4ZYDA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
LVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPAHRVIAENGIGGYSRGVKLKRALLELEGVKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 38
structure length 149
sequence length 149
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zydA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zydA01
3RYRA 2DLLA 3Q9SA 3WG9A 5F1RA 2WTEA 2XV4S 4BHCA 3GX4X 4ENKA 2OZ6A 2RN7A 4HBLA 4OU0A 4H0EA 3T1BA 1J0RA 4M9ZA 2VE8A 3GVAA 2XAHA 5TRDA 1OYYA 4L18B 4M72A 4OIOF 5AIQA 5LBQA 1K78B 4B09A 3J81K 2KIFA 1XCBA 2H6BA 4Y15A 3SXYA 4BHBA 2KIMA 2XAJA 1WQ2A 3DKWA 3BWGA 4A2UA 4KUMA 3FMSA 2LDUA 3R6SA 3BROA 3CJNA 3COAC 4GXOA 4WCGA 2HQRA 1W7PA 5L3BA 5LHHA 2O8XA 3KLNA 1LJ9A 4IRHA 2VT2A 2EFNA 2EJRA 3F8NA 1V4RA 2JTVA 3BZ6A 3SZPA 1IZ1A 1FPQA 1ZHFA 3HYIA 2G7HA 3LFKA 2X4HA 3TOBA 3JSOA 2PJPA 3ZMVA 3T8TA 4CXFA 3V8KA 4RGSA 2CQKA 1WWXA 4G7HF 3WGIA 4UNOA 5ICCA 4I0BA 3ISPA 3HHGA 2NAZA 2HFHA 2DPUA 2O03A 3IWZA 3GUDA 3F21A 3JTHA 1OMIA 4UVCA 5JFRA 1I5ZA 2EV0A 4M6XA 2M8EA 3HOSA 3JSPA 1TTYA 3JAMZ 2EB7A 4MQ9F 2M30A 3HRUA 3TDZC 2K27A 4A0YA 1MKMA 4FHTA 4I7HA 2P4WA 3LWFA 4KA4A 4HZFA 2UXXA 2R7FA 1JHFA 1L0OC 4HW0A 3MWMA 4A0ZA 2DAOA 3GLXA 1BBYA 2W84A 2PMUA 1ZLKA 3I71A 3E97A 1XMAA 2HWVA 2QVOA 4RGRA 1XD7A 3BPXA 5TJJA 4L9NA 4OMZA 5ICGA 4IPAA 2P5KA 2RGVA 1A04A 3L00A 4PCQA 2IA0A 1IN4A 4LB6B 4EJWA 2QENA 3MCZA 4GYIA 3I54A 2HS5A 4O5VA 3I59B 3ZMTA 5LRSA 3ABTA 5FFXA 1D3YA 3WE3A 1QZZA 4GYGA 4GO1A 1UFMA 4R8HA 2D2WA 4ETSA 3L09A 2M45A 3GXOA 1AOYA 6PAXA 2XUBA 4L9VA 2DTRA 1QZYA 3ZN1A 1KYWA 5CLSA 5LGUA 4QLCU 1SD6A 4WX9A 5IT9K 4LLLA 2CG4A 1FYKA 3CO7C 3LQRA 2OQRA 5K5RA 2DK8A 1YFHA 2QZ8A 1HKTA 2VODA 1KU7A 2L01A 1USSA 2KJCA 2V6CA 3PQJA 4KMUX 4MTEA 2EFQA 1SFEA 2MA3A 2ZKZA 5E20A 1R22A 1FNNA 4KIFA 2A5YB 4L9TA 2RQPA 3ULQB 3DF8A 2IP2A 3C7JA 5K1YA 3K1MA 1P4XA 1FC3A 3LA7A 2FMYA 2HTJA 2Z3YA 1K78A 3HHHA 4ZZLA 1LNWA 5K5OA 3ZP5A 2NRAC 1G3YA 1H9GA 1U5TC 2MLGA 2OAZA 2DK5A 1TNSA 2DQRA 2VN2A 2P8TA 3ZQ7A 3JTGA 4BXUA 1F1ZA 4OIQF 1MD0A 3M9AA 5D5UB 2GXGA 4EGZA 4HX8A 1QPMA 1R5GA 4M73A 1V3FA 2CGPA 3BJOA 2GA1A 4HF1A 3HRSA 4U0YA 4UHTA 4XLPF 1KQ8A 1BN5A 5DCFA 3BJAA 1FZPB 1YG2A 4HLYA 2W57A 2KKOA 1ON1A 1J7KA 2XIGA 4L0ZB 3FWEA 4ENNA 3U2RA 3MZHA 1WSUA 1W4MA 3J80K 4R79A 3WGGA 4KNYA 1EH7A 4HQEA 1XB4A 5CVIA 2FXAA 4ZYGA 3FM3A 2OD5A 2H94A 2F5DA 2ESNA 3ROUA 2ACJA 3R61A 1F4KA 3V7SA 4AIHA 3IHUA 2ISYA 1PDNC 3CLOA 1D8JA 3ZMSA 1YTYA 3F3XA 4P96A 3F8FA 2A6EF 3GZ5A 1IW7F 1LQ1A 4MEYF 4DNCA 1LEBA 3SZTA 1IN7A 1R23A 2A69F 1FP2A 4BYYA 2NNYA 5ED4A 5E8GA 4YFXF 1L3LA 3F22A 4IRIA 2HQNA 2DQLA 2FE3A 2V1UA 1XCVA 5D5XB 1SD7A 2JPBA 2XAGA 5FD5A 4E70A 3RKYA 5L3EA 3T0YA 1O3SA 1U78A 2DFIA 2OZUA 1SMTA 1BIAA 4RGUA 1FY7A 1HKSA 3R60A 2DPDA 1J2XA 4IF4A 5LRRA 2ADUA 3KE2A 2CO5A 3LA2A 1HW2A 2LF7A 1YS6A 1P4WA 5LHGA 4HX4A 4I0AA 2QBYA 5CVUA 2IA2A 1BOAA 1UHWA 4BNCA 3EYYA 2ZJ2A 4U7BA 4L9JA 4ENJA 2QQ9A 2X0LA 1KQ9A 2FBKA 1B9NA 3CO6C 2QQBA 2ELHA 2ZNZA 3ECOA 1D5VA 3DPTA 5FD6A 1K6OA 1IN5A 2D1VA 2OU2A 2RV8A 3VEPA 1MDMB 4UXNA 1Z91A 2FOKA 1F5TA 4GGGA 2EFWA 1YQAA 1USTA 5E1ZB 1OYIA 2P6TA 3M1EA 5F6FA 4O3MA 3VODA 2ZMEB 4P5OA 4XRFA 5E18F 2FEZA 2PMHA 3KP2A 4JBAA 5J8CA 3LAPA 3S2WA 4EJTA 3K1PA 3W6KB 5D4RA 1I1GA 1QO0D 3HOTA 3FHZA 1BC7C 1EV7A 3E6DA 3FXRA 4AD9A 4I09A 1S3JA 4IRGA 2PFBA 2BGCA 4HF2A 3CUOA 1HBXG 4P9FA 1RIOH 1IUYA 3MAJA 2YX4A 3KETA 4WK8F 4M71A 2QYOA 2YSRA 2ISZA 2IPQX 2TDXA 4XBFA 1Z1DA 3WODF 2H09A 3N4MA 1JE8A 3MZYA 3J81Z 1G3WA 3TKYA 4ON0A 5AIPA 2B0LA 4CYDA 4EQQA 1KQ0A 2VBYA 2COMA 3ZPLA 2A3SA 1SFXA 1R1TA 1OR7A 2ZNYA 4XSXF 1Q1HA 2VC1A 3FM5A 3H3UA 1KU2A 1U2WA 4QWQA 1B1BA 1MJAA 2PEXA 5J8FA 5DCMB 2KRFA 5BOXA 1R36A 3F8BA 4HDUA 3LQQA 4Q48A 2VBXA 2KJBA 4P9UA 5LGNA 1YYVA 4M6YA 3K9TA 4CDGA 5L3DA 2VBWA 2RVCA 1PUEE 1B6AA 1W5TA 3CUQB 4XSZF 3IWFA 1H0MA 4UV9A 4ZYHA 1FOKA 2GWRA 3HTUA 5FGMA 4Y13A 2L4MA 4K2EA 4LD5A 4OIRF 2DW4A 3KFWX 3KCCA 3VB2A 2ZCWA 4EM0B 5H6QA 3GWZA 3KP7A 4HQMA 1DP7P 1OPCA 4M9XA 1X3UA 5IT3A 1E17A 1G3SA 1ZYRF 5BQTA 1IRGA 1J9IA 1RZ4A 1CF7B 2YPRA 4IXAA 1FT9A 3E5QA 3SFZA 2VT3A 2CWEA 3L9FA 5ICFA 5ERIA 1YW9A 4YIIA 3K1NA 3P9KA 3QP5A 2DO7A 3V8LA 1Y0UA 5BMZA 4NQWA 4KIBA 3GFMA 1G3TA 4EMSA 2F5FA 4G9YA 4YFNF 4BH9A 4Q47A 3K0LA 2P5LC 1SD4A 4FT8A 4D0PA 4AIKA 2STWA 2IJLA 4LK1F 1XGSA 1XGNA 4O6JA 3O6BB 5BS6A 2EWNA 4UVBA 1FX7A 2AXLA 1O57A 5JR3A 4LB5A 5E1XA 3M8EA 1ZRDA 5EEGA 1P4AA 4A5MA 1CGPA 1EH6A 4G7ZF 2YR2A 5ILUA 1O7LA 1YS7A 4NB5A 4UV8A 2QLZA 3BY6A 4LK0F 1XN7A 3LA3A 4AIJA 4CGZA 2RDPA 2P5VA 3R0AA 1C0WA 3RIRA 1O7FA 4RAYA 1S8NA 5FLXK 5F64A 4L5JA 1LVAA 1OYWA 5HVQC 4HYEA 4N9HA 3O2PE 3I5UA 4CZZA 1CF7A 4LLNA 4YFKF 5FLXZ 2V1XA 1XGOA 2R7DA 2HYGD 4M74A 5FO5A 2FA5A 2MBFA 2EV5A 3IRQA 1R1VA 5DDGA 2A6HF 1GXQA 3LAJA 3DEUA 5DUKA 4G7OF 3FMQA 5DUIA 4LMYA 1P2FA 3ZMUA 1JXSA 2Z9OA 3BJ6A 3F8CA 1QQIA 2LSOA 4LG0A 3WGHA 1D8KA 5H20A 2Q8KA 3HTSB 3OOPA 3T5XA 1SFUA 1O3TA 1GXPA 1MJBA 5DEQA 2QWWA 4WXDA 2OQGA 2DU9A 4ZYEA 2L3DA 4A6DA 1I6XA 1SD5A 4OMYA 1YW7A 4RB3C 2UZKA 2CYYA 1YIOA 3R0JA 4ENMA 2VC0A 3NEUA 1ULYA 4HV5A 1HKQA 1U6GA 5CJ9A 3KP5A 3B02A 3D5LA 2ZFWA 4IHSA 4MQVA 3HRTA 1TNTA 3H3ZA 2PI0A 1U5TA 2IVMA 3QPTA 1BI0A 2XAQA 3N97A 1LDDA 3MEXA 3RJPA 3C1DA 3JAMK 1RUNA 1ZG1A 4KMFA 4JK1X 4CO8A 4AWXB 1T98A 2IA1A 2HDCA 3QP6A 3GW2A 1BC8C 3NQOA 2IT0A 3WTTC 2E7XA 2E1CA 3KEQA 1XMKA 2MH9A 4RAZA 2QUFA 2K4BA 5ILSA 2LNBA 4HDVA 5HDKA 2PQ8A 2CW0F 4UVAA 1TBXA 2JT1A 3F8MA 4HF0A 3TO7A 2EK5A 2ETHA 4WF2A 2PN6A 1ZREA 2H27A 3RPUA 3IL2A 2L02A 1R58A 3GFJA 1ZGAA 4A0XA 3ML6A 1ONVA 4ESJA 2Z33A 3WE2A 4PDKA 2NNNA 4M9SA 4EVIA 5A2QK 2E1NA 1KGSA 4A5NA 1IAWA 3TOAA 1YO5C 1FYMA 2O3FA 2FBHA 1KU3A 2Z5UA 4EM1A 3KP3A 3C18A 4LJZF 2WC2A 5CVJA 3CTAA 5CYVA 2DBBA 3QU6A 2BYVE 1DDNA 3NRVA 2O6GE 3RKXA 2XROA 2P7CB 1WRJA 3MQ0A 2HEOA 3GF2A 4EGYA 4RB2C 2VONA 4L0YB 1YLFA 4HAMA 1E2XA 4HV6A 5LGTA 1J59A 1I1SA 4I2OA 3RTRA 4UUVA 3MFKA 3J80Z 3RKWA 3ZMDA 3L7WA 2L54A 2HKOA 3LSTA 3E6BA 4LG0B 3WU1B 4KN7X 1FBSA 5L3CA 5J6XA 1HW5A 1KA8A 2FMLA 2LF8A 5AONA 2VOOA 5FB2A 3EDPA 2ESHA 2FSWA 3P7NA 4ZYDA 1DPUA 5DV5A 2E7WA 3DV8A 2G9WA 4KT5C 3M7GA 2YU3A 2C6YA 4B8XA 4EJVA 3IKTA 1I27A 3KLOA 3F6OA 4G94A 2FBIA 1XGMA 2BEOA 2A61A 3DFGA 3HIFA 1FBUA 1BJAA 2HTSA 3C3WA 1TW3A 3WTWC 1WKMA 4ASNA 3IRRA 1U3EM 3GO5A 1PP7U 1SMYF 2J5OA 5LEKA 2GZWA 5K5QA 4PGGA 3Q9VA 3V7CA 1S7OA 5HDNA 1TQIA 4MHGA 3DXJF 3GFLA 4G6QA 1KYZA 3ERED 2FQ3A 3QRFF 2UWMA 4LGWA 3H92A 4BQAA 2RNJA 3EYIA 1P6RA 1FBQA 2Z99A 2BBYA 2O0YA 1RUOA 1MJ9A 4OINF 3FXUA 2JSCA 2W24A 4CHUA 3FMRA 4Q5SF 5KVRA 3JW4A 4IHTA 1IN8A 5LLQA 3BP8A 4EV0A 1NHAA 3U9GA 4OOIA 2FNAA 4EJOA 3GZ6A 4JQFA 1HW1A 3HSFA 3TO6A 4U0WA 4AVPA 3O3KA 5HS7A 4S05A 1T2KA 3Q5FA 1ON2A 5JVTA 5ICEA 2D1HA 1LEAA 4EJUA 2ZMEA 3TDUC 2MH2A 1MZBA 1XSDA 4RS8A 4PGHA 4KIGA 1W5SA 2XKOA 2RC4A 3PQKA 2STTA 1IXSB 3KP4A 1HXDA 3KZYA 3TQNA 1EH8A 3REOA 5LEJA 2Q2EA 3DPLC 4WXCA 5HS8A 4I02A 1SAXA 4L5IA 4KICA 1XSVA 1TQMA 1J75A 2EFOA 4IJAA 1FSHA 1B4AA 1PP8F 2W85A 1QNTA 1YW8A 1K7AA 1ZAOA 2UXNA 4Z2YA 3WTXC 1ZRCA 1IXRC 4KDPA 2Y48A 3QU3A 1ZGJA 2VOPA 3FXQA 5E1WA 4PZJA 2K86A 5BPDA 1BI2A 5DYMA 1O3RA 1AWCA 2J5PA 3EQLF 1JHHA 4G8XA 4A6EA 4CICA 2AS5F 1STZA 4S04A 1VTNC 3OV8A 4RGXA 3KEOA 1IXCA 3RI4A 5HS9A 3RYPA 3E6MA 3BOQA 1LDKB 3GEZA 2A07F 3BDDA 1S7AA 1UB9A 1BI1A 3B73A 1BI3A 2EFPA 2DT5A 4YIFA 1TW2A 2P7VB 4FX4A 4HLXA 5L3GA 5HDGA 1QBJA 3I59A 4F7ZA 5D8KB 3EETA 3WTUC 1T6SA 2H6CA 4BAYA 1LB2A 3WTSC 1ZARA 2PBIA 2GXBA 2JPCA 4I98B 4NHJA 1P92A 1R1UA 5H6RA 2GAUA 1U8RA 1RI7A 5A2QZ 1DPRA 2HYFA 3ECHA 3DQVC 2WV0A 4XLNF 1RNLA 3SHFA 3F23A 3WU0A 3F72A 1IRFA 2ZO4A 5HLHA 2IRFG 1MGTA 1S6LA 5FFZA 2ZBKA 5D5VB 1ZN2A 4IVNA 4BHPA 4R1HA 1UHMA 2GQQA 2WWYA 4MEXF 4YG2F 1Z7UA 4U7DA 2MC3A 3G73A 3WTYC 4MNUA 1ZLJA 3BPVA 1GHCA 2FRHA 3U1DA 1G6NA 2FF4A 2L4AA 2XVCA 2QQAA 4HX7A 3CDHA 2A68F 3IKVA 3L2CA 1HQCA 5DCMA 3TO9A 3I4PA 1ZG5A 2D45A 1KU9A 2HGCA 2V9VA 1OKRA 2DI3A 3G3ZA 5E17F 2HZTA 3I64A 1B59A 2Y75A 3RPQA 3I53A 2BE5F 2XASA 5HOOA 1W7PD 3TGNA 5JHUA 4MGRA 2PLYA 1R00A 4A12A 2K7LA 5HLGA 1B9MA 5DD4A 5DD8A 5D4SA 4GCVA 2JRTA 1J5YA 3V7RA 2W25A 2JZYA 2OBPA 2K02A 2M5WA 4G6DA 4ZH4F 2NS0A 3DP7A 5IT9Z 2Y0MA 4N0BA 3M8FA 1UCRA 2V1DA 5D5WB 3HUGA 1TLHB 5ILVA 3R4KA 1T0FA 5D6EA 3ZMZA 1S29A 3RDIA 3E6CC 2O61A 4LFUA 5CVRA 1WI9A 2M1BA 3I58A 1O3QA 3GYHX 1HSTA 2YX7A 4HA8A 4LLGF 3VFZA 2HOEA 3QAHA 2VXZA 2FNPA 3E3VA 4HOBA 3PFIA 3W6JB 5D6FA 3V8JA 5EEHA 5D8LB 3QPHA 4MTDA 4TV7A 3WTZA 2VBZA 4U88A 3J7AO 3VOEA 2LKPA 2KIUA 2CSOA 4ESBA 2GA2A 2RKHA 3E5UA 3P9IA 1FWZA 3QOPA 4N9IA 1FLIA 4KN4X 1QGPA 1ZG3A 4EM2A 5HLIA 3E5XA 1Z05A 1GVJA 1W7PB 1K79A 1U5TB 1Z6RA 3F6VA 1XDSA 3FZVA 4FX0A 3D0SA 2K4JA 3V4GA 4DQ2A 5JI6A 2M87A 2XGXA 1ZH5A 2MLKA 3ELKA 3ABUA 1DUXC 4RB1A 1R5HA 2EA2A 4Y17A 1Z9CA 1LDJA 1T38A 4OIPF 3K69A 4WWCA 2GIVA 1IN6A 2NYXA 1H9TA 3SQNA 2BV6A 2XKPA 4I01A 2F5CA 4ESFA 1F9NA 4ZZDA 5CVVA 1XDUA 1MDMA 4U0VA 2PG4A 2XRNA 4P55A 5L3FA 2QM3A 3FF5A 2HR3A 2IW5A 3HSRA 3KZZA 2XHKA 1FYLA 3T8RA 2ZXJA 5E8IA 3AAFA 1ZRFA 3IC7A 3HRMA 3P9CA 3ZN0A 1Z6TA 2QBYB 2V79A 2Q0OA 2OA4A 1IF1A 1BM9A 4KFCA 5BPIA 2R3SA 1HSJA 1R7JA 5LHIA 1BIBA 4RB0A 1G4DA 4Q4ZF 4WXHA 1TQPA 3CUQC 3CUQA 3KP6A 5KK1A 2F5EA 3FX3A 3K2ZA 2CFXA 2P6SA 2F2EA 1JGSA 3HSEA 3I0TA 3WTVC 3GFIA 2G7UA 4KYWA 1XSXA 1T39A 2XAFA 2MD5A 2EA4A 1REPC 1FSEA 2VE9A 1FP1D 2HKXA 2EV6A 2FU4A 1ODDA 3EUHA
chains in the Genus database with same CATH superfamily
2FGGA 3CLQA 3CMMA 3RYRA 3CMEI 2DLLA 3Q9SA 4BDYA 3WG9A 5F1RA 1YX3A 1LPQA 3E0JB 2E34A 3BG9A 4IHYA 2WTEA 2XV4S 4BHCA 1FIAA 3GX4X 4ENKA 4NC7A 2BY3A 1TWAJ 2L92A 3FXLA 4LOCA 2OZ6A 2RN7A 4HBLA 4OU0A 3CCSI 4E7JA 2WB1N 4H0EA 3T1BA 2JSPA 1J0RA 4M9ZA 2R1FA 4F55A 4CSWA 2GM4A 2VE8A 3GVAA 1Y0NA 2XAHA 4XRSA 2EOEA 2EIJH 5TRDA 1OYYA 3GTOJ 2ICWG 3K4LA 4L18B 4M72A 4QSHA 3HM5A 5GPAA 4DIQA 3LMMA 1N33E 4HSRA 4OIOF 2L7FP 5AIQA 1QPIA 5LBQA 2L33A 3C4BA 1K78B 4B09A 5JVGF 3LSHA 5LMNE 2R5ZB 1GLNA 3J81K 2KIFA 2KP6A 5KL3A 4B47A 1XCBA 2B7VA 3LSKA 2L2OA 3ZQIA 4BEHB 4Y7NJ 2H6BA 4Y15A 5JLWA 2YRMA 2DTZA 2EMYA 4KZSA 3SXYA 3OIOA 5J1RA 2L0KA 1EA3A 4JI7E 4BHBA 2KIMA 2XAJA 3BR2A 4KWYA 2N8XA 3H35A 1WQ2A 1MBHA 1X58A 3BWGA 3DKWA 2HYJA 4A2UA 4KUMA 1OQYA 2LDUA 2R7QA 3FMSA 1T4OA 3R6SA 4HEIA 3BROA 3CJNA 2RAEA 3COAC 4GXOA 3BF2A 4WCGA 5HLTA 2HQRA 4HRIA 1W7PA 5L3BA 5LHHA 4JOMA 2O8XA 3KLNA 1LJ9A 4IRHA 1MSEC 5AC5A 1P47A 2VT2A 2YU5A 2R7TA 2EFNA 2EJRA 3F8NA 1V4RA 2JTVA 2M7BA 1TF3A 3BZ6A 3SZPA 3OTOE 1IZ1A 1FPQA 1ZHFA 3HYIA 3K10A 3KZIC 2G7HA 3LFKA 1YHQI 2X4HA 3CESA 5EG0B 1MBGA 4UY8I 2EM5A 3TOBA 3JSOA 4JP0A 2PJPA 3ZMVA 3T8TA 4XRMA 2NS7A 4CXFA 1AAYA 4C3HJ 4UUSA 2M4GA 3V8KA 4RGSA 2CQKA 1WWXA 3DBRB 4XKVA 3SDBA 1ZKGA 3CCEI 3AL0B 4G7HF 3WGIA 4UNOA 4M3GA 2CUZA 5ICCA 3THNA 2FQ4A 2XGDA 4I0BA 2XC7A 2LO3A 3ISPA 3J7YJ 5IP7J 2GHFA 1YIJI 3HHGA 1JKQC 2LREA 2R5YB 2NAZA 4WSGA 1X3ZB 5FLMJ 4OX9E 2HFHA 2UUCE 4F9CB 2DPUA 2O03A 2CPNA 4A3MJ 1HNZE 3IWZA 3C6MA 4DR5E 3GUDA 1YYOA 1BW5A 2EM9A 3F21A 2EN2A 2IS1A 4DV4E 2KT0A 3VK6A 3JTHA 3RSNA 1OMIA 4LFCE 4UVCA 1WJAA 3FK7A 2EQ3A 4JI1E 5JFRA 1I5ZA 2EV0A 1XPXA 3WG7H 4M6XA 2M8EA 3HOSA 2HQAA 3JSPA 1TTYA 3JAMZ 2EB7A 4MQ9F 1N3GA 2EPNA 2EOJA 3THOB 3CJRB 2M30A 3RMPA 3HRUA 3TDZC 2K27A 4XN3A 3BZCA 2EPOA 1JT6A 1N78A 4A0YA 2B3TB 2CV1A 2EMBA 1MKMA 4FHTA 4JI0E 4I7HA 2K9SA 2P4WA 3QYEA 3H9GA 4LF5E 2HHHE 3LWFA 4KA4A 1WZ2A 2UU9E 4HZFA 3DTEA 2YSOA 1LFPA 2UXXA 2EOHA 2R7FA 5B3SH 3QG5C 1JHFA 5J40A 1U9NA 1L0OC 3LSRA 5A6AA 3VPRA 1SAUA 4HW0A 1D0XA 4DKKA 2LOOA 4LIVA 5A2QC 2F48A 1ITYA 4NBQA 3FBIB 3MWMA 4A0ZA 4BS9A 2DAOA 3GLXA 4X1EA 4GFBA 4P7DA 2K85A 1BBYA 2E2HJ 2W84A 2V9PA 1RC9A 1HR0E 2PMUA 4DOZA 5IOYA 1ZLKA 3I71A 3E97A 4M6VA 5FLVA 1BBGA 1XMAA 3CF5F 1LKXA 2HWVA 3CP8A 4ZDPA 1LFBA 4E7HA 2QVOA 4RGRA 1XD7A 3BPXA 3LSGA 5TJJA 2KDZA 1JK1A 4L9NA 4N4NB 4OMZA 5ICGA 2EPKX 3OR1C 1YX5A 3SFIA 3OYGA 1PJRA 2M0MA 4IPAA 4E4HA 2HVSA 2P5KA 3K4KA 2RGVA 1A04A 3L00A 4PCQA 2LTRA 2IA0A 2YSPA 1IN4A 2CFOA 4LB6B 4EJWA 2QENA 3MCZA 4GYIA 3I54A 4AM3A 1OCRH 2Q1ZB 2HS5A 3FHNA 4UB6C 4O5VA 3S1RJ 2LTPA 3EQ1A 2VPLA 2XDVA 1PVEA 3BR0A 3I59B 2DDBA 4XLHA 2JVHA 3ZMTA 3MHSC 2A6TA 2DDAA 1Y1VJ 3IH3A 3PNTA 3VYTB 1UG0A 5LRSA 3ABTA 5FFXA 4M2ZA 2HXOA 2ME0A 4LFAE 2KQRA 1B72A 1D3YA 2JA8J 1A1JA 2KL4A 5F04A 3WE3A 1QZZA 2CQ7A 4GYGA 4NHRA 1TWFJ 4GO1A 2E1MA 1UFMA 4R8HA 3UK3C 2D2WA 1K83J 3K70D 4ETSA 3L09A 1UN6B 2M45A 3GXOA 3ZQQA 1AOYA 1XNRE 1JJ8C 2ELZA 6PAXA 2RS6A 2XUBA 4LIUA 4L9VA 2DTRA 1QZYA 3ZN1A 2LJHA 1FOWA 4OAZA 4HTGA 1GDTA 1KYWA 5F3WA 2ODRC 5CLSA 1MSFC 2EPRA 5LGUA 4XLEA 1SD6A 4QLCU 4WX9A 3I55I 2UUBE 3AFHA 4LLLA 3GCMA 5IT9K 3CQZJ 4QIWN 2WBUA 2CG4A 1FYKA 3CO7C 3LQRA 2OQRA 1TT5B 2CQXA 3DPUA 3KWRA 3EPLA 5K5RA 2DK8A 1G2DC 2L9NA 5EGOB 3DEWA 1FOYA 2ENHA 1YUJA 1YFHA 2DMYA 2MDGA 2QZ8A 2XB5A 1HKTA 3VDXA 2VODA 1BBOA 4W97A 1KU7A 2E1MC 5F1JA 2CV0A 3A1YA 4N4OB 2L3CA 2L01A 1USSA 1GZ6A 3PUBA 2KJCA 4E7SA 2LTSA 2V6CA 3PQJA 4KMUX 4MTEA 4BEHA 3G71I 2EFQA 1MBKA 4WSPA 1SFEA 3J7ZI 1A1LA 1FJGE 2MA3A 2ZKZA 5E20A 1R22A 1FNNA 4KIFA 5C4JJ 3HOZJ 3S2HJ 2A5YB 4L9TA 2JOXA 4O24A 1J5EE 2RQPA 3ULQB 3DF8A 4AU7A 2IP2A 3MSWA 2M7AA 2R7VA 3HEFA 1HDPA 3C7JA 1VQ5I 2YUSA 2EOFA 3HOWJ 4F9AB 5K1YA 1RR7A 3K1MA 1P4XA 4PJMA 5AE3A 1FC3A 3LA7A 2FMYA 2HTJA 2VQGA 3TW6A 3W2WA 2YTOA 3OYDA 2Z3YA 1K4TA 1K78A 3PJRA 5A6KA 3HHHA 1D1BA 4CYCA 2L9RA 4ZZLA 1LNWA 4V2FA 5K5OA 5TISC 4DMIA 4NC8A 3ZP5A 2NRAC 1G3YA 2F6CA 2M1SA 1H9GA 3KX2A 4B3SE 2O7OA 3ADGA 2DT6A 4FCYA 1YE9A 1U5TC 2MLGA 2E35A 2OAZA 1XMQE 2DK5A 1TNSA 4XKCA 1FTTA 2DOEA 2LVSA 2XAUA 1Z3XA 2DJNA 2JUCA 2DQRA 3B6AA 3ABKH 4D5FA 1J26A 2VN2A 2P8TA 3EUHC 2VL8A 4JI8E 3ZQ7A 3JTGA 1BOBA 1F1ZA 4BXUA 1X48A 4G6TB 4OIQF 1MD0A 5CPRB 4F92B 3M9AA 4AUXA 5CFFE 3ASNH 5D5UB 2E60A 1YI2I 2GXGA 2MC4A 4EGZA 4HX8A 1QPMA 1R5GA 2X51A 2Y0SA 3F6HA 4DV6E 3CCUI 4M73A 1V3FA 1KZHA 2CGPA 4ZDOA 3BJOA 3M8JA 2GA1A 4HF1A 1RC7A 3S1MJ 3HRSA 2Q2EB 2ENCA 4U0YA 4UHTA 4XLPF 4LITA 4E7IA 1HCRA 1KQ8A 3BTCA 1BN5A 5DCFA 4MFDA 2ELJA 1H89C 3BJAA 3PSIA 1X1BA 2XF5A 1FZPB 1EF4A 4CYCB 1WJ5A 2ODRD 1PJQA 1YG2A 4UUSB 2R0QC 4DBRA 2AHQA 4HLYA 2W57A 2KKOA 3I4NJ 2EM6A 1ON1A 1OJLA 1J7KA 2XSJC 2XIGA 4L0ZB 5F27A 2LBSB 4B3TE 4RAFA 3FWEA 4ENNA 4DR1E 2BVLA 1O4XA 3CMYA 2WCC3 3U2RA 3MZHA 1U9OA 3DWLE 1W4MA 1WSUA 5M5XJ 2AQFA 2OPTA 3TL4X 4M3EA 4Y3OA 5J47A 3J80K 1XMOE 1POGA 4R79A 2EQ0A 3WGGA 5A6JA 1EH7A 4KNYA 2EP3A 4HQEA 3FISA 1XB4A 2UUZA 5CVIA 2FXAA 2HOTA 3MVPA 4ZYGA 3FM3A 1X3CA 2NUGA 2RQQA 4CCOA 2OD5A 2H94A 2F5DA 2ESNA 3ABMH 1MNDA 3ROUA 5GADJ 2DOAA 2GOXB 2HI3A 2ACJA 3R61A 1F4KA 3TP0A 5KL2A 4YELA 3V7SA 4AIHA 3IHUA 2ISYA 1PDNC 5FRNA 4ANJA 3CLOA 1HDDC 1D8JA 1ZBQA 2JY9A 4DV5E 2NUEA 3PNVA 4D7MA 3ZMSA 1YTYA 2PMZN 3F3XA 3JRGA 2L3JA 4P96A 3RPUD 1NH3A 3HDDA 2B9DA 3CCLI 3F8FA 2QSHX 1ZELA 2A6EF 2NUFA 3GZ5A 4RLQA 3OYAA 1IW7F 1LQ1A 4MEYF 2DLQA 1Z7LA 4DNCA 1LEBA 4C3IJ 3SZTA 3JRDA 1IN7A 2MKDA 3H5NA 1R23A 2A69F 1X49A 2WA0A 4DR2E 3ZGKA 1FP2A 4BYYA 4HPQA 2NNYA 2LT7A 2QSFX 5ED4A 3BTLA 5E8GA 3HQ1A 2ZXHA 4YFXF 1L3LA 3F22A 4IRIA 2K9MA 3CCJI 2H8WA 2HQNA 3I3LA 2J7JA 2DQLA 2FE3A 1A6QA 2VKDA 2V1UA 1XCVA 1WH7A 5D5XB 1SD7A 2JPBA 2XAGA 4DYCA 1VQ6I 5FD5A 4E70A 3BTJA 3RKYA 5L3EA 3T0YA 4CCKA 1O3SA 2QEXI 1Y56A 1U78A 2DFIA 1HNWE 2YZTA 2XF6A 2OZUA 2CSHA 2R7RA 1SMTA 1BIAA 4RGUA 3OIQA 1FY7A 2CQQA 5F08A 1HKSA 2D9HA 1OCOH 2EPZA 3R60A 2DPDA 1J2XA 4IF4A 5LRRA 1PKPA 1IBKE 3LMLA 3ONQA 3NAUA 2BY1A 3EPKA 2GXAA 2ADUA 3KE2A 1VQ9I 3F6GA 4R2RA 3SDGA 4V2GA 2QQ8A 2CO5A 3LA2A 2BVMA 2VPRA 2LF7A 5M5WJ 1HW2A 3GTKJ 2E36A 1YS6A 1P4WA 1AH5A 4O43A 4B43A 2ZJRF 1BR1A 2BHZA 1G2FC 1XNQE 5LHGA 1X19A 2DA4A 4HX4A 4I0AA 2QBYA 5CVUA 4JI6E 4J01A 2EM3A 1B8IB 2IA2A 5DM7F 2HPIA 2YTIA 1BOAA 2LCEA 4U87A 1UHWA 4BNCA 3EYYA 3L2WA 2ZJ2A 4U7BA 2V9KA 5E79C 2EZ6A 4L9JA 2E2JJ 1QA6A 2YRKA 3S17J 4ENJA 2ADRA 2QQ9A 3GTQJ 4BC9A 2X0LA 1KQ9A 3RQIA 2FBKA 1YITI 1B9NA 1Y8QB 4M3BA 2EOQA 4GKJE 3CO6C 2JRMA 2EPPA 2QA4I 1Z67A 2QQBA 4ZJZA 3LSMA 2ELHA 2ZNZA 3ECOA 1A35A 3DPTA 5FD6A 3CC2I 3MKLA 1D5VA 1WH5A 1K6OA 1IN5A 2D1VA 2OU2A 2ID3A 2RV8A 3VEPA 1MDMB 4UXNA 1Z91A 1UJ8A 2FOKA 1F5TA 1L4SA 4GGGA 2EFWA 2IXSA 1T0FC 1YSAC 1YQAA 1USTA 5E1ZB 2PJRA 1OYIA 2L9SA 2LFBA 2RS7A 2P6TA 3M1EA 5F6FA 4O3MA 3VODA 1GVDA 5EYRA 2ZMEB 4RM3A 4P5OA 4XRFA 5E18F 2FEZA 5F0CA 1MMAA 2QCOA 3FXKA 4XKBA 2PMHA 3KP2A 4Y4RA 4A3KJ 4JBAA 5J8CA 2IAIA 3W3CA 3BC8A 3L2RA 3LAPA 1HA8A 3S2WA 4AVZA 3ADIA 3ZCOA 4EJTA 3K1PA 3W6KB 2O9LA 3S3NA 2DJIA 5BNGA 4A3BJ 3CCYA 5K7ZA 5D4RA 1I1GA 1QO0D 3HOTA 3FHZA 2Z1DA 1BC7C 1EV7A 2DMIA 5FKMA 2K7IA 2EMHA 3E6DA 3FXRA 4AD9A 2V26A 2GLIA 4I09A 1S3JA 4IRGA 4BE0A 3JRFA 2PFBA 1VFCA 1OCZH 3FIGA 1Y8RB 2BGCA 1AU7A 1R6RA 4HF2A 3CUOA 4CCJA 3CJQB 1RESA 2WAQA 1HBXG 3QQAA 1D1AA 4P9FA 1RIOH 3Q0VA 1LFUP 2L7KA 1WJCA 1IUYA 1ZAAC 3MAJA 1TZLA 2YX4A 4XLCA 3VYXA 3ZQHA 4MLQA 3KETA 4WK8F 2IS6A 4LG3A 4M71A 2QYOA 2JMWA 2K9NA 2YSRA 2HZDA 2K9LA 2ISZA 2IPQX 2TDXA 4XBFA 1MBFA 3SYTA 1Z1DA 1MMDA 2M8GX 2IS4A 4I99C 3WODF 2H09A 3I9V2 3QPSA 1RKWA 3IWBA 1A1IA 2RSIA 3N4MA 1JE8A 4FTHA 3J7AG 3MZYA 3J81Z 2JN6A 1G3WA 2BW3A 1D0ZA 3OY9A 2MFZA 2EPFA 3TKYA 3IAM2 3J7AY 1GT0C 2EORA 2E1MB 4ON0A 2QSGX 4B3XA 3IH2A 5AIPA 2B0LA 2VUMJ 4CYDA 4EQQA 1KQ0A 1LE8A 2CUJA 2R7UA 2VBYA 2EOZA 3IP4B 2EZKA 1JKOC 1DQUA 4BC7A 1HOMA 2M4KA 2COMA 4X65E 1DQ3A 3ZPLA 3VYRB 5IOZA 2A3SA 1SFXA 2ZXWH 1E3OC 2Z2SB 4B4CA 1R1TA 2EL5A 4XICA 1OR7A 1MNMC 2ZNYA 2CH0A 4XSXF 2B7TA 3GTJJ 4PFPA 4TUIA 1TN9A 3BQZA 2F4MB 3K6GA 1HC8A 1Q1HA 3JR9A 1I94E 2VC1A 3FM5A 3H3UA 2LMZA 1KU2A 1U2WA 4F93B 4QWQA 3BG5A 3L2VA 3RCOA 1B1BA 1MJAA 3JRIA 4R2EA 2PEXA 3W2VA 3EUKL 5J8FA 5DCMB 2KRFA 4G12A 5M3MJ 1WGXA 5BOXA 4F54A 1R36A 3F8BA 3TEDA 1SANA 4HDUA 3LQQA 4A3CJ 5EGOA 2X6OA 1SEUA 4Q48A 4XIDA 2TCTA 4PJ0C 2VBXA 2V85A 2EM4A 2KJBA 3ZXSA 4P9UA 5LGNA 1YYVA 3C2BA 4M6YA 3K9TA 4CCLA 4CDGA 1TWHJ 4IQ4A 4XM3A 5L3DA 2VBWA 2X9DA 2HXIA 2RVCA 4BUPA 1PUEE 1B6AA 1W5TA 2CT1A 1GUUA 3CUQB 4XSZF 3IWCA 4LU9A 3GMEA 3IWFA 1H0MA 4UV9A 1SVMA 2YTDA 1JKRC 5IP6A 4ZYHA 1FOKA 2GWRA 3HTUA 5FGMA 3S3OA 2NVXJ 3SEQA 4Y13A 2JVAA 2L4MA 3E1SA 4BJ6C 4K2EA 4LD5A 2ZJQF 5IYDJ 4RDUA 4OIRF 3BR3A 2EMKA 2DW4A 3KFWX 3KCCA 3OL4A 3VB2A 2ZCWA 2KRCA 4EM0B 4IHXA 3ASOH 3GWZA 3KP7A 5H6QA 3DLAA 2RPCA 4HQMA 4L8NA 1DP7P 3H1CA 3HKZN 1HNXE 1OPCA 3CC4I 4M9XA 3DJWA 3CCRI 1X3UA 5IT3A 1BJZA 1E17A 4MLOA 2G0EA 1W5CC 1G3SA 1ZYRF 1A6IA 5BQTA 1IRGA 3ECRA 2HDWA 1Z0XA 4R2QA 1J9IA 1RZ4A 2IGMA 1CF7B 3BCBA 1ENHA 2YPRA 4CCMA 4IXAA 1QU3A 2JYAA 4R2DA 1VQKI 1FT9A 3E5QA 3SFZA 1A36A 2JVGA 5KL5A 2VT3A 2CWEA 3L9FA 5ICFA 3EUAA 5ERIA 1YW9A 2V7FA 2DMNA 4YIIA 1R5ID 2MSYA 3K1NA 3P9KA 3QP5A 2DO7A 3V8LA 4E7ZA 2HOAA 1N36E 1Y0UA 1MMNA 5BMZA 1JUPA 4NQWA 1VNDA 3NWTA 4KIBA 3OYEA 2EOXA 3GFMA 1G3TA 3K4NA 2IGKA 4EMSA 2F5FA 2R92J 5F0FA 1R49A 4G9YA 2QKMB 3GTMJ 4JI3E 4BQQA 4YFNF 3LFUA 3S2DJ 4X64E 2MC5A 3S16J 4BH9A 4Q47A 3A4CA 2Q8UA 1AA7A 3K0LA 2P5LC 1SD4A 3B6CA 4FT8A 4JX6A 4D0PA 4AIKA 2STWA 2LUPB 3OIPA 2PMZA 2IJLA 2VQCA 2DCEA 3EPHA 1MH4A 4LK1F 4NXNE 1XGSA 1XGNA 4O6JA 3AG3H 2R5YA 3O6BB 5BS6A 2EWNA 4UVBA 1FX7A 1AKHB 5FKKA 4Z6YA 4XLFA 2KHXA 2AXLA 1P7JA 2W4SA 3DKYA 1ZBTA 4ZTFA 1O57A 2L7MP 5JR3A 2FTXB 2EPMX 5K7HA 3E7LA 1OR7C 3IAS2 4LB5A 5E1XA 2CTDA 5AASA 3M8EA 2DMPA 2IS2A 5KL4A 1JTXA 1G8XA 1NG6A 1ZRDA 2XGCA 5EEGA 2Y9ZA 1IG7A 1P4AA 1YPNA 2JK3A 4A5MA 1X6HA 3OYKA 1CGPA 1A31A 2OCCH 1EH6A 3IWDA 4G7ZF 2YR2A 5ILUA 3JRBA 3GTLJ 4N4RB 1O7LA 4RMNA 2WV1A 3OOUA 1YS7A 1UAAA 4BBRJ 4NB5A 4Y33A 3MHHC 2FJ1A 4UV8A 4DUZE 1Z21A 2QLZA 3HOYJ 3QPLA 4B3ME 4A93J 3BY6A 4LK0F 4XL9A 3I56I 2EBIA 1XN7A 3Q0WA 3OS0A 3LA3A 1S72I 4AIJA 4CGZA 4LTYA 1OLTA 1JT0A 4Q28A 2RDPA 2P5VA 3R0AA 1DU6A 2EMXA 4GKKE 3F0CA 1C0WA 3W6VA 3RIRA 1NK3P 1O7FA 2NVQJ 4IOAF 2A05A 3OYJA 2LH9A 3G1LA 4RAYA 2OV7A 3ADJA 2L5QA 1R4NB 3TW7A 1S8NA 5FLXK 5F64A 4L5JA 1LVAA 1OYWA 5HVQC 1I39A 1MH3A 4M0VA 4HYEA 3PNYA 2L2KB 4N9HA 1MBEA 3MN2A 3I5UA 1MMGA 3O2PE 4CZZA 1CF7A 3CCQI 3AG2H 1ERDA 4NZVA 4FQGA 3K70C 2EIKH 4LLNA 4YFKF 2H36X 1X6FA 3DTKA 5FLXZ 3HOVJ 2EH3A 2V1XA 1SVOA 3X2QH 2KRHA 3DCFA 2HNHA 1AKHA 1XGOA 4NDLA 3M3YJ 2R7DA 2HYGD 4M74A 5FO5A 4BE1A 2FA5A 2KDOA 2MBFA 2EV5A 4LF4E 3IRQA 1R1VA 3MZ8A 1V55H 5DDGA 2A6HF 1FEXA 4YEJA 3SZGA 1GXQA 3LAJA 2EJ4A 3DEUA 1OFCX 1YYWA 1MNEA 4L5EA 5DUKA 4G7OF 1B72B 3FMQA 2FV4B 3TP3A 3TQMA 2HU9A 4BXXJ 5DUIA 4WYQB 4LMYA 5CKTA 4BQNA 1P2FA 3ZMUA 2LY9A 1JXSA 3FXJA 1NEIA 4BMJA 4XKWA 1NK2P 5FKLA 4BXFA 3VHTB 1WJPA 2M9AA 3BR1A 2JJ7A 2HOSA 1R9TJ 3BJ6A 2Z9OA 2H1LA 3DBHB 3F8CA 1QQIA 2LSOA 4RLFA 5J3LA 4LG0A 3WGHA 1D8KA 2R7ZJ 5H20A 4A3LJ 2Q8KA 3HTSB 3DU6A 3OOPA 3MKZA 3VSLA 2XGEA 5FRMA 4ZYAA 2KIQA 3MKYB 3HJEA 3T5XA 2LJUA 1PYVA 1SFUA 1O3TA 2CQNA 1GXPA 1MJBA 3PSFA 2I8DA 2MABA 2QWWA 4WXDA 2OQGA 5DEQA 2DU9A 3U21A 1OCTC 4ZYEA 2L3DA 3HOUJ 2WY8Q 4A6DA 4CCNA 1I6XA 5A6BD 5IYBJ 1SD5A 4DZJA 4OMYA 2JA6J 3JU0A 1YW7A 4RB3C 2UZKA 2CYYA 1RRJA 4BBYA 5KL6A 3U1KA 1BL0A 2N8GA 1YIOA 5IWAE 3ZOBA 2YU8A 1IRXA 5DNYA 3R0JA 4ENMA 2VC0A 1WHQA 2MG4A 3NEUA 1ULYA 4RH8A 4HV5A 1HKQA 3BG3A 2VQEE 1JGGA 2K3PA 3L2QA 1U6GA 5CJ9A 5KCMA 3KP5A 3O8HA 1UMQA 4F2JC 3B02A 3OSFA 4PUSA 2NVTJ 3HPSA 3D5LA 2ZFWA 5AE1A 4IHSA 2BZTA 1R71A 1WFXA 4XR6A 4MQVA 1Z3YA 2DA3A 4WFTA 2WY7Q 3HRTA 1TNTA 4DBQA 4J00A 4O5GA 1V5FA 3IH4A 4DV2E 3PUFA 3H3ZA 2PI0A 1P7IA 2DOFA 1U5TA 2IVMA 2DLKA 4DGWB 3QPTA 2XPWA 1ZK8A 1BI0A 2DA7A 2XAQA 3N97A 5A69A 4QTRA 1LDDA 4FISA 1MMSA 3K4BA 1VQOI 3MEXA 1YUIA 3RJPA 3C1DA 2O8KA 2EN3A 2CMPA 4F52A 1NCSA 3JAMK 2DMTA 2ZSIB 1ZG1A 1RUNA 4KMFA 4JK1X 2PRTA 4CO8A 4AWXB 1T98A 3HXLA 3JAMC 2IA1A 1JUSA 2BXZA 2HQ5A 4GDFA 4IS1C 1X2MA 1JK2A 2BW3B 2VKHA 5IT9C 2LRDA 2HDCA 4F3QA 3QP6A 1MBJA 4BGDA 3GW2A 1BC8C 3NQOA 5IXMB 5GAHJ 2IT0A 3WTTC 2E7XA 3ZRGA 2MGQA 1XMXA 4E7LA 2E1CA 1PDAA 2W7NA 4R2SA 2IGNA 1ETQA 1I6HJ 4DV1E 3KEQA 3CZ6A 3CDLA 2XPVA 4C3JJ 1XMKA 2MH9A 3K7AJ 4RAZA 2QUFA 2K4BA 5ILSA 2LNBA 3LL7A 4HDVA 5HDKA 5LMUE 2PQ8A 2BB8A 2BY0A 2CW0F 1F2IG 3HC7A 2NVUB 2LY2A 4UVAA 4AQYE 1TBXA 2JT1A 3F8MA 4HF0A 2K40A 2I13A 1ETOA 3TO7A 2DYRH 4DZPA 5LD2C 2KZVA 2EMAA 2EK5A 2Y30A 2ETHA 2EM0A 4WF2A 1K6YA 4H4KC 2PN6A 3P5JA 1ZREA 1TL8A 1VQ7I 4LF9E 2LK2A 3S32A 2H27A 3RPUA 3IL2A 2L02A 1R58A 2VI6A 1X1AA 3GFJA 1X1DA 4C9YA 1ZGAA 4A0XA 3ML6A 3OYLA 4DR3E 1ONVA 4ESJA 3AG4H 4B48A 3HOXJ 3TMOA 3H9QA 4UUTA 2E19A 4M3DA 2Z33A 3WE2A 1UG2A 1O0WA 4PDKA 2NNNA 4WPYA 5B5EC 1RPWA 2ZMEC 3OWTA 1APLC 4M9SA 1Z77A 3ABLH 4EVIA 2O5RA 2XRLA 3FKIJ 5A2QK 4BDZA 5J1YA 2E1NA 1RR8C 1ETKA 3HKZA 1KGSA 2UV1A 4A5NA 2EN4A 1IAWA 1TT0A 3TOAA 1FTZA 4JI2E 1YO5C 1FYMA 2O3FA 2FBHA 3BZKA 3UNGC 2F8BA 1KU3A 2Z5UA 3OL3A 3OS2A 3S14J 1QRYA 4EM1A 3ZOQB 3FBNB 2NOJB 3KP3A 3C18A 4LJZF 2WC2A 5CVJA 3CTAA 2JQ7A 5CYVA 2DBBA 2BXYA 2ZJPF 4A3DJ 4IOCF 3QU6A 2BYVE 1DDNA 3NRVA 3SJMA 2V4JC 2O6GE 5EEAA 3RKXA 1X5WA 2XROA 4XOPA 2P7CB 4ABZA 2LD5A 1WRJA 3JREA 3MQ0A 4XRSG 4S0HB 2HEOA 3GF2A 2KPMA 4DUYE 2YU9J 4EGYA 2A5WA 2M2EA 2EL4A 4RB2C 4C2MJ 2VONA 3AUZA 4L0YB 2LMDA 1ZU1A 1YLFA 1K61A 4HAMA 4K0KE 4L5NC 3CMAI 1E2XA 4HV6A 4R8OA 5LGTA 1J59A 3PO2J 1I1SA 2VQFE 2MDRA 2L2MA 4OWRB 4I2OA 3RTRA 4UUVA 3MFKA 1STUA 2K4VA 4LF7E 4BJ5C 1FMVA 3JTZA 3J80Z 5E3OA 1B69A 2ME6A 1ETVA 3RKWA 1WCMJ 4NC6A 2K9QA 3ZMDA 2EPAA 3L7WA 1IJWC 1EKZA 2LKXA 2L54A 2HKOA 3LSTA 3E6BA 2F4VE 4R03A 4LG0B 3L1PA 3WU1B 3KYLA 4R2CA 4KN7X 1W0UA 2NA2A 2WBTA 4DR7E 1VQ8I 4C2UA 1XTAA 3ZQGA 1FBSA 5L3CA 2R4GA 1HW5A 5J6XA 3GZNB 1KA8A 2FMLA 2LF8A 5AONA 2VOOA 5FB2A 3EDPA 5CQEA 2ESHA 4E6KG 2UXBE 4IO9F 2FSWA 3CC7I 3P7NA 2WZOA 2KLOA 1BB8A 2UXCE 5GTHC 4ZYDA 1DPUA 1A1KA 4GEQB 5DV5A 1R4MB 3ZQFA 4AIDA 2E7WA 4KJZA 2YTEA 3DV8A 3HBLA 2G9WA 4KT5C 3M7GA 2YU3A 4KT6A 1IMUA 4ZTJA 2VJ5A 2C6YA 3A2KA 4B8XA 4EJVA 2EE8A 3IKTA 2KISA 1A1FA 1PJSA 4X8WA 3A01A 2LKSA 2MC6A 1I27A 3KLOA 3F6OA 2DT7B 4XNFA 1GTKA 4RHBB 4PJLA 4XN0A 5FLXC 4G94A 1IV8A 2FBIA 1XGMA 1YJWI 2BEOA 2A61A 3DFGA 5M3FJ 1T33A 3M99B 3HIFA 2V1NA 1FBUA 2VJIA 1BJAA 3OYNA 2HTSA 2QF7A 3C3WA 3QYBA 5TGTA 2H1KA 1TW3A 3I4MJ 3WTWC 1WJBA 1WKMA 3UR3C 2M0CA 4XORA 1CQTA 4ASNA 3CCVI 2V6EA 3IRRA 3OMYA 2R7XA 1U3EM 3GO5A 1PP7U 1SMYF 1E3PA 5FKOA 2DA5A 2J5OA 2VQHA 3RQ4A 2RSMA 2ZFUA 5LEKA 3Q3SA 2GZWA 5K5QA 2JXPA 4XMYA 1Y1WJ 1VQNI 1BR2A 4PGGA 2CRGA 3Q9VA 2KHMA 3V7CA 1QZEA 3VSKA 2XF7A 1S7OA 2ZB9A 2JA2A 5HDNA 1TQIA 2KONA 3MD2A 2F4OB 2NS8A 4MHGA 2K3FA 3H5RA 2OTLI 5IPAA 3DXJF 3GFLA 4G6QA 1ETWA 1KYZA 1WPKA 3ERED 2FQ3A 3DBLB 3QRFF 2UWMA 1X1CA 2EMCA 3UKGA 4LGWA 2M3AA 2EN1A 3PL8A 1TWCJ 3BGHA 1ZGWA 2YTFA 3H92A 2EPXA 2WADA 4DW6A 4E7KA 2YTNA 4BQAA 2RNJA 4C2TA 3EYIA 1P6RA 3G6EI 2EOMA 1FBQA 1IC8A 1FKAE 4JX5A 3JRHA 2Z99A 2CS3A 2BBYA 2O0YA 5DTDA 1RUOA 1N34E 1MJ9A 4XOTA 4PJJA 5KAFC 3FIWA 1Z1BA 2LG4A 4OINF 2CU7A 3FXUA 2JSCA 5AC4A 2X1EA 4IQJA 4RAGA 2Y0SN 1IDZA 3CJTB 2ZSHB 2ELYA 2EZHA 1KONA 4PK4A 2W24A 5M5YJ 5IY5H 4CHUA 3FMRA 4JYKA 5J4YA 5C44J 4Q5SF 5A6BA 2ZC2A 5KVRA 2LC2A 2ZXIA 3JW4A 4NUBA 1XX5A 4IHTA 1IN8A 5LLQA 1IQSA 3BP8A 1G59A 4EV0A 1X1PA 3J80C 1NHAA 1UZCA 1W0TA 3JRCA 2XSDC 3VYYA 3ESWB 4BKXA 5DS9A 3U9GA 4OOIA 1FOXA 2FNAA 3VYSB 2CUFA 4EJOA 2E72A 4A3FJ 5GPCA 3GZ6A 2EMFA 1XS9A 4JQFA 5IP9J 5F0HA 3OYMA 1HW1A 3HSFA 9ANTA 3TO6A 4JI5E 2IEKA 1UILA 2MW8A 4U0WA 4AVPA 2A25A 2L2NA 3O3KA 1IBME 5HS7A 4S05A 4A69C 5H2FC 2LBFB 3P1XA 2Y2ZA 3Q0UA 1T2KA 3OYCA 3Q5FA 1ON2A 4FETA 5JVTA 2YTPA 5ICEA 4IHWA 2D1HA 1LEAA 2X6WA 4EJUA 1D1CA 2ZMEA 3TDUC 3LNQA 3BG6A 2MH2A 3WHCA 1VQ4I 1MZBA 1XSDA 4RS8A 1T95A 4PGHA 5FROA 4KIGA 1W5SA 2XKOA 4X6AJ 5KNLA 4ZC3A 2RC4A 3PQKA 1IXSB 2STTA 4I8OA 3KP4A 1HXDA 1Y39A 1VZ0A 3KZYA 3C2HA 3AG1H 3TQNA 1EH8A 3REOA 3H09A 2VJJA 2EQRA 5LEJA 4B3RE 2Q2EA 1OCCH 3DPLC 4WXCA 1QHGA 1JKPC 1YJNI 2EMGA 5HS8A 4I02A 2JPAA 3A0BC 2OTJI 2X6YA 1F36A 1SAXA 4DR4E 3FXOA 4LF8E 4I6ZA 4L5IA 4KICA 1XSVA 1TQMA 1J75A 2EFOA 3ADLA 4BY7J 2L9VA 3RZDJ 4IJAA 5JHFA 1FSHA 3PFYA 2CV2A 1B4AA 3S93A 1PP8F 2W85A 3S1NJ 3GTPJ 1QNTA 2RREA 2DIXA 1YW8A 1K7AA 1ZAOA 2UXNA 4Z2YA 3WTXC 1ZRCA 1IXRC 4KDPA 2Y48A 4KHPE 1JJ6C 3QU3A 4P78A 2LY1A 1ZGJA 2VOPA 3FXQA 1N32E 5E1WA 4M9VC 5GAEJ 1QU6A 4PZJA 3LOCA 4DV3E 2K86A 5BPDA 1BI2A 4RM2A 1A1HA 1H8AC 5DYMA 4BACA 1O3RA 2ELKA 4V19K 2EMWA 1AWCA 3PM1A 4YY3E 2J5PA 2V86A 2EPCA 3GBGA 2WB1A 1IV6A 1RQ0A 2OF7A 3EQLF 1AHDP 1A1GA 1JHHA 4G8XA 4DV7E 3JCUC 4A6EA 4CICA 2BOLA 4R2AA 4A3EJ 2AS5F 1STZA 1W36D 3OSGA 2UUAE 4S04A 1VTNC 1QVUA 4IX7A 3O8GA 1Y6IA 2DGCA 2DODA 2WBMA 4MFEA 3OV8A 1I50J 3M4OJ 4RGXA 3EPZA 3KEOA 3HL2A 1IXCA 3RI4A 5EF6A 2DA6A 5HS9A 2XPUA 2KOUA 2EZIA 4IHVA 3RYPA 3ZR8X 3E6MA 2HGHA 3BOQA 1XC5A 2IGOA 1E0EA 2WAEA 1LDKB 2OUMA 3GEZA 3S3MA 2YS9A 2QGUA 3BDDA 2A07F 4F6NA 2DXIA 1S7AA 1UB9A 3BT9A 4BJTA 2GOMA 1SVLA 1BI1A 4O4KA 2OCEA 3B73A 2QKLB 3OYBA 1ZQ3P 2W48A 1BI3A 2OJED 1S5LC 2DT5A 2EFPA 1ETYA 1TW2A 4YIFA 4DR6E 2P7VB 4FX4A 4M3FA 4KITB 2IHR1 4HLXA 5L3GA 5HDGA 1QBJA 3I59A 1RKTA 1YZ9A 2EMIA 4F7ZA 2HPMA 3BTIA 3G4SI 5D8KB 4HG2A 4YIRX 4F91B 2MD0A 3EETA 3HGGA 3SEZA 3WTUC 1T6SA 2H6CA 5J1UA 3OYHA 3HG9A 4BAYA 3MMYB 4A3IJ 3WTSC 5FKNA 1LB2A 1ZARA 2PBIA 3PO3J 5HNFA 1DP3A 1X6EA 1P9QC 2LE2A 2E71A 2GXBA 2EN7A 2Y9YA 2JPCA 1UELB 4I98B 4NHJA 2NABA 1P92A 1R1UA 3ZQCA 1IGNA 1A5JA 1IDYA 3LSJA 2YWQA 1V54H 1SFOJ 5H6RA 3HPZA 1X4OA 3OS1A 4XK4A 2HC5A 3LSIA 2EOSA 4FE7A 2GAUA 4X66E 1X3WB 4D5CA 1U8RA 1RI7A 3OMLA 3A02A 2CJJA 1DPRA 5A2QZ 2HYFA 3K4MA 2VKVA 5LL6R 3WU2C 3ECHA 3DQVC 4J8ZA 2WV0A 3A0HC 4XLNF 1WHNA 4DV0E 5EG0A 1NG7A 3KPHA 1VF9A 1RNLA 1OCPA 1N25A 3K6QA 2V83A 2E5NA 2JA7J 3SHFA 3NWSA 3WU0A 3F23A 3F72A 5BR8E 1IRFA 2MKNA 1ORKA 4II2A 4AYBN 2VIXA 2ZO4A 3N05A 2JR1A 5HLHA 2H8RA 2EM2A 2DRPA 2IRFG 3WHBA 1GV5A 5KL7A 4BQOA 1IO2A 1S6LA 1MGTA 1DGCA 2B63J 3DU5A 5FFZA 4BU2A 2EIMH 4FASD 1FMWA 2ZBKA 5D5VB 1F43A 1PUFB 3H36A 1ZN2A 4FK5C 1MIJA 2DMQA 4IVNA 5JLXA 3AV0A 4BHPA 2DYSH 3HUGB 4R1HA 2EOYA 1VQPI 2CUEA 1DI2A 3HPGA 2I9IA 4AYBA 1UHMA 2BBGA 2GQQA 3CCMI 1FJLA 1T4LB 3T1HE 3DKXA 4BBSJ 2WWYA 4MEXF 2FOWA 4RBOA 2WAFA 5GP9A 1LLMC 4YG2F 1Z7UA 2E1OA 2X85A 4U7DA 2JA5J 1WI3A 1NTCA 2MC3A 4EATA 3BBGA 3G73A 1PJTA 4LF6E 3WTYC 1IRZA 4MNUA 1D5YA 2LP0A 2ID6A 4DYRA 1J09A 1ZLJA 1VI0A 3BPVA 2I10A 2PJRB 1GHCA 2EOOA 2X48A 2ECBA 2FRHA 4BY1J 2AO9A 4JYAE 5B1BH 3H0DA 1TP4A 3U1DA 3AL0C 1G6NA 2FF4A 2NVYJ 2L4AA 2VE7C 2DFFA 2XVCA 3QYFA 2QQAA 4HX7A 2EM8A 2YT4A 3CDHA 4CH7A 1IUFA 3W2AA 4CA0A 5E3MA 2RTXA 2M4IA 5CQGA 3T1YE 1T56A 2P0WA 1WHUA 2A68F 2VASA 3F9KA 1H88C 3IKVA 3L2CA 4HNTA 1HQCA 5DCMA 2W00A 2EM7A 1WJFA 3TO9A 3FDYA 1UBDC 1X4PA 3I4PA 1GV2A 4PSWA 2RQLA 2Y31A 3S8PA 1ZG5A 1BA5A 4OAYA 4JI4E 1V5EA 2D45A 4GZNC 3BR6A 2YPNA 2WAQN 4KISA 4Q35B 1KU9A 2HGCA 2V9VA 2K5CA 4M30A 1T4NA 4EEFG 2V8QB 1OKRA 2DI3A 3G3ZA 1W36C 2ECCA 2R76A 5E17F 2LUQA 2HZTA 1E3HA 5B66C 3CP2A 2EPUA 2YRHA 3DF6A 1QHHD 3FXMA 3I64A 2EMLA 3MKWB 1B59A 4HEA2 1QVTA 4D1QA 2Y75A 3RPQA 3I53A 1I3AA 4B1RA 1GQEA 3G1OA 2DFHA 2BE5F 4YRVA 2DMUA 2XASA 5LFAA 3AKZA 1MEYC 2JP9A 5HOOA 5EDNA 1OISA 1W7PD 4II3A 3TGNA 5B1AH 2L8TA 2V87A 2VB6A 5JHUA 3GLLA 3BG7A 2I5UA 2VRDA 4MGRA 2PLYA 1R00A 4ITVA 3OYFA 4A12A 2K7LA 5HLGA 1B9MA 5DD4A 5DD8A 1DGRM 5D4SA 5E3LA 4GCVA 3S1QJ 2JRTA 1J5YA 4DJAA 1SFKA 1D0YA 3H5AA 2VLAA 3J81C 2HJJA 2EL6A 1SR9A 2L6MA 3V7RA 2W25A 4JX4A 4D7NA 3EPJA 2IBDA 2DA1A 2JZYA 2OC6A 1VQMI 2OBPA 2KMUA 2DFEA 2K02A 3HZJA 2M5WA 4G6DA 3HPHA 4C30A 2NS0A 4ZH4F 1LUJB 1UHSA 4MO7A 2LLKA 3DP7A 5IT9Z 2R7OA 3BLYA 4NXME 2Y0MA 2EQ1A 3H3VK 4N0BA 2HDDA 3M8FA 3C6KA 2GBYA 1UCRA 2V1DA 5D5WB 4AC0A 3HUGA 2R7WA 1TLHB 5ILVA 2E5ZA 2F4IA 3R4KA 2DA2A 5EJCA 5J4VA 1T0FA 4UB8C 5D6EA 1WVRA 3RZOJ 2BHYA 2BY2A 3ZMZA 4XLAA 1S29A 2NOGA 3RDIA 2YTJA 4IJDA 1FIPA 4BL0B 2DB2A 2D5VA 1S9HA 3HB9A 3A01B 1S7EA 3E6CC 2EN6A 4YHHE 2O61A 1X2NA 2LBFA 1MW7A 3QWLA 4LFUA 1WI9A 5CVRA 2M1BA 1ZR4A 3I58A 3BR5A 3QODA 2KFDA 1O3QA 3A03A 1BR4A 1HSTA 3M1CA 3GYHX 1V5GA 2YX7A 4HA8A 1B8IA 4LLGF 3VFZA 2HOEA 1JUMA 3QAHA 2VXZA 2FNPA 3E3VA 2B9SA 4HOBA 2RNGA 3PFIA 3W6JB 3DLLF 2M7QA 5D6FA 3V8JA 2R5ZA 4TUGA 2NXNB 1N77A 2GIZA 5EEHA 5D8LB 1U8BA 3QPHA 2EZLA 1UHZA 4MTDA 1IBLE 2FUG2 2EOIA 4TV7A 3WTZA 2XB0X 2LR8A 1PUFA 2VBZA 1N75A 5TSEA 2WBSA 4U88A 1DGWY 3J7AO 3D5RC 3VOEA 2LKPA 2HVQA 2R93J 4X62E 2KIUA 1WXRA 2ZM6E 2CSOA 1ZR9A 2Z16A 2EMZA 1U0JA 4ESBA 2GA2A 2RKHA 3E5UA 3P9IA 1FWZA 2L7ZA 3QOPA 4N9IA 5GTIC 1FLIA 4ZDLA 4KN4X 1QGPA 1ZG3A 2PX9A 5KAIC 4EM2A 5E3NA 2X1CA 2AXTC 3M07A 1EKEA 4I76A 2EILH 3S15J 3HTXA 5HLIA 3E5XA 1Z05A 5EZHA 2FD5A 4QPQA 2E5LE 1GVJA 1W7PB 1K79A 1U5TB 1Z6RA 3CDIA 5HNHA 1DU0A 3DEEA 1EJ9A 4BE2A 3F6VA 4J19A 3OR2C 1XDSA 3FZVA 4IZZA 4FX0A 1RETA 2VJ4A 3D0SA 2FX0A 1LVKA 2K4JA 2F5VA 3L2UA 3V4GA 4DQ2A 3H9JA 2M87A 2XGXA 5JI6A 1Q1VA 1ZH5A 2MLKA 3ELKA 3VYUB 3ABUA 4D9JA 4HSTA 1RMDA 1HLVA 1LE8B 5K7FA 1DUXC 2W82A 2P81A 1TF6A 3NARA 4RB1A 2W1OA 1R5HA 5KHDA 4HNVA 1YOVB 2M9HA 2EA2A 4X0GA 4Y17A 1Z9CA 1LDJA 4CUGA 5C4XJ 2N3HA 4OOGC 4BCAA 1T38A 4OIPF 3K69A 2EINH 4WWCA 2GIVA 1IN6A 3FKJA 4A3JJ 1YJ9I 1KJKA 2COBA 4HNUA 4R2PA 2KZGA 2NYXA 1H9TA 3H0GJ 2VQLA 5T6JA 4W1UA 2JWTA 3SQNA 2ENAA 2VF1A 2BV6A 4DYQA 2XKPA 3LLHA 4I01A 2F5CA 2LYCA 5HODA 3BIDA 4ESFA 1F9NA 1K4SA 1HF0A 5IV8B 2JOBA 3RKQA 1TWGJ 1G2HA 5EZGA 1YRNB 4ZZDA 2GPIA 2V89A 2Y69H 5ADZA 1BW6A 5CVVA 1XDUA 2MYSA 2YTGA 2EWLA 2X1DA 5C3EJ 1MDMA 3K4CA 4U0VA 4IKFA 2PG4A 2XRNA 3KYCB 4P55A 2QM3A 3V42A 5L3FA 3HSRA 3FF5A 2HR3A 2IW5A 2JUGA 3BCAA 3KZZA 4P1WA 1ZR2A 1X47A 2VXDA 3CF2A 2XHKA 4GRIA 2R7SA 1FYLA 4IL6C 3C4TA 3T8RA 2ZXJA 4B3AA 5E8IA 2X6XA 3IC7A 3AAFA 3BQYA 1ZRFA 3CD6I 3K2AA 4X9JA 5IYCJ 2DN0A 2CW8A 1YYKA 3HRMA 3P9CA 4NQWB 3DTIA 1JTYA 2DSYA 4LFBE 3ZN0A 3ERMA 5AE2A 4XQFA 3KEYA 3TBIA 1Z6TA 4FE4A 3D1NI 3VWBA 2V88A 4F9BB 2QBYB 3HGYA 2V79A 1JI8A 1WJDA 3J7Yp 2Q0OA 1WJEA 2OA4A 2M34A 1YRNA 1IF1A 1BM9A 2LRSA 4KFCA 5BPIA 2LV2A 2R3SA 1HSJA 1R7JA 5LHIA 3JRAA 1BIBA 4RB0A 1G4DA 1ACIA 3PIOF 3PIPF 3QOEA 1XG1A 3KYDB 4MLVA 4Q4ZF 3D5SC 4WXHA 2N3GA 1TQPA 3CUQC 3CUQA 1TC3C 4PJNA 3KP6A 4PSXA 5KK1A 2F5EA 4NNJA 4PFOA 2EPLX 4F6MA 4Y52J 3OYIA 3IV5A 3FX3A 5FJ8J 3K2ZA 2E2IJ 2CFXA 3G2BA 1T08B 2P6SA 4CZCA 1T8IA 2F2EA 2TRTA 1SC7A 1JGSA 3K4JA 5GAGJ 3G1MA 2LVHA 3FK6A 3HSEA 3I0TA 3WTVC 4IEJA 3GFIA 4A3GJ 2G7UA 3IUOA 1W1WE 4KYWA 4MIMA 1XSXA 3LSPA 1T39A 2XAFA 4XONA 3ZQLA 2MD5A 2YTQA 4RA2A 1VQLI 2B7EA 2JWOA 4JV5E 2UXDE 2EA4A 2VKEA 1M1EB 1REPC 3C2GA 2HVRA 1FSEA 4QPOA 3KIOA 2VE9A 4B44A 2AQEA 5DM6F 2CW7A 1FP1D 1KYQA 1ZTRA 1I3QJ 2HKXA 2EN8A 2EV6A 2FU4A 3GTGJ 1ODDA 1IQOA 2GLOA 1ETXA 3EUHA
chains in the Genus database with same CATH topology
3RYRA 2DLLA 3Q9SA 3WG9A 5F1RA 2WTEA 2XV4S 4BHCA 3GX4X 4ENKA 2OZ6A 2RN7A 4HBLA 4OU0A 4H0EA 3T1BA 1J0RA 4M9ZA 2VE8A 3GVAA 2XAHA 5TRDA 1OYYA 4L18B 4M72A 4OIOF 5AIQA 5LBQA 1K78B 4B09A 3J81K 2KIFA 1XCBA 2H6BA 4Y15A 3SXYA 4BHBA 2KIMA 2XAJA 1WQ2A 3DKWA 3BWGA 4A2UA 4KUMA 3FMSA 2LDUA 3R6SA 3BROA 3CJNA 3COAC 4GXOA 4WCGA 2HQRA 1W7PA 5L3BA 5LHHA 2O8XA 3KLNA 1LJ9A 4IRHA 2VT2A 2EFNA 2EJRA 3F8NA 1V4RA 2JTVA 3BZ6A 3SZPA 1IZ1A 1FPQA 1ZHFA 3HYIA 2G7HA 3LFKA 2X4HA 3TOBA 3JSOA 2PJPA 3ZMVA 3T8TA 4CXFA 3V8KA 4RGSA 2CQKA 1WWXA 4G7HF 3WGIA 4UNOA 5ICCA 4I0BA 3ISPA 3HHGA 2NAZA 2HFHA 2DPUA 2O03A 3IWZA 3GUDA 3F21A 3JTHA 1OMIA 4UVCA 5JFRA 1I5ZA 2EV0A 4M6XA 2M8EA 3HOSA 3JSPA 1TTYA 3JAMZ 2EB7A 4MQ9F 2M30A 3HRUA 3TDZC 2K27A 4A0YA 1MKMA 4FHTA 4I7HA 2P4WA 3LWFA 4KA4A 4HZFA 2UXXA 2R7FA 1JHFA 1L0OC 4HW0A 3MWMA 4A0ZA 2DAOA 3GLXA 1BBYA 2W84A 2PMUA 1ZLKA 3I71A 3E97A 1XMAA 2HWVA 2QVOA 4RGRA 1XD7A 3BPXA 5TJJA 4L9NA 4OMZA 5ICGA 4IPAA 2P5KA 2RGVA 1A04A 3L00A 4PCQA 2IA0A 1IN4A 4LB6B 4EJWA 2QENA 3MCZA 4GYIA 3I54A 2HS5A 4O5VA 3I59B 3ZMTA 5LRSA 3ABTA 5FFXA 1D3YA 3WE3A 1QZZA 4GYGA 4GO1A 1UFMA 4R8HA 2D2WA 4ETSA 3L09A 2M45A 3GXOA 1AOYA 6PAXA 2XUBA 4L9VA 2DTRA 1QZYA 3ZN1A 1KYWA 5CLSA 5LGUA 4QLCU 1SD6A 4WX9A 5IT9K 4LLLA 2CG4A 1FYKA 3CO7C 3LQRA 2OQRA 5K5RA 2DK8A 1YFHA 2QZ8A 1HKTA 2VODA 1KU7A 2L01A 1USSA 2KJCA 2V6CA 3PQJA 4KMUX 4MTEA 2EFQA 1SFEA 2MA3A 2ZKZA 5E20A 1R22A 1FNNA 4KIFA 2A5YB 4L9TA 2RQPA 3ULQB 3DF8A 2IP2A 3C7JA 5K1YA 3K1MA 1P4XA 1FC3A 3LA7A 2FMYA 2HTJA 2Z3YA 1K78A 3HHHA 4ZZLA 1LNWA 5K5OA 3ZP5A 2NRAC 1G3YA 1H9GA 1U5TC 2MLGA 2OAZA 2DK5A 1TNSA 2DQRA 2VN2A 2P8TA 3ZQ7A 3JTGA 4BXUA 1F1ZA 4OIQF 1MD0A 3M9AA 5D5UB 2GXGA 4EGZA 4HX8A 1QPMA 1R5GA 4M73A 1V3FA 2CGPA 3BJOA 2GA1A 4HF1A 3HRSA 4U0YA 4UHTA 4XLPF 1KQ8A 1BN5A 5DCFA 3BJAA 1FZPB 1YG2A 4HLYA 2W57A 2KKOA 1ON1A 1J7KA 2XIGA 4L0ZB 3FWEA 4ENNA 3U2RA 3MZHA 1WSUA 1W4MA 3J80K 4R79A 3WGGA 4KNYA 1EH7A 4HQEA 1XB4A 5CVIA 2FXAA 4ZYGA 3FM3A 2OD5A 2H94A 2F5DA 2ESNA 3ROUA 2ACJA 3R61A 1F4KA 3V7SA 4AIHA 3IHUA 2ISYA 1PDNC 3CLOA 1D8JA 3ZMSA 1YTYA 3F3XA 4P96A 3F8FA 2A6EF 3GZ5A 1IW7F 1LQ1A 4MEYF 4DNCA 1LEBA 3SZTA 1IN7A 1R23A 2A69F 1FP2A 4BYYA 2NNYA 5ED4A 5E8GA 4YFXF 1L3LA 3F22A 4IRIA 2HQNA 2DQLA 2FE3A 2V1UA 1XCVA 5D5XB 1SD7A 2JPBA 2XAGA 5FD5A 4E70A 3RKYA 5L3EA 3T0YA 1O3SA 1U78A 2DFIA 2OZUA 1SMTA 1BIAA 4RGUA 1FY7A 1HKSA 3R60A 2DPDA 1J2XA 4IF4A 5LRRA 2ADUA 3KE2A 2CO5A 3LA2A 1HW2A 2LF7A 1YS6A 1P4WA 5LHGA 4HX4A 4I0AA 2QBYA 5CVUA 2IA2A 1BOAA 1UHWA 4BNCA 3EYYA 2ZJ2A 4U7BA 4L9JA 4ENJA 2QQ9A 2X0LA 1KQ9A 2FBKA 1B9NA 3CO6C 2QQBA 2ELHA 2ZNZA 3ECOA 1D5VA 3DPTA 5FD6A 1K6OA 1IN5A 2D1VA 2OU2A 2RV8A 3VEPA 1MDMB 4UXNA 1Z91A 2FOKA 1F5TA 4GGGA 2EFWA 1YQAA 1USTA 5E1ZB 1OYIA 2P6TA 3M1EA 5F6FA 4O3MA 3VODA 2ZMEB 4P5OA 4XRFA 5E18F 2FEZA 2PMHA 3KP2A 4JBAA 5J8CA 3LAPA 3S2WA 4EJTA 3K1PA 3W6KB 5D4RA 1I1GA 1QO0D 3HOTA 3FHZA 1BC7C 1EV7A 3E6DA 3FXRA 4AD9A 4I09A 1S3JA 4IRGA 2PFBA 2BGCA 4HF2A 3CUOA 1HBXG 4P9FA 1RIOH 1IUYA 3MAJA 2YX4A 3KETA 4WK8F 4M71A 2QYOA 2YSRA 2ISZA 2IPQX 2TDXA 4XBFA 1Z1DA 3WODF 2H09A 3N4MA 1JE8A 3MZYA 3J81Z 1G3WA 3TKYA 4ON0A 5AIPA 2B0LA 4CYDA 4EQQA 1KQ0A 2VBYA 2COMA 3ZPLA 2A3SA 1SFXA 1R1TA 1OR7A 2ZNYA 4XSXF 1Q1HA 2VC1A 3FM5A 3H3UA 1KU2A 1U2WA 4QWQA 1B1BA 1MJAA 2PEXA 5J8FA 5DCMB 2KRFA 5BOXA 1R36A 3F8BA 4HDUA 3LQQA 4Q48A 2VBXA 2KJBA 4P9UA 5LGNA 1YYVA 4M6YA 3K9TA 4CDGA 5L3DA 2VBWA 2RVCA 1PUEE 1B6AA 1W5TA 3CUQB 4XSZF 3IWFA 1H0MA 4UV9A 4ZYHA 1FOKA 2GWRA 3HTUA 5FGMA 4Y13A 2L4MA 4K2EA 4LD5A 4OIRF 2DW4A 3KFWX 3KCCA 3VB2A 2ZCWA 4EM0B 5H6QA 3GWZA 3KP7A 4HQMA 1DP7P 1OPCA 4M9XA 1X3UA 5IT3A 1E17A 1G3SA 1ZYRF 5BQTA 1IRGA 1J9IA 1RZ4A 1CF7B 2YPRA 4IXAA 1FT9A 3E5QA 3SFZA 2VT3A 2CWEA 3L9FA 5ICFA 5ERIA 1YW9A 4YIIA 3K1NA 3P9KA 3QP5A 2DO7A 3V8LA 1Y0UA 5BMZA 4NQWA 4KIBA 3GFMA 1G3TA 4EMSA 2F5FA 4G9YA 4YFNF 4BH9A 4Q47A 3K0LA 2P5LC 1SD4A 4FT8A 4D0PA 4AIKA 2STWA 2IJLA 4LK1F 1XGSA 1XGNA 4O6JA 3O6BB 5BS6A 2EWNA 4UVBA 1FX7A 2AXLA 1O57A 5JR3A 4LB5A 5E1XA 3M8EA 1ZRDA 5EEGA 1P4AA 4A5MA 1CGPA 1EH6A 4G7ZF 2YR2A 5ILUA 1O7LA 1YS7A 4NB5A 4UV8A 2QLZA 3BY6A 4LK0F 1XN7A 3LA3A 4AIJA 4CGZA 2RDPA 2P5VA 3R0AA 1C0WA 3RIRA 1O7FA 4RAYA 1S8NA 5FLXK 5F64A 4L5JA 1LVAA 1OYWA 5HVQC 4HYEA 4N9HA 3O2PE 3I5UA 4CZZA 1CF7A 4LLNA 4YFKF 5FLXZ 2V1XA 1XGOA 2R7DA 2HYGD 4M74A 5FO5A 2FA5A 2MBFA 2EV5A 3IRQA 1R1VA 5DDGA 2A6HF 1GXQA 3LAJA 3DEUA 5DUKA 4G7OF 3FMQA 5DUIA 4LMYA 1P2FA 3ZMUA 1JXSA 2Z9OA 3BJ6A 3F8CA 1QQIA 2LSOA 4LG0A 3WGHA 1D8KA 5H20A 2Q8KA 3HTSB 3OOPA 3T5XA 1SFUA 1O3TA 1GXPA 1MJBA 5DEQA 2QWWA 4WXDA 2OQGA 2DU9A 4ZYEA 2L3DA 4A6DA 1I6XA 1SD5A 4OMYA 1YW7A 4RB3C 2UZKA 2CYYA 1YIOA 3R0JA 4ENMA 2VC0A 3NEUA 1ULYA 4HV5A 1HKQA 1U6GA 5CJ9A 3KP5A 3B02A 3D5LA 2ZFWA 4IHSA 4MQVA 3HRTA 1TNTA 3H3ZA 2PI0A 1U5TA 2IVMA 3QPTA 1BI0A 2XAQA 3N97A 1LDDA 3MEXA 3RJPA 3C1DA 3JAMK 1RUNA 1ZG1A 4KMFA 4JK1X 4CO8A 4AWXB 1T98A 2IA1A 2HDCA 3QP6A 3GW2A 1BC8C 3NQOA 2IT0A 3WTTC 2E7XA 2E1CA 3KEQA 1XMKA 2MH9A 4RAZA 2QUFA 2K4BA 5ILSA 2LNBA 4HDVA 5HDKA 2PQ8A 2CW0F 4UVAA 1TBXA 2JT1A 3F8MA 4HF0A 3TO7A 2EK5A 2ETHA 4WF2A 2PN6A 1ZREA 2H27A 3RPUA 3IL2A 2L02A 1R58A 3GFJA 1ZGAA 4A0XA 3ML6A 1ONVA 4ESJA 2Z33A 3WE2A 4PDKA 2NNNA 4M9SA 4EVIA 5A2QK 2E1NA 1KGSA 4A5NA 1IAWA 3TOAA 1YO5C 1FYMA 2O3FA 2FBHA 1KU3A 2Z5UA 4EM1A 3KP3A 3C18A 4LJZF 2WC2A 5CVJA 3CTAA 5CYVA 2DBBA 3QU6A 2BYVE 1DDNA 3NRVA 2O6GE 3RKXA 2XROA 2P7CB 1WRJA 3MQ0A 2HEOA 3GF2A 4EGYA 4RB2C 2VONA 4L0YB 1YLFA 4HAMA 1E2XA 4HV6A 5LGTA 1J59A 1I1SA 4I2OA 3RTRA 4UUVA 3MFKA 3J80Z 3RKWA 3ZMDA 3L7WA 2L54A 2HKOA 3LSTA 3E6BA 4LG0B 3WU1B 4KN7X 1FBSA 5L3CA 5J6XA 1HW5A 1KA8A 2FMLA 2LF8A 5AONA 2VOOA 5FB2A 3EDPA 2ESHA 2FSWA 3P7NA 4ZYDA 1DPUA 5DV5A 2E7WA 3DV8A 2G9WA 4KT5C 3M7GA 2YU3A 2C6YA 4B8XA 4EJVA 3IKTA 1I27A 3KLOA 3F6OA 4G94A 2FBIA 1XGMA 2BEOA 2A61A 3DFGA 3HIFA 1FBUA 1BJAA 2HTSA 3C3WA 1TW3A 3WTWC 1WKMA 4ASNA 3IRRA 1U3EM 3GO5A 1PP7U 1SMYF 2J5OA 5LEKA 2GZWA 5K5QA 4PGGA 3Q9VA 3V7CA 1S7OA 5HDNA 1TQIA 4MHGA 3DXJF 3GFLA 4G6QA 1KYZA 3ERED 2FQ3A 3QRFF 2UWMA 4LGWA 3H92A 4BQAA 2RNJA 3EYIA 1P6RA 1FBQA 2Z99A 2BBYA 2O0YA 1RUOA 1MJ9A 4OINF 3FXUA 2JSCA 2W24A 4CHUA 3FMRA 4Q5SF 5KVRA 3JW4A 4IHTA 1IN8A 5LLQA 3BP8A 4EV0A 1NHAA 3U9GA 4OOIA 2FNAA 4EJOA 3GZ6A 4JQFA 1HW1A 3HSFA 3TO6A 4U0WA 4AVPA 3O3KA 5HS7A 4S05A 1T2KA 3Q5FA 1ON2A 5JVTA 5ICEA 2D1HA 1LEAA 4EJUA 2ZMEA 3TDUC 2MH2A 1MZBA 1XSDA 4RS8A 4PGHA 4KIGA 1W5SA 2XKOA 2RC4A 3PQKA 2STTA 1IXSB 3KP4A 1HXDA 3KZYA 3TQNA 1EH8A 3REOA 5LEJA 2Q2EA 3DPLC 4WXCA 5HS8A 4I02A 1SAXA 4L5IA 4KICA 1XSVA 1TQMA 1J75A 2EFOA 4IJAA 1FSHA 1B4AA 1PP8F 2W85A 1QNTA 1YW8A 1K7AA 1ZAOA 2UXNA 4Z2YA 3WTXC 1ZRCA 1IXRC 4KDPA 2Y48A 3QU3A 1ZGJA 2VOPA 3FXQA 5E1WA 4PZJA 2K86A 5BPDA 1BI2A 5DYMA 1O3RA 1AWCA 2J5PA 3EQLF 1JHHA 4G8XA 4A6EA 4CICA 2AS5F 1STZA 4S04A 1VTNC 3OV8A 4RGXA 3KEOA 1IXCA 3RI4A 5HS9A 3RYPA 3E6MA 3BOQA 1LDKB 3GEZA 2A07F 3BDDA 1S7AA 1UB9A 1BI1A 3B73A 1BI3A 2EFPA 2DT5A 4YIFA 1TW2A 2P7VB 4FX4A 4HLXA 5L3GA 5HDGA 1QBJA 3I59A 4F7ZA 5D8KB 3EETA 3WTUC 1T6SA 2H6CA 4BAYA 1LB2A 3WTSC 1ZARA 2PBIA 2GXBA 2JPCA 4I98B 4NHJA 1P92A 1R1UA 5H6RA 2GAUA 1U8RA 1RI7A 5A2QZ 1DPRA 2HYFA 3ECHA 3DQVC 2WV0A 4XLNF 1RNLA 3SHFA 3F23A 3WU0A 3F72A 1IRFA 2ZO4A 5HLHA 2IRFG 1MGTA 1S6LA 5FFZA 2ZBKA 5D5VB 1ZN2A 4IVNA 4BHPA 4R1HA 1UHMA 2GQQA 2WWYA 4MEXF 4YG2F 1Z7UA 4U7DA 2MC3A 3G73A 3WTYC 4MNUA 1ZLJA 3BPVA 1GHCA 2FRHA 3U1DA 1G6NA 2FF4A 2L4AA 2XVCA 2QQAA 4HX7A 3CDHA 2A68F 3IKVA 3L2CA 1HQCA 5DCMA 3TO9A 3I4PA 1ZG5A 2D45A 1KU9A 2HGCA 2V9VA 1OKRA 2DI3A 3G3ZA 5E17F 2HZTA 3I64A 1B59A 2Y75A 3RPQA 3I53A 2BE5F 2XASA 5HOOA 1W7PD 3TGNA 5JHUA 4MGRA 2PLYA 1R00A 4A12A 2K7LA 5HLGA 1B9MA 5DD4A 5DD8A 5D4SA 4GCVA 2JRTA 1J5YA 3V7RA 2W25A 2JZYA 2OBPA 2K02A 2M5WA 4G6DA 4ZH4F 2NS0A 3DP7A 5IT9Z 2Y0MA 4N0BA 3M8FA 1UCRA 2V1DA 5D5WB 3HUGA 1TLHB 5ILVA 3R4KA 1T0FA 5D6EA 3ZMZA 1S29A 3RDIA 3E6CC 2O61A 4LFUA 5CVRA 1WI9A 2M1BA 3I58A 1O3QA 3GYHX 1HSTA 2YX7A 4HA8A 4LLGF 3VFZA 2HOEA 3QAHA 2VXZA 2FNPA 3E3VA 4HOBA 3PFIA 3W6JB 5D6FA 3V8JA 5EEHA 5D8LB 3QPHA 4MTDA 4TV7A 3WTZA 2VBZA 4U88A 3J7AO 3VOEA 2LKPA 2KIUA 2CSOA 4ESBA 2GA2A 2RKHA 3E5UA 3P9IA 1FWZA 3QOPA 4N9IA 1FLIA 4KN4X 1QGPA 1ZG3A 4EM2A 5HLIA 3E5XA 1Z05A 1GVJA 1W7PB 1K79A 1U5TB 1Z6RA 3F6VA 1XDSA 3FZVA 4FX0A 3D0SA 2K4JA 3V4GA 4DQ2A 5JI6A 2M87A 2XGXA 1ZH5A 2MLKA 3ELKA 3ABUA 1DUXC 4RB1A 1R5HA 2EA2A 4Y17A 1Z9CA 1LDJA 1T38A 4OIPF 3K69A 4WWCA 2GIVA 1IN6A 2NYXA 1H9TA 3SQNA 2BV6A 2XKPA 4I01A 2F5CA 4ESFA 1F9NA 4ZZDA 5CVVA 1XDUA 1MDMA 4U0VA 2PG4A 2XRNA 4P55A 5L3FA 2QM3A 3FF5A 2HR3A 2IW5A 3HSRA 3KZZA 2XHKA 1FYLA 3T8RA 2ZXJA 5E8IA 3AAFA 1ZRFA 3IC7A 3HRMA 3P9CA 3ZN0A 1Z6TA 2QBYB 2V79A 2Q0OA 2OA4A 1IF1A 1BM9A 4KFCA