E6BA 2LKPA 3WTXC 2ZMEA 3MZYA 4KDPA 5HS7A 1XDUA 4M9ZA 1KQ0A 4MEXF 3CUQA 4U88A 3HIFA 3F72A 4KMFA 1BBYA 1Z05A 5J8CA 1DDNA 1U78A 4FT8A 3L2CA 2CGPA 2GA1A 1LDJA 4I02A 2OA4A 4O3MA 1FY7A 3QPHA 5JHUA 3E5UA 3BJAA 3SZPA 3S2WA 4EJUA 2GIVA 1TW3A 4ZZLA 5LHIA 1JHHA 1U5TA 1DUXC 1XMAA 3HRTA 3T0YA 3QOPA 3FWEA 2O03A 4IRIA 2ELHA 2HZTA 2M45A 2X0LA 4HOBA 1WQ2A 1KU2A 3KP2A 5FGMA 4BQAA 4WXDA 2HTSA 4P9UA 1U6GA 2VC1A 1HW5A 4MQ9F 3HSFA 1JXSA 1MDMA 4RAYA 4HV5A 2M1BA 3E97A 4HLXA 1NHAA 4CYDA 5BQTA 1ZGAA 3HRUA 4HX4A 1YLFA 1Y0UA 4WF2A 1IRGA 1ODDA 2W84A 1PUEE 5CVJA 1EH7A 2FNAA 2QZ8A 4Q5SF 1FYKA 3MAJA 3FMRA 4RS8A 2TDXA 4G8XA 1K6OA 4DNCA 5D5XB 1HXDA 4KN7X 2FXAA 3ZMTA 4GO1A 2EB7A 1O3QA 5DYMA 4IXAA 3H3UA 2IA2A 2MBFA 4E70A 1ZHFA 4ON0A 1XGSA 2XHKA 3IC7A 2H09A 1KGSA 1QPMA 4FHTA 1YW7A 2OZ6A 5E1WA 2PEXA 2Q0OA 2VBYA 3P9CA 3T5XA 1B9MA 4KT5C 1I6XA 2QUFA 2NAZA 1T0FA 2D1HA 2QQ9A 1HBXG 3QU6A 2KRFA 4HQMA 3F22A 1F9NA 4M72A 3KETA 4XSZF 4I0BA 2EFQA 1RNLA 1I5ZA 2OQGA 4G7HF 4D0PA 2DT5A 4I01A 2NNNA 3E5QA 3WE3A 4M9XA 5A2QZ 2PMUA 1C0WA 4WXCA 3BOQA 2DPUA 3I0TA 1QGPA 3VOEA 5L3EA 3EDPA 2DQRA 4EM1A 5CYVA 4Q4ZF 2LDUA 1STZA 5L3DA 3WU0A 1H9TA 4Q48A 3HHGA 3KP5A 1V3FA 4FX4A 1GXQA 2O3FA 1UHMA 3TOAA 5FD6A 1D8JA 4KN4X 3JW4A 3RJPA 1K7AA 3PQKA 4HAMA 2FEZA 4LFUA 2DI3A 2NRAC 5LRSA 4L5JA 2F5EA 1JE8A 2ZCWA 3J80Z 1P4WA 2Z99A 3E6MA 3GW2A 2PG4A 4HBLA 2VONA 1QZYA 1KYZA 1OMIA 3CO7C 2P5KA 1KQ8A 3M8EA 4IVNA 3WG9A 3NRVA 4CO8A 3ZPLA 2J5PA 1RUNA 4LLGF 2P8TA 2QBYB 2ZNYA 1MZBA 1HW2A 4HQEA 1Z9CA 2W25A 2M87A 2P7CB 1YFHA 5IT9Z 4HLYA 4HDUA 4L9JA 4A2UA
chains in the Genus database with same CATH superfamily
3J7AG 2BEOA 4LG3A 2R7XA 3BGHA 1T4NA 2BYVE 4RB1A 2CRGA 2XF6A 5JVGF 1XSXA 1SVOA 1QO0D 4X6AJ 1BBOA 1Z67A 3OMYA 4E7JA 3HB9A 5EYRA 3GLXA 1LVAA 2EPXA 1X6FA 2CT1A 5T6JA 3FBIB 3BG5A 5F27A 3DJWA 1ZH5A 1X6HA 2NVQJ 1TQMA 4G7ZF 1VQPI 2QSHX 4DR2E 4A6DA 4BYYA 3RDIA 4DV5E 1BBGA 2HWVA 5KL6A 1XPXA 1D0XA 4F7ZA 4DIQA 1RZ4A 4HYEA 2Q8KA 3S1MJ 2XROA 1T4LB 3RI4A 4MO7A 2X1DA 1Z1DA 4BKXA 3GZ6A 5JR3A 1D5VA 3D5SC 5KHDA 2BGCA 3QP6A 2K9QA 5ADZA 4QPOA 2E34A 5CVRA 1WJBA 1IGNA 3BT9A 4F93B 2EPKX 1X4OA 2EL5A 4E7SA 2LT7A 2I9IA 1U9NA 5J40A 1QU6A 4J00A 4NHRA 1B4AA 1HKTA 3W2WA 1V4RA 4EVIA 1P4AA 1VFCA 5H2FC 3OYDA 1BI1A 4RAFA 2VQGA 3OYGA 3J81K 2HEOA 2EOFA 1TT5B 4JBAA 3WG7H 2L2OA 1B59A 2XF7A 1RETA 3HOZJ 2DN0A 2E1OA 2B7TA 4B48A 1TP4A 2LTRA 1WSUA 4YFXF 1YW8A 1VI0A 1OCTC 1CF7B 4PK4A 1XNRE 2BE5F 1ZKGA 4ZYHA 3PUFA 1MBHA 2VPLA 4OINF 3KE2A 5TSEA 1LQ1A 4BC9A 4ZDLA 3W6JB 3ECOA 1KU9A 2X9DA 4E7KA 1VQMI 2JPCA 3IWCA 1J59A 3T8TA 4S05A 3J7AO 2UV1A 3M7GA 3THNA 5BMZA 2JWOA 5F6FA 3ZP5A 3JTGA 1I94E 4LFAE 5EZHA 1BIAA 5A6BA 2R7ZJ 4H4KC 3HGYA 1X3CA 3TO6A 3PM1A 3QU3A 1RI7A 3E5XA 3OSGA 4G94A 1Z6TA 1HDPA 3BR1A 2EMFA 5TRDA 2FSWA 4HV6A 3VYXA 4J19A 3J81C 1VQ6I 2OCCH 1IN4A 3PFIA 1T2KA 1AU7A 3VSKA 3ROUA 3OY9A 2MDRA 1AKHA 3ABMH 4RHBB 2AS5F 5D6EA 3IWZA 3BG3A 3D5LA 4XN0A 5IYBJ 1FMVA 3WTYC 2L9SA 2H1LA 2L92A 2JVHA 4Y7NJ 2JOBA 2OBPA 2MC4A 1G3SA 2DYSH 3DKYA 1HF0A 5M5WJ 1A6IA 3K1MA 4P96A 1ZLJA 4NB5A 2ENHA 3WGGA 4A0XA 1OPCA 3C2BA 2L3DA 3KP4A 1X48A 5BPIA 2L3CA 5FFXA 4XL9A 2FQ4A 4V2FA 4UV8A 1PP7U 3BROA 1DPUA 4H0EA 3BPXA 3I4PA 5HDKA 2QEXI 1TNTA 1QQIA 2QQAA 2YSRA 3QG5C 2O8XA 1MSEC 2FBIA 1WI3A 1R1UA 4ABZA 2H6BA 2LRSA 2ZFWA 3O2PE 2ECBA 3NWTA 4IRGA 2LD5A 1LPQA 3TMOA 3TBIA 3OYHA 2A68F 2VE9A 4AM3A 2H6CA 1SR9A 3KLOA 5DM6F 3QRFF 3SFZA 1X2NA 5IOZA 3CCRI 1JKQC 3CMMA 1RUOA 1PJTA 2DFHA 3GVAA 5IYCJ 1OR7C 4JI8E 4DR4E 4K0KE 2HI3A 4RAZA 2PLYA 2HQAA 1YRNB 4W1UA 2VT3A 1WH7A 2WV1A 3LSHA 5J1YA 2EM3A 5A6JA 2IAIA 4AYBA 4Y13A 2YU3A 1ZAOA 2EMCA 3AV0A 3HHHA 4EATA 2DLQA 2EA2A 2LH9A 2XPUA 5FLVA 5KL4A 2DMTA 2LKXA 4Y4RA 5C4XJ 1ZU1A 4YY3E 1P7IA 2W57A 2FF4A 3V8LA 1MD0A 4M3BA 2YRHA 2DMQA 2X6XA 2R92J 4ZYGA 2Y0SA 3FXMA 4DJAA 3GBGA 4ETSA 5KAFC 4YHHE 1PYVA 2LC2A 1S7OA 4IHSA 3M1EA 1PJRA 3KX2A 4MEYF 3GTGJ 2M9HA 4LIUA 2IEKA 1N78A 3WU2C 4NDLA 4ZC3A 3H3VK 4A5MA 4LFBE 1ETKA 2FGGA 1IRXA 1SD4A 3CZ6A 1RIOH 4R8HA 4BHBA 2L2NA 2VN2A 2W24A 5LRRA 4Y3OA 3SZTA 1B9NA 2BVLA 3QOEA 3WGIA 3FMSA 5LLQA 1DU0A 2K7IA 2EPRA 2L02A 2L4AA 1VQNI 1VTNC 4C9YA 3R61A 1MEYC 4PJMA 1V5GA 1WHNA 4X8WA 3MWMA 1ZK8A 2BBGA 4M0VA 2KL4A 4WX9A 1O4XA 2CQKA 3FF5A 4JX5A 1SFOJ 4P55A 2RV8A 4IRHA 1DP3A 5HS8A 3BC8A 4CICA 1X2MA 3C1DA 3DPTA 3IH4A 3OWTA 4JOMA 2E1CA 1I6HJ 2RREA 3IKTA 1Y39A 1HKQA 3HSRA 4P9FA 4F9CB 4CYCA 3BJOA 1FZPB 2P5VA 1W5SA 4N4RB 2EFPA 1W0TA 2EOQA 2CSHA 2KISA 2F48A 1W7PA 3CCEI 4NXNE 3S8PA 3P9KA 2EWLA 1P47A 3OV8A 4CZZA 3S14J 4UHTA 1X3UA 1FT9A 3LSPA 3AFHA 3I54A 3GLLA 5ED4A 4CCNA 2XRLA 5EGOA 1A1FA 1TTYA 3FKJA 2QCOA 1K6YA 3SYTA 4FISA 3HXLA 2ENAA 2WBUA 4YFNF 2NVTJ 2EMHA 3RPUD 5TISC 2EMLA 3HOWJ 1BB8A 2LF8A 3VYYA 2EH3A 4JV5E 1SFKA 4BJ6C 3OYLA 2RTXA 4M3EA 3ZQQA 3JCUC 2IJLA 1MMDA 3OR2C 2B9SA 1D3YA 1WRJA 3VFZA 2EM7A 1Q1HA 4WSPA 5D4SA 5K7ZA 2HXIA 2XB5A 1A1IA 2L5QA 4MIMA 1I27A 3SXYA 3M3YJ 3H3ZA 2XPWA 4L9TA 2EM9A 3DQVC 2ZJRF 4DR6E 3WTZA 1YW9A 5D4RA 2HOAA 4MLOA 1REPC 1FJLA 2HS5A 2QYOA 2JVGA 4MFEA 2RPCA 1E3HA 1FPQA 4HF0A 4C3HJ 1D1AA 3ZQCA 4ENKA 3L7WA 2JR1A 2KHXA 4LFCE 2CG4A 2EPAA 4B3XA 5HLHA 1W5CC 2ENCA 1N32E 4A6EA 2VB6A 3CDIA 2W82A 2KQRA 2F5CA 1MMGA 3LL7A 2HPIA 2KZGA 1YTYA 3A4CA 3JAMZ 4DV0E 2M4GA 5K5QA 4RM3A 2YPRA 2RN7A 3PUBA 2CV2A 4A93J 3KEOA 4N4OB 1IAWA 2VBZA 1G59A 3VHTB 4PGHA 3HUGA 5BPDA 5F3WA 3OIQA 1RQ0A 2PRTA 3I59A 4KIFA 4AIHA 1A1GA 4PJLA 3I4MJ 4M9VC 2VBWA 2L7KA 2QF7A 4LF6E 2NA2A 2BY3A 5L3FA 2DSYA 1OYIA 2JSCA 4KFCA 4B3TE 2OD5A 4R2QA 2MFZA 2EMKA 1V54H 1TW2A 4IHVA 1LLMC 1MH3A 3F6HA 2DLKA 1TQIA 4O24A 2YTGA 1FIAA 1I1GA 3EPKA 5IT3A 1U5TB 1OCCH 2OV7A 2HQNA 2LKSA 2X6OA 1GZ6A 2L9NA 1IBLE 4LF4E 4G9YA 2CQ7A 3AG3H 4AVZA 1AWCA 1JUSA 3G1MA 3SQNA 1MMAA 1S5LC 1M1EB 2CUZA 4A0YA 5M5YJ 4R2DA 2RGVA 1UCRA 3KEYA 4BAYA 3T8RA 1N3GA 2IA0A 3GX4X 2E35A 2ZSHB 4Q47A 1PDNC 1GQEA 2F4OB 4XR6A 4NQWA 5M3FJ 3U21A 5LGUA 2D5VA 4IHYA 2YTQA 4I09A 2ZC2A 2Z2SB 3AKZA 1R58A 4LIVA 2YR2A 2DQLA 3DPLC 3CCSI 2EN6A 1SAUA 3NWSA 4MGRA 2EPNA 2M4IA 2DA6A 4FASD 4MTEA 4U7BA 2LVHA 2WAQA 1FJGE 2VE8A 2HYFA 3RYRA 3L1PA 2K40A 3BTJA 4AQYE 3ZN1A 2GAUA 1E2XA 4DYQA 2D45A 1MDMB 1BW5A 3I3LA 3RCOA 1MMSA 5L3CA 2EZIA 5K1YA 3IL2A 1IDYA 4LG0A 4DBRA 2LTSA 2VE7C 4XKWA 2YRKA 4P1WA 3BP8A 3HOXJ 2NS8A 2EMZA 2ESNA 4LB5A 2EOYA 5E20A 5IOYA 2F5VA 3SHFA 1WJEA 2EZ6A 3C7JA 4OIPF 4QSHA 3WTTC 1QZZA 4CZCA 1BW6A 3Q9VA 3ERED 2EOOA 3GTKJ 5C3EJ 4WK8F 4BDZA 9ANTA 5ICCA 3BWGA 3EUKL 4LF8E 5JFRA 1TF3A 1R6RA 3F0CA 2CV1A 2XAGA 4XM3A 2XAFA 3BR3A 2M30A 3RQIA 5L3BA 3CJRB 2CFXA 2IA1A 2IRFG 1YITI 1S9HA 3ONQA 2HOEA 2H94A 2DFIA 1L3LA 1DPRA 5GTIC 1WVRA 2A6EF 4KIGA 2GLIA 5FKKA 3SFIA 3CCUI 3Q3SA 4E7IA 4DR1E 2XAJA 2LCEA 4N9HA 4UUVA 4X62E 3GF2A 4UVCA 5B1BH 4YIFA 4OMZA 5BS6A 3CMYA 2XB0X 1E17A 1JJ6C 4D7NA 3L09A 3J7AY 4D5CA 2ZMEC 1FP1D 5KK1A 1FC3A 2V7FA 2DB2A 3OL4A 5LD2C 2A5YB 5F0FA 4MLVA 3TO7A 4UVBA 3HL2A 4I6ZA 5IWAE 3QPTA 2ICWG 1Z21A 3U9GA 2KJBA 2UU9E 2VXZA 4KIBA 3CUQC 2DJNA 2XDVA 2EN4A 2HTJA 4XN3A 2EILH 4GEQB 4IS1C 2MKDA 4Y15A 4RA2A 5DCMB 1LKXA 4RB2C 4U0WA 2R93J 2NXNB 4OAYA 4ASNA 4UNOA 2A6HF 2LMZA 1TN9A 3OOUA 3M8JA 5AIPA 5ICFA 4C3IJ 2E1MB 4O5VA 1ZGWA 1MKMA 2GA2A 2PBIA 4DR5E 3HEFA 1XGMA 3DKXA 1Y0NA 4AVPA 2V1DA 2EMBA 4Z6YA 5EZGA 4AYBN 2COBA 2PQ8A 2TRTA 4BU2A 4CH7A 2HXOA 2KZVA 1UAAA 2CH0A 3ABTA 2KDZA 4OOIA 1OKRA 3FK7A 3OIOA 1B6AA 1HR0E 1F2IG 1ZRFA 5GPAA 2HDWA 4HRIA 4IO9F 3DXJF 3ZMSA 1JTYA 4FE7A 1G6NA 1U5TC 2JUCA 1DQUA 3MZHA 2Y0SN 1SD7A 1HSJA 1O7LA 2EFNA 2YTOA 4F9BB 2VKDA 3ESWB 2V79A 2RDPA 2R1FA 2BW3B 3VPRA 1IN5A 3MCZA 3BTCA 4GKKE 5FKLA 1MH4A 1YYKA 2ZB9A 3A01A 1UHZA 4B3RE 4XIDA 3ZN0A 2BV6A 3G1OA 5J1RA 4P78A 3ZQ7A 1F5TA 1HNXE 1LNWA 4OIRF 2FRHA 3H0GJ 2VKHA 4LITA 1OISA 2OCEA 1UB9A 3FXOA 4ZZDA 3OYFA 4JI2E 4G6DA 3CC2I 3K9TA 2G7UA 3QP5A 3L2WA 3GFJA 1T98A 2IGOA 4CCKA 3K70C 1DI2A 3KZZA 3ZMVA 1PKPA 1QVUA 1WWXA 5F08A 3F8CA 4M6VA 1R5ID 5F04A 2R0QC 4HTGA 1ON1A 4IPAA 3MFKA 2R5YA 1K79A 2IXSA 2G0EA 2UWMA 5ERIA 3HTUA 4KMUX 2HHHE 3FHNA 1YHQI 3LSIA 2GPIA 4LLLA 5AE1A 4Z2YA 2W00A 2Q2EA 2PMHA 3F6OA 4B1RA 4KISA 3N4MA 2CQQA 3EUHA 2PJRA 1FX7A 2VQCA 1TLHB 2CV0A 5H20A 3B02A 4N4NB 2A69F 4L5NC 4PDKA 4U7DA 2Y9ZA 2EA4A 2XV4S 2YWQA 4OOGC 1KZHA 3ADLA 3HYIA 3F8BA 2V89A 1ETOA 5CVVA 2DXIA 4BUPA 4EJWA 2XGXA 1S29A 2CO5A 1CGPA 2HGCA 3F8MA 2JA8J 3IWDA 2Y75A 5CJ9A 2I13A 2MW8A 1SAXA 3BZ6A 1BOBA 2R4GA 3CC4I 2YSPA 1D0YA 3VSLA 3S15J 2Z1DA 2CTDA 2AQEA 4NXME 5ILUA 4IF4A 4EM2A 3PO3J 2GXAA 5JI6A 1AH5A 2ELZA 1TNSA 4DOZA 2KHMA 5K5OA 2K7LA 2EM4A 2EPFA 2LBFA 4RLQA 2F4VE 3KYLA 1X5WA 1D1BA 2ELKA 4M9SA 2E1MC 3SEQA 1K78A 2ZM6E 2K02A 4FQGA 1QBJA 5A69A 3EQ1A 2DOAA 2PN6A 1B72B 1XCBA 4XRFA 3E7LA 2EMIA 4G6QA 3HOSA 2QQ8A 3ZRGA 2P7VB 4KT6A 2V6EA 1IV8A 2JT1A 2ZJ2A 1SMYF 3LA7A 3ECHA 1VQ7I 3KEQA 3M99B 2ETHA 5IP9J 3GTQJ 3PSIA 1A35A 4I7HA 5D5VB 4D5FA 1UZCA 3EPLA 4GYIA 3PIOF 1TWAJ 5DUKA 3D5RC 2EMGA 4G6TB 1S8NA 3F21A 4UUTA 4YG2F 2GOMA 1T0FC 1X58A 4NUBA 2HU9A 3WGHA 5FLXK 2VKEA 3ZMDA 2A61A 2QSGX 1XN7A 5HNHA 2ZXIA 3K4NA 4S04A 2JK3A 3ASNH 4A3GJ 1TZLA 1FP2A 4A0ZA 3KIOA 1ERDA 1A1HA 1YZ9A 1H89C 4A3BJ 4GXOA 4HNVA 4R2SA 3H9JA 2HR3A 3F6VA 2FA5A 2RQLA 2VJIA 4XLFA 2BHZA 2EJRA 2XF5A 1TWGJ 2JN6A 3FZVA 4AIDA 4XLAA 5M5XJ 2VODA 5A6AA 1IQOA 2LG4A 3MKZA 5DCFA 4P7DA 4X64E 2I8DA 3SDBA 4HSRA 3RQ4A 4E7ZA 2V85A 2HJJA 4ZDPA 2MC5A 1EH8A 2O0YA 2E5NA 5F1RA 1YX5A 3I58A 2O6GE 3I4NJ 2QWWA 2L2KB 2WAQN 4DV3E 4HX7A 2L33A 3BTLA 4PZJA 4O4KA 2VL8A 4MHGA 1XGNA 2CS3A 2ZO4A 2QM3A 1R5GA 3Q0VA 3EETA 2VQLA 2RNJA 2NUFA 3OYEA 1L4SA 4MNUA 4U87A 3VYTB 1X19A 3IKVA 5DM7F 2UUAE 3LFUA 3JTZA 4DKKA 3ZXSA 2EN8A 1DGRM 3WHCA 3FIGA 1QRYA 2BBYA 4R8OA 1FSHA 3DLAA 1V5FA 1T95A 3DCFA 4HEA2 2YUSA 1LEAA 2YTNA 2HDDA 4JX4A 2EPZA 1N36E 3PNYA 3QODA 1ZBQA 5AC5A 1PJSA 2PFBA 5GTHC 3BTIA 2X1CA 2WV0A 2FMLA 1L0OC 1Y56A 2B7EA 3HOVJ 2IS1A 2EPOA 4RH8A 2A07F 5H6QA 2JA2A 3TL4X 3I53A 1MBEA 1XX5A 2R7FA 4R03A 3JRAA 2YRMA 2ZXHA 4Q28A 1HNWE 1IRFA 4ZTJA 3ZQGA 1OR7A 4LMYA 1YIOA 4R1HA 1HKSA 2DTZA 1B8IA 1KJKA 1XMXA 4PCQA 2B7VA 3K1NA 2Y31A 4Q35B 2LOOA 4BS9A 2R76A 3FIWA 3VEPA 3ZQFA 2UZKA 3K4JA 3JREA 4R2RA 3C4BA 2EN1A 3M9AA 4YIIA 3K10A 2LSOA 2HVQA 3IHUA 2JJ7A 1SD5A 4W97A 3GTPJ 2EOZA 3FM5A 5L3GA 1LE8B 2JTVA 4LB6B 4M30A 5E3LA 1FYMA 1AKHB 4TV7A 5IP7J 1FNNA 2RQQA 2WADA 3C6KA 4IZZA 1WH5A 3LQQA 1HW1A 1IN6A 2FU4A 5KL2A 3I64A 5LFAA 2F5FA 1Z3YA 3QYEA 4I99C 1HQCA 4WCGA 3DU6A 2F2EA 3P7NA 3PJRA 1HOMA 2YZTA 1X1PA 1FBUA 3MHSC 1ONVA 2Y0MA 1POGA 2OAZA 2R7DA 3BQYA 3E1SA 3K4LA 3QAHA 2AXLA 4RB0A 5H6RA 2JXPA 2VT2A 1BC8C 2YU8A 1P92A 3E3VA 4C30A 1ETVA 1NK2P 2QGUA 2DTRA 2Z5UA 3DWLE 4XK4A 5FKMA 4XNFA 4LTYA 2DODA 3V8KA 5HNFA 3COAC 3Q0UA 2JRTA 3EPJA 4R79A 2COMA 3I71A 4GYGA 1P9QC 2K4BA 3KLNA 1BM9A 3HSEA 1RC7A 2XVCA 1DU6A 2DLLA 1KYWA 3HBLA 3THOB 2EZHA 2OZUA 2AHQA 2M7QA 4NBQA 1GXPA 2Y48A 3WTSC 3CMAI 1VQKI 3S1RJ 2YTDA 3LMLA 1FBSA 1R7JA 2DK8A 2DAOA 1JKOC 2ZJQF 1ZARA 4C2UA 2XC7A 4XLEA 1MMNA 3J7YJ 2VXDA 2V6CA 3EYYA 3GWZA 5CLSA 5EG0B 1R22A 3W6KB 3E6CC 1GVJA 1AOYA 2EL4A 2DFEA 3CJTB 1J5EE 2EM5A 5LEKA 4RB3C 1Z1BA 4A5NA 2V9PA 1XD7A 2RAEA 1Y1VJ 2EZKA 2PI0A 2KIUA 1U0JA 2ELYA 2DDBA 4BJTA 1KU7A 3BCBA 4KICA 1NTCA 3VB2A 3JRBA 5HDNA 2P4WA 3ABUA 1FIPA 2EP3A 3JRCA 5ICGA 2EOEA 5KNLA 3G3ZA 2DGCA 3LFKA 4ESFA 4RGSA 2A3SA 2QKMB 3GXOA 2CMPA 5E18F 1ZAAC 3CJNA 3FMQA 3J7Yp 4NC8A 5C44J 1HCRA 3H92A 4FX0A 3HG9A 3QYBA 2EPLX 4B8XA 1P6RA 2QENA 4AUXA 4PFPA 4XBFA 5FKNA 1YJ9I 1V5EA 4BEHA 4XORA 4XLHA 2D1VA 4KWYA 1YYOA 3I9V2 4DZPA 4IHTA 2DMNA 2CYYA 3F23A 1USTA 2VASA 1FOXA 1NEIA 2EOSA 1UFMA 3EPZA 3KYDB 2HOSA 3ZCOA 2P81A 3BDDA 4EJOA 4XRMA 2OTJI 2X6YA 3ULQB 3OYBA 2HVRA 4CYCB 4EM0B 3BF2A 2ZJPF 1A6QA 4DV1E 2XSJC 1R4NB 2NABA 1T6SA 3A1YA 1W7PB 2F5DA 1JT0A 3M8FA 3BR0A 5A6KA 2STTA 2JPAA 3HPSA 3HZJA 2E7WA 3OYAA 3ADJA 3V7CA 4D9JA 2CW7A 3RMPA 4S0HB 3DEUA 1TC3C 2DFFA 4OIOF 3S1NJ 5EGOB 3H5NA 1YG2A 1VQLI 2KRHA 2FJ1A 2WBSA 3WODF 2HDCA 1R5HA 3UKGA 2E72A 3ADGA 1YUIA 4M3FA 2YU9J 4EJVA 2E36A 4NC6A 5FROA 1HNZE 1W4MA 2WAEA 1ZRCA 4B09A 3TW6A 3PIPF 2MLGA 1HLVA 1SVLA 4WPYA 4I8OA 3DFGA 3DEEA 5AIQA 3CMEI 3B73A 3D0SA 1JK1A 1FKAE 1O3RA 1KQ9A 3QWLA 1ULYA 2MSYA 1D5YA 1OQYA 2KMUA 2E71A 2W48A 2E60A 3VODA 4LF5E 1T33A 3J81Z 1T38A 3BIDA 1IRZA 3FDYA 2LO3A 2XASA 3PSFA 1FMWA 4LLNA 3TOBA 4M2ZA 2IVMA 2WB1A 3SEZA 1H88C 4M6XA 4UVAA 1UJ8A 4M3GA 2X4HA 1QPIA 4EJTA 3HOYJ 2ZMEB 4DV6E 1ETQA 1MSFC 1OLTA 4LU9A 4O5GA 5IYDJ 1ZG1A 4XSXF 4OMYA 4DV2E 1XB4A 3ASOH 1ZR4A 2CUEA 3HUGB 1XMQE 2DOEA 3TP3A 2ACJA 1ZREA 2EV5A 1NK3P 2M7AA 3CUQB 2STWA 1R36A 2BZTA 2ESHA 4DBQA 2O9LA 1WPKA 2HQ5A 3KP6A 1GUUA 3KFWX 4JQFA 1GDTA 3C18A 4EMSA 4E7HA 1J09A 2P6SA 2K85A 3BJ6A 4I98B 4GRIA 3C2HA 3LWFA 3FXQA 5KVRA 4AIKA 3S2DJ 4CUGA 2GZWA 2A25A 5FB2A 4GFBA 3N97A 1QU3A 2H36X 3GFLA 1JKPC 2ZSIB 3CD6I 2BY1A 3BPVA 5E17F 2K4JA 1TF6A 1X1AA 4KHPE 4XICA 4BBRJ 2G9WA 2WC2A 5D6FA 4DV4E 3LA2A 2H27A 1J26A 5J1UA 5K5RA 2EZLA 1WJCA 2N8GA 1HSTA 4HW0A 3W2AA 3VYRB 1T08B 1SVMA 1BOAA 5A6BD 4NQWB 2EM6A 1SFXA 1S6LA 3JRFA 2XRNA 1WGXA 2CQXA 3LSKA 2M5WA 2MABA 2ADUA 1U8RA 4JYAE 4KYWA 2CWEA 1O3TA 1U2WA 1ZG3A 4J01A 1H9GA 3GO5A 4L5EA 3QYFA 4A3JJ 3CCYA 2J7JA 1IF1A 2CW0F 2Z16A 3TKYA 2L4MA 4F92B 2K4VA 4IHWA 4B44A 3S3NA 2DA4A 5A2QK 2N3HA 1RESA 3RIRA 1MJAA 2RKHA 5F64A 2K9MA 2UXXA 3DBLB 4HA8A 4LG0B 2VRDA 3OSFA 1K61A 1LJ9A 3V42A 3KP3A 5LHGA 4BE0A 2FNPA 3VYUB 4ENJA 2FMYA 3GFIA 4L9VA 4PSWA 2L9VA 2EM2A 2R7OA 2EOXA 3RKXA 4IOCF 4RGUA 2FQ3A 3CLOA 2BVMA 5JLXA 3K0LA 4XMYA 2EN3A 3HQ1A 3M4OJ 3RKYA 5BR8E 3K2ZA 5F0HA 1JT6A 3WU1B 1D8KA 3R0AA 3AUZA 5K7HA 2M7BA 2LUPB 5GAEJ 1UBDC 2VQEE 5ILVA 4A3KJ 3L2UA 2GM4A 4C3JJ 3Q0WA 1R1TA 4L5IA 3S3MA 1RKTA 5FO5A 2V1NA 4M74A 1YS6A 2XPVA 5J3LA 4X65E 5HDGA 3HPGA 2ZKZA 1X1BA 3ZMZA 2XGDA 3OYCA 2E5ZA 3PQJA 3TW7A 3HDDA 2JOXA 4ZH4F 1W0UA 2XGEA 2F6CA 1R9TJ 3VWBA 3C6MA 1A1LA 2V4JC 3J80K 4UXNA 5FRMA 2LRDA 2L01A 1A31A 1DP7P 3BY6A 4LGWA 3HRSA 2HQRA 2XAHA 4R2CA 4R2EA 4BC7A 4IJDA 3DF8A 2ZXJA 3R0JA 4UV9A 5HLGA 3WTVC 2OQRA 1HDDC 4G7OF 1G3WA 3LSTA 4XRSG 1EF4A 1GHCA 3PNVA 2KPMA 2EQRA 4E7LA 4A3CJ 5FJ8J 4A3DJ 3DTEA 1S7EA 2OF7A 2K9SA 1X6EA 2EJ4A 1S7AA 2J5OA 4XKCA 3EYIA 1O57A 1Z0XA 3FX3A 3DBHB 2JSPA 2E7XA 1EV7A 2GXGA 2M2EA 2FBHA 2EOIA 2DA5A 5EJCA 4BXXJ 4EQQA 2KKOA 4PFOA 2LLKA 1JHFA 3O6BB 4JI6E 3I5UA 4R2AA 3BZKA 1EKZA 1Y6IA 2EV0A 3UNGC 5DUIA 3A03A 1WJFA 2IPQX 1MBGA 1K4SA 1VZ0A 5LGNA 5IT9K 1ZTRA 4G12A 1XMKA 4FTHA 3BLYA 4DV7E 3MEXA 1UELB 1XGOA 1R23A 1MNMC 4F6NA 4HZFA 2HVSA 2XKOA 1D1CA 5B66C 2N8XA 2V1UA 5TJJA 2MLKA 4B3ME 3RSNA 2LYCA 2LMDA 3L2QA 1J9IA 2JYAA 5D8KB 2EFWA 4MTDA 3LSRA 3TQNA 1OYYA 1USSA 2EFOA 2HYJA 3CESA 1H8AC 4L18B 1IN7A 5LBQA 3HC7A 3MD2A 4CCJA 3P9IA 1XSDA 3A01B 1OCOH 1HC8A 1MIJA 2VOPA 2ISYA 4L0ZB 2IW5A 2BXZA 1KONA 1W7PD 2BXYA 3G6EI 4AWXB 2E2JJ 3V4GA 3IP4B 2XAQA 2P6TA 2Z3YA 3CP8A 3FHZA 2P5LC 4A3FJ 1NH3A 1ZLKA 2LV2A 2XIGA 2VUMJ 1ZGJA 2K9NA 3RYPA 4HEIA 4L8NA 1QVTA 5KAIC 3JR9A 1WJ5A 1OYWA 5DCMA 2FBKA 2QKLB 4EEFG 2EM0A 4BQNA 4PUSA 5IT9C 2KFDA 3IH3A 4LF7E 2ZXWH 1LEBA 4CXFA 3WTUC 4M71A 1I3QJ 3HTXA 2L3JA 2MC3A 4QIWN 5IXMB 1IMUA 2FV4B 5D5UB 1ZRDA 2LTPA 4GCVA 3H1CA 3H9GA 1JGGA 1BI2A 4P5OA 2F8BA 3VK6A 3JSPA 3A2KA 2EMYA 3LA3A 3LNQA 1YJWI 5LMUE 2R5YB 2KJCA 1MJBA 4V19K 4QLCU 2NVXJ 3K4MA 3TDUC 4Y17A 2OU2A 5EF6A 3CCLI 3OMLA 1GV5A 2QVOA 2WBMA 3K69A 2R5ZA 2JUGA 2DK5A 1BI3A 2BY2A 2M0MA 2AXTC 3G4SI 4IOAF 3MZ8A 1ITYA 2Q2EB 3GFMA 2RNGA 2PJRB 4ENMA 2EINH 2CUJA 2KLOA 2MH9A 2V88A 4JX6A 2Y30A 1IC8A 1LB2A 3F8NA 2RC4A 3TO9A 2DRPA 1FYLA 2ISZA 5F0CA 2KIFA 2V1XA 2DJIA 3O8GA 2M34A 3W3CA 6PAXA 3CCJI 4ZYAA 3RZOJ 2RS7A 3JRHA 2HKOA 2PJPA 3HOUJ 1G2DC 2A5WA 1SD6A 2CSOA 1LDDA 3WE2A 3SZGA 2IT0A 1D0ZA 2VF1A 1Z77A 5DS9A 3DKWA 2JWTA 3FXJA 4BHPA 4MLQA 1GTKA 1RKWA 5CQGA 2OPTA 2Z33A 1IG7A 5EEHA 1QHHD 3HPZA 3ABKH 2EQ3A 1IDZA 5E1XA 3RTRA 2WB1N 2LNBA 2DT6A 2LBFB 1IUYA 1UHWA 1E0EA 2FOKA 2V9KA 4GGGA 2DCEA 2GLOA 2HKXA 3QQAA 2OUMA 3IRQA 1FTTA 3HOTA 3LAJA 4KA4A 2L8TA 3FXUA 3MKLA 4DR7E 1K78B 4M3DA 2R7SA 4WSGA 1MNEA 1KU3A 5D5WB 5E8IA 3MQ0A 5FD5A 2YX4A 4BNCA 2NOJB 2V9VA 1I1SA 1U8BA 4BH9A 3DP7A 4YELA 2HGHA 3PNTA 3LSJA 4RGXA 4JI4E 2NS0A 3H09A 2D9HA 1Y8RB 2LY1A 4UUSA 4M73A 2YU5A 3GTMJ 4NNJA 4JI7E 4I0AA 4F55A 5EEGA 2EPUA 2EMXA 5LL6R 1FBQA 2ME0A 4PJNA 4U0YA 3KCCA 1R49A 1JKRC 1XCVA 5DEQA 4BXUA 2JPBA 1JUMA 4YFKF 2YS9A 2JA5J 4HF1A 5AONA 2F4IA 2X48A 1ETYA 2C6YA 1IZ1A 3CJQB 1F1ZA 2CFOA 2RQPA 1VF9A 4DZJA 1BR2A 4AD9A 3KWRA 2R7QA 3L00A 4HNUA 3HTSB 3KP7A 4L9NA 3DF6A 1TBXA 3FM3A 5HOOA 1JGSA 1ON2A 1P4XA 2ELJA 3LSGA 2UXDE 4BY7J 2PMZA 3ZMUA 4EV0A 4LK1F 5J8FA 1SFEA 1YS7A 1ZYRF 2KIMA 3TDZC 1WKMA 2R3SA 4XLNF 1Z91A 3I56I 3AAFA 1FOKA 3CUOA 1WHQA 4O43A 4N0BA 3F3XA 2DW4A 4M6YA 2LY9A 3OYKA 4Y33A 2GWRA 2W7NA 5KCMA 4ESJA 5B5EC 3K4BA 4BBSJ 3REOA 4BHCA 1Q1VA 1X4PA 4OU0A 4BCAA 3VDXA 4GKJE 2FOWA 5GADJ 3JRGA 2L7FP 3LOCA 1ZQ3P 3ZQIA 2E5LE 1IO2A 4PSXA 2MD5A 3WTWC 1B72A 2RSMA 4NC7A 3IWBA 2DA3A 3NQOA 2QBYA 4WFTA 5CVUA 2O61A 2JRMA 2Z9OA 3TQMA 3GZ5A 4A3IJ 1MBJA 3ERMA 4RDUA 1K83J 2I5UA 2JY9A 2ZNZA 1R00A 4LF9E 5CVIA 2VQHA 3O3KA 5KL3A 1FLIA 2R7UA 4X0GA 1GLNA 5DD8A 3VYSB 1PJQA 5E1ZB 2EM8A 1MJ9A 3CTAA 3JTHA 5AC4A 1TWCJ 3WHBA 1EA3A 2JMWA 4FE4A 1BL0A 3H5RA 5FLXC 3EUHC 5HS9A 3RPQA 3HKZA 5B3SH 1UG0A 4O6JA 1PUFA 1ENHA 3G73A 1J2XA 4HPQA 1O0WA 1MBFA 4CCOA 4PGGA 1T39A 5KL5A 1J5YA 2VOOA 2G7HA 2JZYA 3FISA 3T1HE 2K3FA 5C4JJ 2VPRA 1B8IB 3AL0B 1FWZA 1BJAA 3OYMA 4CHUA 5CKTA 3K1PA 2AQFA 3U1KA 5ILSA 1APLC 5E3OA 1IXRC 1BR4A 2VJJA 4ANJA 3RPUA 1EJ9A 5KL7A 2K27A 3R4KA 1G3TA 1H0MA 4JI3E 2HNHA 1DGWY 2E2IJ 3JSOA 3F6GA 2W85A 2WY7Q 2DPDA 3IWFA 2EN2A 5EDNA 2E19A 4HX8A 2DMUA 4I76A 1LVKA 4DW6A 5IPAA 2QSFX 1VQ9I 2R7TA 4R2PA 4QWQA 1YO5C 3J7ZI 4GDFA 3T1BA 4KUMA 2DA1A 1J75A 5DV5A 3U2RA 1IW7F 4DQ2A 2HYGD 1LFBA 4IJAA 3U1DA 4OIQF 3Q5FA 5AE3A 4BGDA 2K86A 2LF7A 3ML6A 3MN2A 3A0HC 1G3YA 4TUIA 4WYQB 3AG4H 3GUDA 4AU7A 3CF5F 3FXRA 1JK2A 2NNYA 1IXCA 2CJJA 1YYVA 4FETA 5J47A 1XNQE 2QLZA 1WJPA 2FE3A 2DO7A 3FBNB 5IY5H 4I2OA 2DMPA 4IQ4A 2RSIA 4UY8I 2IGMA 1WXRA 1JTXA 3IH2A 3MKYB 4ZDOA 1MGTA 3H36A 2VI6A 4RMNA 2V83A 3NAUA 4LJZF 3K7AJ 1SFUA 3MMYB 3UK3C 4DUZE 2ODRC 1J0RA 1PVEA 5F1JA 5JHFA 4FCYA 1X3WB 2L9RA 4DUYE 2GBYA 2IP2A 1WZ2A 1P7JA 1DQ3A 5DNYA 1CF7A 5DDGA 2WWYA 1XMOE 5J6XA 2D2WA 2VJ4A 1LDKB 3ABLH 3ECRA 3JAMK 2NVUB 2JA7J 2NYXA 2ZBKA 2EV6A 1LE8A 2KP6A 2NS7A 4II3A 2B3TB 1PP8F 4TUGA 3ELKA 4CDGA 3CC7I 2EQ1A 2GQQA 2EIJH 1BC7C 4LD5A 1A5JA 2AO9A 3V7SA 1P2FA 1IXSB 1QHGA 3V8JA 4KITB 4YRVA 1DGCA 3IRRA 4WXHA 2EMAA 1OCZH 4KNYA 2FUG2 5B1AH 5E79C 4B3AA 1F4KA 4BDYA 2HOTA 2L6MA 3DLLF 1LFPA 3GZNB 3K4KA 4L0YB 2QQBA 1TWFJ 4RAGA 2GXBA 4JK1X 4PJJA 4RGRA 4DYRA 1MNDA 5E8GA 1S3JA 2LP0A 3DV8A 4WWCA 3GTJJ 1BR1A 2UUBE 2LVSA 4K2EA 3TP0A 1Z7UA 3DPUA 5HVQC 1ZR2A 2YTPA 3V7RA 2UXCE 3IAM2 1RR7A 2BHYA 3HRMA 1JI8A 3JAMC 3C3WA 3CLQA 1B1BA 2DDAA 2NUGA 5BOXA 4XOPA 4HDVA 3QPSA 3BR5A 3CDHA 3H35A 1AAYA 4CGZA 1WJDA 3TGNA 2WTEA 4F91B 2H8WA 1LFUP 1YSAC 4DR3E 3JRIA 1R4MB 1IN8A 2XUBA 2R7WA 2EK5A 2LK2A 3ZOQB 2YTFA 4BEHB 3DTKA 2QA4I 2WA0A 2KOUA 4AIJA 3S2HJ 4C2TA 2MH2A 4EGYA 5D8LB 1E3PA 2ECCA 3H5AA 1YI2I 1TWHJ 3BCAA 3AL0C 1SMTA 2OC6A 5FLXZ 2H8RA 2DBBA 4DMIA 2FD5A 2DU9A 1N33E 5LHHA 5EG0A 1A1KA 1T8IA 2EWNA 2X6WA 4DGWB 4YEJA 5FFZA 4YIRX 3H0DA 2WBTA 2HFHA 5HODA 5ICEA 4NHJA 2LUQA 1LUJB 2MA3A 3E6DA 3GCMA 3CCVI 5BNGA 1FOWA 3G2BA 3GYHX 2VC0A 5K7FA 4RBOA 2Q1ZB 4PJ0C 1O7FA 2O7OA 5LEJA 2E2HJ 3W2VA 1YUJA 2EIKH 1YRNA 1TQPA 2EQ0A 1KA8A 4KJZA 2UXBE 4B3SE 2EPCA 2MG4A 2ODRD 2YTJA 3GMEA 1Z3XA 3LAPA 3LQRA 2YPNA 1A36A 1J7KA 5DD4A 1BIBA 4BQQA 1MBKA 1FSEA 1U9OA 3LLHA 2K9LA 2O8KA 2L54A 2JA6J 1YOVB 2UXNA 5EEAA 4F54A 2IHR1 1TT0A 3Q9SA 4A12A 2HZDA 2YX7A 2RVCA 3OS2A 4ENNA 1O3SA 3IUOA 5GAHJ 5AE2A 1VQ5I 3R6SA 3G71I 1WCMJ 4F2JC 1YQAA 3FKIJ 3RKQA 1VNDA 3H9QA 3AG2H 3OOPA 1K4TA 1RRJA 4BY1J 3EQLF 1UMQA 1G4DA 1WFXA 1XDSA 1B69A 5CQEA 1Y8QB 3KPHA 1BI0A 3L9FA 4IHXA 2HC5A 3T1YE 5GAGJ 2M8GX 3TEDA 4LK0F 3F8FA 4MQVA 5E3NA 1XSVA 1I50J 1WI9A 2FX0A 5LGTA 1ETXA 2MDGA 5JVTA 3S32A 4ZYEA 4MFDA 3CO6C 5HLIA 4BBYA 3ISPA 1OJLA 2FTXB 1XTAA 2VBXA 1AA7A 4HF2A 2PX9A 2PMZN 4N9IA 3ZGKA 4BMJA 2IGKA 2Y2ZA 4QTRA 2UUCE 3NEUA 1W5TA 3OS1A 2YT4A 5JLWA 4U0VA 1Z7LA 1Z6RA 1G2FC 1JUPA 3RKWA 4F52A 3DBRB 1U3EM 1A04A 2XKPA 3I59B 4EGZA 2EPPA 4KZSA 3GTLJ 3R60A 2E1NA 1IBME 1EH6A 1FOYA 4A3EJ 3BR6A 2K3PA 1BN5A 4V2GA 1STUA 2R7RA 1A1JA 2M8EA 1ZG5A 1ZN2A 2LJHA 2I10A 4LOCA 1QNTA 2VKVA 3SDGA 4IX7A 2B9DA 2MGQA 3MSWA 3ZQLA 2MC6A 4XLPF 1UILA 3I55I 3KZYA 4ESBA 4D7MA 1R1VA 4X1EA 4BQOA 3GEZA 4ZYDA 2B0LA 1G2HA 3E6BA 2M0CA 2LKPA 1RC9A 3HKZN 3WTXC 2ZMEA 4HNTA 2EORA 2XSDC 2V8QB 2A05A 3K4CA 4HG2A 4E6KG 3MZYA 4XLCA 1FEXA 5DTDA 2TCTA 2H1KA 4KDPA 3LMMA 2M4KA 1XDUA 2ZFUA 4M9ZA 5HS7A 3OS0A 2UUZA 2EOMA 1ORKA 3A02A 4JI0E 1KQ0A 4MEXF 3CUQA 4B43A 3LSMA 4U88A 2MYSA 3HIFA 3GTOJ 3F72A 4KMFA 1BBYA 1Z05A 5J8CA 3BG6A 1DDNA 1HA8A 1U78A 4FT8A 3L2CA 2CGPA 1ZELA 1IJWC 1F43A 2GA1A 3BG7A 5GP9A 1LDJA 4I02A 2OA4A 4BJ5C 3M07A 4O3MA 1FY7A 1ETWA 2RS6A 4OX9E 3QPHA 3FXKA 5JHUA 3E5UA 4ITVA 1X49A 4X66E 1F36A 4BXFA 2VIXA 3BJAA 3SZPA 3S2WA 4EJUA 2GIVA 4XOTA 4B47A 1OCPA 2R7VA 1TW3A 1UG2A 2W1OA 4ZZLA 5LHIA 1JHHA 1U5TA 1DUXC 2EIMH 1N77A 3BBGA 1XMAA 3CQZJ 5J4VA 3OTOE 4C2MJ 1XS9A 3MKWB 3HRTA 2EL6A 3T0YA 3F9KA 3FWEA 3QOPA 2P0WA 2O03A 4IRIA 2ELHA 2HZTA 3JRDA 4IQJA 2M45A 2X0LA 4HOBA 2DIXA 1WQ2A 1YIJI 1KU2A 3KP2A 1OCRH 2GOXB 5FGMA 3CF2A 4BQAA 4WXDA 2HTSA 5A2QC 3A0BC 2WY8Q 2A6TA 3OL3A 4P9UA 2MD0A 1U6GA 4E4HA 1GV2A 2X1EA 4XONA 2EBIA 2NUEA 2VC1A 1RMDA 2GHFA 1HW5A 4MQ9F 3HSFA 1JXSA 3D1NI 1FTZA 1MDMA 4RAYA 4HV5A 4JP0A 2M1BA 3E97A 4HLXA 1NHAA 4CYDA 2BY0A 1ZGAA 5BQTA 3RZDJ 3HRUA 1YE9A 2Y9YA 4HX4A 1YLFA 2XGCA 1WJAA 1Y0UA 1G8XA 3C2GA 4WF2A 4II2A 1IRGA 2EN7A 2DMIA 2EOJA 1ODDA 3CDLA 1X1DA 2M3AA 3IV5A 2WZOA 2W84A 3AG1H 2DA2A 1PUEE 5CVJA 1EH7A 2FNAA 2QZ8A 5LMNE 2WCC3 2ADRA 1NG6A 4CA0A 1W36C 4Q5SF 3BZCA 4UB8C 2V86A 2KRCA 3J80C 2OTLI 1FYKA 1UN6B 3UR3C 2IGNA 3HM5A 3BR2A 5CFFE 3MAJA 2Q8UA 2LE2A 4CCLA 2YSOA 2JQ7A 3FMRA 4RS8A 1T4OA 3ZQHA 4B4CA 3EUAA 3S3OA 2TDXA 4G8XA 1XC5A 1K6OA 2GIZA 4DNCA 5D5XB 4RLFA 3PO2J 1HXDA 2X85A 1RR8C 1NG7A 1NCSA 4KN7X 4F6MA 4F9AB 2FXAA 1IBKE 3K2AA 3ZMTA 4GO1A 2EB7A 3S17J 1O3QA 2IS6A 4A69C 1YX3A 5DYMA 2L7ZA 4CSWA 2CQNA 4IXAA 2JVAA 2NVYJ 1IV6A 2BOLA 3H3UA 2IA2A 4DYCA 3QPLA 2MBFA 4OAZA 4BL0B 2B63J 2EOHA 4E70A 2CW8A 1YPNA 4NZVA 1ZHFA 2LBSB 4ON0A 2IS2A 1XGSA 2XHKA 3IC7A 4BE1A 1IUFA 4ZJZA 5IP6A 1ACIA 2YTEA 2DMYA 2H09A 2E1MA 1KGSA 5GPCA 2R5ZB 1QPMA 4FHTA 1YW7A 4IEJA 2OZ6A 3P1XA 3O8HA 5E1WA 3FXLA 4GZNC 3N05A 2PEXA 3S1QJ 1N75A 5AASA 2Q0OA 2ME6A 2VBYA 3DU5A 3P9CA 4IKFA 4Y52J 3EPHA 3OYNA 1WHUA 3T5XA 3MHHC 1B9MA 3E0JB 4KT5C 4UB6C 1N34E 1I6XA 4X9JA 4XQFA 2QUFA 3BG9A 2LJUA 1QZEA 2NAZA 3B6AA 1T0FA 4F3QA 4ZTFA 2LFBA 1V55H 2Y69H 2D1HA 3S16J 2QQ9A 3M1CA 3PFYA 1X1CA 2BW3A 2BB8A 1W1WE 2KIQA 3MVPA 1MW7A 3QU6A 2KRFA 4A3MJ 1HBXG 4HQMA 1N25A 3G1LA 3F22A 2L2MA 1EKEA 1F9NA 1VQ4I 4M72A 3KETA 4XSZF 2O5RA 2N3GA 5FKOA 4I0BA 4JYKA 2W4SA 4BACA 2IS4A 2MKNA 3ADIA 2EFQA 1RNLA 1I5ZA 1RPWA 2ID3A 2OQGA 1VQ8I 4HSTA 1IQSA 2WAFA 4G7HF 4D0PA 3X2QH 1W36D 2DT5A 2CUFA 2CU7A 1R71A 2DT7B 4I01A 2NNNA 3E5QA 3DTIA 3HPHA 3WE3A 5J4YA 4M9XA 5A2QZ 2YTIA 3CP2A 4CCMA 2V87A 2PMUA 2HPMA 1C0WA 1PDAA 3ZR8X 4WXCA 1SANA 3BOQA 1YYWA 2DPUA 4AC0A 1E3OC 3I0TA 1QGPA 3VOEA 5L3EA 2KONA 3KZIC 4UUSB 1AHDP 3EDPA 2DQRA 4EM1A 3DEWA 1UHSA 5CYVA 4Q4ZF 2NOGA 3OR1C 2LDUA 1STZA 5L3DA 1BA5A 2KDOA 3WU0A 4JI1E 2VQFE 1H9TA 4Q48A 4XKBA 4XRSA 2IBDA 3HHGA 3K6QA 3KP5A 1V3FA 4FK5C 1BJZA 3B6CA 1QA6A 4FX4A 1GXQA 2JP9A 1Y1WJ 2O3FA 3K6GA 1UHMA 3TOAA 5FD6A 1D8JA 4KN4X 1JJ8C 3JW4A 3RJPA 3L2VA 1K7AA 2EMWA 3PQKA 1YJNI 4HAMA 2FEZA 3OIPA 4LFUA 2DI3A 1I39A 2DA7A 2NRAC 1X47A 5LRSA 3ZOBA 3CCQI 5E3MA 1CQTA 2X51A 3W6VA 4RM2A 4L5JA 2CPNA 2F5EA 1VQOI 1JE8A 4JI5E 2ZCWA 3J80Z 2DOFA 3OYIA 1P4WA 2Z99A 3CCMI 2M1SA 1SEUA 3E6MA 3GW2A 4IL6C 2PG4A 3BQZA 1T56A 1S72I 2V26A 4HBLA 2VONA 1QZYA 1KYZA 1I3AA 1OMIA 1XG1A 2LR8A 2LY2A 2P5KA 3NARA 3CO7C 1KQ8A 3HGGA 2L0KA 3M8EA 4IVNA 4OWRB 3WG9A 4A3LJ 3NRVA 4CO8A 3ZPLA 5FLMJ 1GVDA 2OJED 2F4MB 2J5PA 1RUNA 4LLGF 2P8TA 2QBYB 3KYCB 1KYQA 2ZNYA 3IAS2 1MZBA 4XKVA 1SC7A 1HW2A 2XAUA 2L7MP 4HQEA 1OFCX 2DYRH 3OYJA 1Z9CA 4J8ZA 3C4TA 2VJ5A 5M3MJ 2W25A 3FK6A 5IV8B 5HLTA 4BE2A 2K5CA 2M87A 1ZR9A 3L2RA 2P7CB 2VLAA 3HJEA 1YFHA 3JU0A 2KT0A 4D1QA 1GT0C 2EE8A 2M9AA 1X3ZB 5TGTA 3K70D 5CPRB 5IT9Z 1PUFB 2LREA 1TL8A 4HLYA 2EPMX 3P5JA 3S93A 4HDUA 1ZBTA 5FRNA 4L9JA 3PL8A 4A2UA 4QPQA 3SJMA 2ID6A
chains in the Genus database with same CATH topology
2BEOA 2BYVE 4RB1A 1XSXA 1QO0D 3GLXA 1LVAA 1ZH5A 1TQMA 4G7ZF 4A6DA 4BYYA 3RDIA 2HWVA 4F7ZA 1RZ4A 4HYEA 2Q8KA 2XROA 3RI4A 1D5VA 1Z1DA 3GZ6A 5JR3A 2BGCA 3QP6A 5CVRA 1B4AA 1HKTA 4EVIA 1V4RA 1P4AA 2HEOA 1BI1A 3J81K 4JBAA 1B59A 1WSUA 4YFXF 1YW8A 1CF7B 2BE5F 4ZYHA 4OINF 3KE2A 1LQ1A 3W6JB 3ECOA 1KU9A 2JPCA 1J59A 3T8TA 4S05A 3J7AO 3M7GA 5BMZA 5F6FA 3ZP5A 3JTGA 1BIAA 3TO6A 3QU3A 1RI7A 3E5XA 4G94A 1Z6TA 5TRDA 2FSWA 4HV6A 1T2KA 1IN4A 3PFIA 3ROUA 2AS5F 5D6EA 3IWZA 3D5LA 3WTYC 2OBPA 1G3SA 3K1MA 4P96A 1ZLJA 4NB5A 3WGGA 4A0XA 1OPCA 2L3DA 3KP4A 5BPIA 5FFXA 1PP7U 4UV8A 3BROA 1DPUA 4H0EA 3BPXA 3I4PA 5HDKA 1TNTA 1QQIA 2QQAA 2YSRA 2O8XA 2FBIA 1R1UA 2H6BA 2ZFWA 3O2PE 4IRGA 2A68F 2VE9A 2H6CA 3KLOA 3QRFF 3SFZA 1RUOA 3GVAA 4RAZA 2PLYA 2VT3A 4Y13A 2YU3A 1ZAOA 3HHHA 2EA2A 2W57A 2FF4A 3V8LA 1MD0A 4ZYGA 4ETSA 4IHSA 1S7OA 3M1EA 4MEYF 4A5MA 1SD4A 1RIOH 4R8HA 4BHBA 2VN2A 2W24A 5LRRA 3SZTA 1B9NA 3WGIA 3FMSA 5LLQA 2L02A 2L4AA 1VTNC 3R61A 3MWMA 4WX9A 2CQKA 3FF5A 4P55A 2RV8A 4IRHA 5HS8A 4CICA 3C1DA 3DPTA 2E1CA 3IKTA 1HKQA 3HSRA 4P9FA 3BJOA 1FZPB 2P5VA 1W5SA 2EFPA 1W7PA 3P9KA 3OV8A 4CZZA 4UHTA 1X3UA 1FT9A 3I54A 5ED4A 1TTYA 4YFNF 2LF8A 2IJLA 1D3YA 1WRJA 3VFZA 1Q1HA 5D4SA 1I27A 3SXYA 3H3ZA 4L9TA 3DQVC 3WTZA 1YW9A 5D4RA 1REPC 2HS5A 2QYOA 4HF0A 1FPQA 4ENKA 3L7WA 2CG4A 5HLHA 4A6EA 2F5CA 1YTYA 3JAMZ 5K5QA 2YPRA 2RN7A 3KEOA 1IAWA 2VBZA 4PGHA 3HUGA 5BPDA 3I59A 4KIFA 4AIHA 2VBWA 5L3FA 1OYIA 2JSCA 4KFCA 2OD5A 1TW2A 1TQIA 1I1GA 5IT3A 1U5TB 2HQNA 4G9YA 1AWCA 3SQNA 4A0YA 2RGVA 1UCRA 4BAYA 3T8RA 2IA0A 3GX4X 1PDNC 4Q47A 4NQWA 5LGUA 4I09A 1R58A 2YR2A 2DQLA 3DPLC 4MGRA 4MTEA 4U7BA 2VE8A 2HYFA 3RYRA 3ZN1A 2GAUA 1E2XA 2D45A 1MDMB 5L3CA 3IL2A 5K1YA 4LG0A 3BP8A 2ESNA 4LB5A 5E20A 3SHFA 3C7JA 4OIPF 3WTTC 1QZZA 3ERED 3Q9VA 4WK8F 5ICCA 3BWGA 5JFRA 2XAGA 5L3BA 2XAFA 2M30A 2IRFG 2CFXA 2IA1A 2HOEA 2H94A 2DFIA 1L3LA 1DPRA 2A6EF 4KIGA 2XAJA 4N9HA 4UUVA 3GF2A 4UVCA 4YIFA 4OMZA 5BS6A 1E17A 3L09A 1FP1D 5KK1A 1FC3A 2A5YB 3TO7A 4UVBA 3QPTA 3U9GA 2KJBA 2VXZA 4KIBA 3CUQC 2HTJA 4Y15A 5DCMB 4RB2C 4U0WA 4ASNA 4UNOA 2A6HF 5AIPA 5ICFA 4O5VA 1MKMA 2GA2A 2PBIA 1XGMA 4AVPA 2V1DA 2PQ8A 3ABTA 4OOIA 1OKRA 1B6AA 1ZRFA 3DXJF 3ZMSA 1G6NA 1U5TC 3MZHA 1SD7A 1HSJA 1O7LA 2EFNA 2V79A 2RDPA 1IN5A 3MCZA 3ZN0A 2BV6A 3ZQ7A 1F5TA 1LNWA 4OIRF 2FRHA 1UB9A 4ZZDA 4G6DA 3K9TA 2G7UA 3QP5A 3GFJA 1T98A 3KZZA 3ZMVA 1WWXA 3F8CA 1ON1A 4IPAA 3MFKA 1K79A 2UWMA 5ERIA 3HTUA 4KMUX 4LLLA 4Z2YA 2Q2EA 2PMHA 3F6OA 3N4MA 3EUHA 1FX7A 1TLHB 5H20A 3B02A 2A69F 4PDKA 4U7DA 2EA4A 2XV4S 3HYIA 3F8BA 5CVVA 4EJWA 2XGXA 1S29A 2CO5A 1CGPA 2HGCA 3F8MA 2Y75A 5CJ9A 1SAXA 3BZ6A 5ILUA 4IF4A 4EM2A 5JI6A 1TNSA 5K5OA 2K7LA 4M9SA 1K78A 2K02A 1QBJA 2PN6A 1XCBA 4XRFA 4G6QA 3HOSA 2P7VB 2JT1A 2ZJ2A 3LA7A 1SMYF 3ECHA 3KEQA 2ETHA 4I7HA 5D5VB 4GYIA 5DUKA 1S8NA 3F21A 4YG2F 3WGHA 5FLXK 3ZMDA 2A61A 1XN7A 4S04A 1FP2A 4A0ZA 4GXOA 2HR3A 3F6VA 2FA5A 2HDCA 2EJRA 3FZVA 2VODA 5DCFA 1EH8A 2O0YA 5F1RA 3I58A 2O6GE 2QWWA 4HX7A 4PZJA 4MHGA 1XGNA 2ZO4A 2QM3A 1R5GA 3EETA 2RNJA 4MNUA 3IKVA 2BBYA 1FSHA 1LEAA 2PFBA 2WV0A 2FMLA 1L0OC 2A07F 5H6QA 3I53A 2R7FA 1IRFA 1OR7A 4LMYA 1YIOA 4R1HA 1HKSA 4PCQA 3K1NA 3VEPA 2UZKA 3M9AA 4YIIA 2LSOA 3IHUA 1SD5A 3FM5A 5L3GA 2JTVA 4LB6B 1FYMA 4TV7A 1FNNA 3LQQA 1HW1A 1IN6A 2FU4A 3I64A 2F5FA 1HQCA 4WCGA 2F2EA 3P7NA 1FBUA 1ONVA 2Y0MA 2OAZA 2R7DA 1O3SA 3QAHA 4RB0A 2AXLA 5H6RA 2VT2A 1BC8C 1P92A 3E3VA 2DTRA 2Z5UA 3V8KA 3COAC 2JRTA 4R79A 2COMA 3I71A 4GYGA 2K4BA 3KLNA 1BM9A 3HSEA 2XVCA 2DLLA 1KYWA 2OZUA 1GXPA 2Y48A 3WTSC 1FBSA 1R7JA 2DK8A 2DAOA 1ZARA 2V6CA 3EYYA 3GWZA 5CLSA 1R22A 3W6KB 3E6CC 1GVJA 1AOYA 5LEKA 4RB3C 4A5NA 1XD7A 2PI0A 2KIUA 1KU7A 4KICA 3VB2A 5HDNA 2P4WA 3ABUA 5ICGA 3G3ZA 3LFKA 4ESFA 4RGSA 2A3SA 3GXOA 5E18F 3CJNA 3FMQA 3H92A 4FX0A 4B8XA 1P6RA 2QENA 4XBFA 2D1VA 4IHTA 2CYYA 3F23A 1USTA 1UFMA 3BDDA 4EJOA 3ULQB 4EM0B 1T6SA 1W7PB 2F5DA 3M8FA 2STTA 2E7WA 3V7CA 3DEUA 4OIOF 1YG2A 3WODF 1R5HA 4EJVA 1W4MA 1ZRCA 4B09A 2MLGA 3DFGA 5AIQA 3B73A 3D0SA 1O3RA 1KQ9A 1ULYA 3VODA 3J81Z 1T38A 2XASA 4LLNA 3TOBA 2IVMA 4M6XA 4UVAA 4EJTA 2X4HA 2ZMEB 1ZG1A 4XSXF 4OMYA 1XB4A 2ACJA 1ZREA 2EV5A 3CUQB 2STWA 1R36A 2ESHA 3KP6A 3KFWX 4JQFA 3C18A 4EMSA 2P6SA 3BJ6A 4I98B 4AIKA 3LWFA 3FXQA 5KVRA 2GZWA 5FB2A 3N97A 3GFLA 3BPVA 5E17F 2K4JA 2G9WA 2WC2A 5D6FA 3LA2A 2H27A 5K5RA 1HSTA 4HW0A 1BOAA 1SFXA 1S6LA 2XRNA 2M5WA 2ADUA 1U8RA 4KYWA 2CWEA 1O3TA 1U2WA 1ZG3A 1H9GA 3GO5A 1IF1A 2CW0F 3TKYA 2L4MA 5A2QK 3RIRA 1MJAA 2RKHA 5F64A 2UXXA 4HA8A 4LG0B 1LJ9A 5LHGA 3KP3A 4ENJA 2FNPA 2FMYA 3GFIA 4L9VA 3RKXA 4RGUA 2FQ3A 3CLOA 3K0LA 3RKYA 3K2ZA 3WU1B 1D8KA 3R0AA 5ILVA 1R1TA 4L5IA 5FO5A 4M74A 1YS6A 5HDGA 2ZKZA 3ZMZA 3PQJA 4ZH4F 3J80K 4UXNA 2L01A 1DP7P 3BY6A 4LGWA 3HRSA 2HQRA 2XAHA 3DF8A 2ZXJA 3R0JA 3WTVC 4UV9A 5HLGA 2OQRA 4G7OF 1G3WA 3LSTA 1GHCA 1S7AA 2J5OA 3EYIA 1O57A 3FX3A 2E7XA 1EV7A 2GXGA 2FBHA 4EQQA 2KKOA 1JHFA 3O6BB 3I5UA 2EV0A 5DUIA 2IPQX 5LGNA 5IT9K 1XMKA 3MEXA 1XGOA 1R23A 4HZFA 2XKOA 2V1UA 5TJJA 2MLKA 1J9IA 5D8KB 2EFWA 4MTDA 3TQNA 1OYYA 1USSA 2EFOA 4L18B 1IN7A 5LBQA 3P9IA 1XSDA 2VOPA 2ISYA 4L0ZB 2IW5A 1W7PD 4AWXB 3V4GA 2XAQA 2P6TA 2Z3YA 3FHZA 2P5LC 1ZLKA 2XIGA 1ZGJA 3RYPA 1OYWA 5DCMA 2FBKA 1LEBA 4CXFA 3WTUC 4M71A 2MC3A 5D5UB 1ZRDA 4GCVA 1BI2A 4P5OA 3JSPA 3LA3A 2KJCA 1MJBA 4QLCU 3TDUC 4Y17A 2OU2A 2QVOA 3K69A 2DK5A 1BI3A 3GFMA 4ENMA 2MH9A 1LB2A 3F8NA 2RC4A 3TO9A 1FYLA 2ISZA 2KIFA 2V1XA 6PAXA 2HKOA 2PJPA 1SD6A 2CSOA 1LDDA 3WE2A 2IT0A 3DKWA 4BHPA 2Z33A 5EEHA 5E1XA 3RTRA 2LNBA 1IUYA 1UHWA 2FOKA 4GGGA 2HKXA 3IRQA 3HOTA 3LAJA 4KA4A 3FXUA 1K78B 1KU3A 5D5WB 5E8IA 3MQ0A 5FD5A 2YX4A 4BNCA 2V9VA 1I1SA 4BH9A 3DP7A 4RGXA 2NS0A 4M73A 4I0AA 5EEGA 1FBQA 4U0YA 3KCCA 1XCVA 5DEQA 4BXUA 2JPBA 4YFKF 4HF1A 5AONA 2C6YA 1IZ1A 1F1ZA 2RQPA 4AD9A 3L00A 3HTSB 3KP7A 4L9NA 1TBXA 3FM3A 5HOOA 1JGSA 1ON2A 1P4XA 4EV0A 3ZMUA 4LK1F 5J8FA 1SFEA 1YS7A 1ZYRF 2KIMA 3TDZC 1WKMA 2R3SA 4XLNF 1Z91A 3AAFA 1FOKA 3CUOA 4N0BA 3F3XA 2DW4A 4M6YA 2GWRA 4ESJA 3REOA 4BHCA 4OU0A 2MD5A 3WTWC 2QBYA 3NQOA 5CVUA 2O61A 2Z9OA 3GZ5A 2ZNZA 1R00A 5CVIA 3O3KA 1FLIA 5DD8A 5E1ZB 1MJ9A 3CTAA 3JTHA 5HS9A 3RPQA 4O6JA 3G73A 1J2XA 4PGGA 1T39A 1J5YA 2VOOA 2G7HA 2JZYA 1FWZA 1BJAA 4CHUA 3K1PA 5ILSA 1IXRC 3RPUA 2K27A 3R4KA 1G3TA 1H0MA 3JSOA 2W85A 2DPDA 3IWFA 4HX8A 4QWQA 1YO5C 3T1BA 4KUMA 1J75A 5DV5A 3U2RA 1IW7F 4DQ2A 2HYGD 4IJAA 3U1DA 4OIQF 3Q5FA 2K86A 2LF7A 3ML6A 1G3YA 3GUDA 3FXRA 2NNYA 1IXCA 1YYVA 2QLZA 2FE3A 2DO7A 4I2OA 1MGTA 4LJZF 1SFUA 1J0RA 2IP2A 1CF7A 5DDGA 2WWYA 5J6XA 2D2WA 1LDKB 3JAMK 2NYXA 2ZBKA 2EV6A 1PP8F 3ELKA 4CDGA 2GQQA 1BC7C 4LD5A 3V7SA 1P2FA 1IXSB 3V8JA 3IRRA 4WXHA 4KNYA 1F4KA 4L0YB 2QQBA 2GXBA 4JK1X 4RGRA 5E8GA 1S3JA 4WWCA 3DV8A 4K2EA 1Z7UA 5HVQC 3V7RA 3HRMA 3C3WA 1B1BA 5BOXA 4HDVA 3CDHA 4CGZA 3TGNA 2WTEA 1IN8A 2XUBA 2EK5A 4AIJA 2MH2A 4EGYA 5D8LB 1SMTA 5FLXZ 2DBBA 2DU9A 5LHHA 2EWNA 5FFZA 2HFHA 5ICEA 4NHJA 2MA3A 3E6DA 3GYHX 2VC0A 1O7FA 5LEJA 1TQPA 1KA8A 3LAPA 3LQRA 1J7KA 5DD4A 1BIBA 1FSEA 2L54A 2UXNA 3Q9SA 4A12A 2YX7A 2RVCA 4ENNA 3R6SA 1YQAA 3OOPA 3EQLF 1G4DA 1XDSA 1BI0A 3L9FA 4LK0F 3F8FA 4MQVA 1XSVA 1WI9A 5LGTA 5JVTA 4ZYEA 3CO6C 5HLIA 3ISPA 2VBXA 4HF2A 4N9IA 3NEUA 1W5TA 4U0VA 1Z6RA 3RKWA 1U3EM 1A04A 2XKPA 3I59B 4EGZA 3R60A 2E1NA 1EH6A 1BN5A 2M8EA 1ZG5A 1ZN2A 1QNTA 4XLPF 3KZYA 4ESBA 1R1VA 4ZYDA 3GEZA 2B0LA 3E6BA 2LKPA 3WTXC 2ZMEA 3MZYA 4KDPA 5HS7A 1XDUA 4M9ZA 1KQ0A 4MEXF 3CUQA 4U88A 3HIFA 3F72A 4KMFA 1BBYA 1Z05A 5J8CA 1DDNA 1U78A 4FT8A 3L2CA 2CGPA 2GA1A 1LDJA 4I02A 2OA4A 4O3MA 1FY7A 3QPHA 5JHUA 3E5UA 3BJAA 3SZPA 3S2WA 4EJUA 2GIVA 1TW3A 4ZZLA 5LHIA 1JHHA 1U5TA 1DUXC 1XMAA 3HRTA 3T0YA 3QOPA 3FWEA 2O03A 4IRIA 2ELHA 2HZTA 2M45A 2X0LA 4HOBA 1WQ2A 1KU2A 3KP2A 5FGMA 4BQAA 4WXDA 2HTSA 4P9UA 1U6GA 2VC1A 1HW5A 4MQ9F 3HSFA 1JXSA 1MDMA 4RAYA 4HV5A 2M1BA 3E97A 4HLXA 1NHAA 4CYDA 5BQTA 1ZGAA 3HRUA 4HX4A 1YLFA 1Y0UA 4WF2A 1IRGA 1ODDA 2W84A 1PUEE 5CVJA 1EH7A 2FNAA 2QZ8A 4Q5SF 1FYKA 3MAJA 3FMRA 4RS8A 2TDXA 4G8XA 1K6OA 4DNCA 5D5XB 1HXDA 4KN7X 2FXAA 3ZMTA 4GO1A 2EB7A 1O3QA 5DYMA 4IXAA 3H3UA 2IA2A 2MBFA 4E70A 1ZHFA 4ON0A 1XGSA 2XHKA 3IC7A 2H09A 1KGSA 1QPMA 4FHTA 1YW7A 2OZ6A 5E1WA 2PEXA 2Q0OA 2VBYA 3P9CA 3T5XA 1B9MA 4KT5C 1I6XA 2QUFA 2NAZA 1T0FA 2D1HA 2QQ9A 1HBXG 3QU6A 2KRFA 4HQMA 3F22A 1F9NA 4M72A 3KETA 4XSZF 4I0BA 2EFQA 1RNLA 1I5ZA 2OQGA 4G7HF 4D0PA 2DT5A 4I01A 2NNNA 3E5QA 3WE3A 4M9XA 5A2QZ 2PMUA 1C0WA 4WXCA 3BOQA 2DPUA 3I0TA 1QGPA 3VOEA 5L3EA 3EDPA 2DQRA 4EM1A 5CYVA 4Q4ZF 2LDUA 1STZA 5L3DA 3WU0A 1H9TA 4Q48A 3HHGA 3KP5A 1V3FA 4FX4A 1GXQA 2O3FA 1UHMA 3TOAA 5FD6A 1D8JA 4KN4X 3JW4A 3RJPA 1K7AA 3PQKA 4HAMA 2FEZA 4LFUA 2DI3A 2NRAC 5LRSA 4L5JA