2EOFA

Solution structure of the c2h2 type zinc finger (region 411-441) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
b'GSSGSSGTGEKPYECNECQKAFNTKSNLMVHQRTHTGESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 411-441) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eofA01
2EOIA 2EMHA 3M99B 4M9VC 4R2AA 1Z1BA 1A1LA 2ENAA 2YTDA 2D9HA 2EPAA 2EOSA 1A1JA 2EJ4A 1AAYA 2HGHA 4IJDA 2EN1A 2YTPA 2NABA 2YTJA 2YU8A 2EM8A 1A1IA 1YUIA 2YTQA 2EM2A 2EOEA 1RMDA 2EP3A 2MKNA 1DGCA 3EPKA 4GZNC 4F2JC 2LO3A 2MDGA 2GLIA 2EPRA 2A25A 2EPZA 2YTIA 2EMCA 2MKDA 2EL5A 2DLQA 5KL5A 2EL6A 2EMKA 2WCC3 1TF6A 5KL3A 2EOMA 2PRTA 2RPCA 2EOXA 1ZR9A 1BB8A 2EQ0A 2EORA 2ENCA 2I13A 2WBUA 1ZU1A 5KL7A 2EM7A 2EM4A 3EPJA 2CSHA 2LVHA 1X6HA 1B69A 2EPPA 2YTNA 3UK3C 2EPXA 2WBSA 3EPHA 2LT7A 2YTOA 2CT1A 2EOQA 2ADRA 2WBTA 2DMIA 2EOJA 3MHSC 1TN9A 4R2DA 2YRKA 4X9JA 2RSIA 2EM3A 1NCSA 2LCEA 1KJKA 2EMWA 1A1HA 1YUJA 2DRPA 1BBOA 1X6EA 2YTEA 2JPAA 2EN8A 1TF3A 2EM0A 2EOHA 3EPLA 1UN6B 1G2DC 5KL4A 2YRMA 2EQ3A 4R2EA 2EMZA 4R2CA 5KL6A 2EMYA 1P47A 2J7JA 2EN6A 2EM9A 1X3CA 2ELYA 4WSGA 1A1GA 1A1KA 1UBDC 2VRDA 3MHHC 2YRHA 1A1FA 2EM6A 2EMBA 2EL4A 2EMIA 2EPUA 2EOFA 2EQ1A 1ZAAC 2YTGA 2E72A 1MEYC 2JP9A 2EMXA 2YU5A 2EMGA 4R2RA 2EN7A 2DGCA 1X6FA 4FK5C 1G2FC 1LLMC 2EE8A 2LV2A 4R2QA 4F6NA 2EM5A 2BB8A 1X5WA 2YTFA 1YSAC 4IS1C 2ENHA 2YSOA 1JK1A 4R2PA 2GHFA 2EOOA 4R2SA 2EN2A 2EN3A 2EMLA 4F6MA 1JK2A 2ELZA 2M9AA 2CTDA 1F2IG 2DLKA 2EMFA 2R1FA 1WJPA 2EOYA 2EMAA 2EPCA 2EN4A 3VHTB 5KL2A 2YSPA 2EOZA
chains in the Genus database with same CATH superfamily
4M30A 2KHXA 2EOIA 4J8ZA 2EZ6A 5T6JA 2E5LE 1AAYA 4DV3E 2F8BA 4DUZE 1XNQE 2YU8A 4JI5E 4HEIA 4B3ME 1UHZA 2EOEA 1RMDA 3C4TA 3MSWA 1YYKA 2EPLX 1I94E 1XNRE 3EPKA 2A25A 2EPZA 2YTIA 4X65E 2WCC3 4WSPA 3H09A 1EH6A 5KL3A 2EOMA 2RPCA 1YPNA 4DMIA 3J7Yp 1HR0E 4L5NC 4KZSA 1QNTA 1ZBTA 1GZ6A 2HC5A 4AQYE 4JI6E 1AH5A 3QG5C 4MLVA 3FIGA 3EPHA 1FJGE 2IHR1 4ZYGA 2EPMX 2DMIA 1ZBQA 1J5EE 4K0KE 2YRKA 4X9JA 2L8TA 2EM3A 4X66E 1PKPA 4O24A 4LF9E 2JPAA 4LF7E 1X48A 1UN6B 3EPLA 2RQLA 5BR8E 4R2EA 4R2CA 1STUA 1WRJA 4GEQB 4WSGA 1A1KA 3F6HA 1T4LB 4JI8E 2EM6A 5A2QC 4LU9A 4L8NA 1QU6A 5IXMB 4ZYHA 2YTGA 3BF2A 4RHBB 2JP9A 1EH7A 2EMXA 2L2KB 4JI2E 1G2FC 2V8QB 2B3TB 2EM5A 2LMZA 2BB8A 4NZVA 2EWLA 5A6AA 2ENHA 2YSOA 1JK1A 2BBGA 1YFHA 3ADLA 3HPZA 4O43A 4MLQA 1JK2A 2YT4A 5A6JA 2V83A 2RS6A 2DLKA 1F2IG 1X49A 1WXRA 1WHNA 5IWAE 3HXLA 2M4IA 4BBYA 2LJUA 2RSIA 3KWRA 2LUQA 2EMHA 4F9BB 2VE7C 1A1LA 1SFEA 1IQSA 1KYQA 4X62E 2L92A 1IBME 4IJDA 2NABA 1A1IA 2YTQA 2LUPB 2EM2A 4X64E 2H36X 4JI3E 3BBGA 5LMUE 1O0WA 2NA2A 3THNA 5KL5A 2EL6A 2EMKA 3DF6A 4OOGC 2PRTA 1BB8A 4LF4E 3IWBA 2EORA 2ENCA 2I13A 1N36E 3EPJA 5ADZA 1X6HA 1UILA 2LTSA 1RC7A 2UUAE 2EPPA 5DNYA 3UK3C 2V88A 2YTOA 2CT1A 1L4SA 2EOQA 1IBLE 2NUEA 2MC5A 2CPNA 3MHSC 2N3HA 4R2DA 3ZOQB 4BCAA 2EMWA 2DRPA 4DKKA 1X6EA 1HNWE 1IBKE 1XMQE 4F9CB 3T1HE 1TF3A 2RSMA 2UXBE 3J7AG 4BC9A 4DR5E 1P47A 2J7JA 2EM9A 5LMNE 4LF8E 2ELYA 1A1GA 4F9AB 2YPNA 2VRDA 1A1FA 3RMPA 1N3GA 4DV2E 2EL4A 2JWOA 4I8OA 5AE3A 2EOFA 3JU0A 2GPIA 2ODRC 4DUYE 1MEYC 4BMJA 5A69A 2YU5A 2EMGA 4YHHE 2EN7A 2DGCA 2MDRA 5AC5A 2EE8A 2LV2A 2V85A 2LJHA 3AV0A 4F6NA 1EH8A 1IQOA 3EQ1A 3LMLA 1X5WA 2YTFA 3J81C 4WXDA 4HTGA 2ODRD 4TUGA 2EOOA 2EN2A 2ELZA 2M9AA 4JV5E 2UXCE 1T38A 1WJPA 2EPOA 2EPCA 2VQFE 3IWCA 3HTXA 4WFTA 5KL2A 4BHCA 2YSPA 3KZYA 2JOBA 4O5GA 3M99B 4M9VC 4TUIA 4R2AA 2DB2A 1Z1BA 2YTDA 5AE1A 5AE2A 2EOSA 2EJ4A 2LE2A 3JAMC 4DR7E 1YUIA 1BBGA 3C6MA 2MKNA 2B7VA 2B7TA 2RTXA 1DGCA 3K6QA 3ECRA 2LO3A 4YY3E 3C6KA 2EPRA 2EMCA 2MKDA 1HNXE 4NXME 2JR1A 1TF6A 3P1XA 1PJSA 2DIXA 2EOXA 1PDAA 2EPNA 4JI0E 4DV7E 3F6GA 5A6KA 2WBUA 3BGHA 1ZU1A 2M1SA 4B3TE 2LTRA 4B3SE 1DI2A 1J26A 4DR2E 4DV5E 2YTNA 3JTZA 2EPXA 2FGGA 2V87A 3KZZA 2WBTA 2EOJA 3L00A 1WHQA 1TN9A 5FLXC 2LCEA 4Q35B 2L3JA 1YUJA 2Q8UA 1BBOA 3TQMA 2R76A 4WX9A 2YTEA 2JOXA 1G2DC 5KL4A 1GQEA 3HQ1A 4DR4E 2EQ3A 5F3WA 5KL6A 3IWDA 2ZM6E 1UBDC 1T4OA 4WXCA 4OX9E 2V89A 2VF1A 4LFBE 4M0VA 4JI4E 2EPUA 2EQ1A 3ADIA 1ZAAC 3OMLA 4RH8A 1RQ0A 4R2RA 1FKAE 2YZTA 3ADJA 4O4KA 1X6FA 4ZYDA 4FK5C 3T1YE 1YYWA 1SR9A 4DV6E 4JI7E 1LLMC 2UXDE 4R2QA 4DR3E 1N34E 2NUFA 4IS1C 4R2PA 2GHFA 4R2SA 2EN3A 4F6MA 2EMLA 2UUCE 1X47A 2N3GA 4GKKE 4NHRA 2FV4B 2CTDA 2EMFA 2R1FA 2EPKX 4Q28A 4BC7A 2EMAA 2EN4A 4B3RE 3ADGA 3BIDA 2N8XA 3HPSA 4WYQB 2EOZA 4ZYEA 3AUZA 2L33A 5LL6R 2ENAA 2UUBE 2D9HA 2F4VE 4GKJE 2EPAA 1A1JA 2HGHA 4BHBA 1PJTA 2EN1A 2MC6A 4M2ZA 2YTPA 2YTJA 3THOB 2KONA 5TSEA 5IV8B 1N32E 2JY9A 2EM8A 2B9DA 2EP3A 5AC4A 5LLQA 2V86A 4GZNC 1GTKA 4F2JC 3C4BA 2HHHE 1PJQA 2DMYA 2I9IA 2MDGA 4DR1E 2GLIA 2EL5A 2HJJA 2DLQA 4P7DA 1IMUA 2DSYA 2JYAA 1ZR9A 2EQ0A 1DQ3A 3DJWA 5KL7A 2M7QA 2EM7A 4DV4E 2EM4A 2CSHA 2LVHA 4LFAE 1YYOA 3VYXA 1B69A 4LTYA 2WBSA 2JXPA 2LT7A 2K4VA 2K7IA 3OTOE 2ADRA 3LLHA 4KWYA 4N4RB 5AASA 2FTXB 3VK6A 1NCSA 1KJKA 1T4NA 2L2MA 1A1HA 4R8OA 4P78A 3VYYA 4WPYA 2UU9E 4NXNE 2EN8A 4LF6E 2EM0A 2EOHA 4LF5E 2YRMA 2KOUA 2LRSA 2EMZA 4DV1E 2EMYA 2EN6A 1X3CA 2L2NA 3J80C 3MHHC 2YRHA 1MGTA 1T39A 2EMBA 1XMOE 4R03A 4DV0E 4KHPE 2EMIA 2WZOA 2E72A 1YZ9A 2L3CA 4X8WA 4LFCE 2JVAA 2NUGA 2LBSB 1YSAC 5CFFE 2YWQA 1HNZE 2RS7A 5IT9C 2G7HA 2E1MA 1EKZA 4DR6E 4BS9A 2EOYA 4F54A 1N33E 3VHTB 2VQEE 5A6BD 5A6BA 1NEIA 4JYAE 2L6MA 4JI1E
chains in the Genus database with same CATH topology
2EOIA 2EMHA 3M99B 4M9VC 4R2AA 1Z1BA 1A1LA 2ENAA 2YTDA 2D9HA 2EPAA 2EOSA 1A1JA 2EJ4A 1AAYA 2HGHA 4IJDA 2EN1A 2YTPA 2NABA 2YTJA 2YU8A 2EM8A 1A1IA 1YUIA 2YTQA 2EM2A 2EOEA 1RMDA 2EP3A 2MKNA 1DGCA 3EPKA 4GZNC 4F2JC 2LO3A 2MDGA 2GLIA 2EPRA 2A25A 2EPZA 2YTIA 2EMCA 2MKDA 2EL5A 2DLQA 5KL5A 2EL6A 2EMKA 2WCC3 1TF6A 5KL3A 2EOMA 2PRTA 2RPCA 2EOXA 1ZR9A 1BB8A 2EQ0A 2EORA 2ENCA 2I13A 2WBUA 1ZU1A 5KL7A 2EM7A 2EM4A 3EPJA 2CSHA 2LVHA 1X6HA 1B69A 2EPPA 2YTNA 3UK3C 2EPXA 2WBSA 3EPHA 2LT7A 2YTOA 2CT1A 2EOQA 2ADRA 2WBTA 2DMIA 2EOJA 3MHSC 1TN9A 4R2DA 2YRKA 4X9JA 2RSIA 2EM3A 1NCSA 2LCEA 1KJKA 2EMWA 1A1HA 1YUJA 2DRPA 1BBOA 1X6EA 2YTEA 2JPAA 2EN8A 1TF3A 2EM0A 2EOHA 3EPLA 1UN6B 1G2DC 5KL4A 2YRMA 2EQ3A 4R2EA 2EMZA 4R2CA 5KL6A 2EMYA 1P47A 2J7JA 2EN6A 2EM9A 1X3CA 2ELYA 4WSGA 1A1GA 1A1KA 1UBDC 2VRDA 3MHHC 2YRHA 1A1FA 2EM6A 2EMBA 2EL4A 2EMIA 2EPUA 2EOFA 2EQ1A 1ZAAC 2YTGA 2E72A 1MEYC 2JP9A 2EMXA 2YU5A 2EMGA 4R2RA 2EN7A 2DGCA 1X6FA 4FK5C 1G2FC 1LLMC 2EE8A 2LV2A 4R2QA 4F6NA 2EM5A 2BB8A 1X5WA 2YTFA 1YSAC 4IS1C 2ENHA 2YSOA 1JK1A 4R2PA 2GHFA 2EOOA 4R2SA 2EN2A 2EN3A 2EMLA 4F6MA 1JK2A 2ELZA 2M9AA 2CTDA 1F2IG 2DLKA 2EMFA 2R1FA 1WJPA 2EOYA 2EMAA 2EPCA 2EN4A 3VHTB 5KL2A 2YSPA 2EOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOI A;  2EMH A;  3M99 B;  4M9V C;  4R2A A;  1Z1B A;  1A1L A;  2ENA A;  2YTD A;  2D9H A;  2EPA A;  2EOS A;  1A1J A;  2EJ4 A;  1AAY A;  2HGH A;  4IJD A;  2EN1 A;  2YTP A;  2NAB A;  2YTJ A;  2YU8 A;  2EM8 A;  1A1I A;  1YUI A;  2YTQ A;  2EM2 A;  2EOE A;  1RMD A;  2EP3 A;  2MKN A;  1DGC A;  3EPK A;  4GZN C;  4F2J C;  2LO3 A;  2MDG A;  2GLI A;  2EPR A;  2A25 A;  2EPZ A;  2YTI A;  2EMC A;  2MKD A;  2EL5 A;  2DLQ A;  5KL5 A;  2EL6 A;  2EMK A;  2WCC 3;  1TF6 A;  5KL3 A;  2EOM A;  2PRT A;  2RPC A;  2EOX A;  1ZR9 A;  1BB8 A;  2EQ0 A;  2EOR A;  2ENC A;  2I13 A;  2WBU A;  1ZU1 A;  5KL7 A;  2EM7 A;  2EM4 A;  3EPJ A;  2CSH A;  2LVH A;  1X6H A;  1B69 A;  2EPP A;  2YTN A;  3UK3 C;  2EPX A;  2WBS A;  3EPH A;  2LT7 A;  2YTO A;  2CT1 A;  2EOQ A;  2ADR A;  2WBT A;  2DMI A;  2EOJ A;  3MHS C;  1TN9 A;  4R2D A;  2YRK A;  4X9J A;  2RSI A;  2EM3 A;  1NCS A;  2LCE A;  1KJK A;  2EMW A;  1A1H A;  1YUJ A;  2DRP A;  1BBO A;  1X6E A;  2YTE A;  2JPA A;  2EN8 A;  1TF3 A;  2EM0 A;  2EOH A;  3EPL A;  1UN6 B;  1G2D C;  5KL4 A;  2YRM A;  2EQ3 A;  4R2E A;  2EMZ A;  4R2C A;  5KL6 A;  2EMY A;  1P47 A;  2J7J A;  2EN6 A;  2EM9 A;  1X3C A;  2ELY A;  4WSG A;  1A1G A;  1A1K A;  1UBD C;  2VRD A;  3MHH C;  2YRH A;  1A1F A;  2EM6 A;  2EMB A;  2EL4 A;  2EMI A;  2EPU A;  2EOF A;  2EQ1 A;  1ZAA C;  2YTG A;  2E72 A;  1MEY C;  2JP9 A;  2EMX A;  2YU5 A;  2EMG A;  4R2R A;  2EN7 A;  2DGC A;  1X6F A;  4FK5 C;  1G2F C;  1LLM C;  2EE8 A;  2LV2 A;  4R2Q A;  4F6N A;  2EM5 A;  2BB8 A;  1X5W A;  2YTF A;  1YSA C;  4IS1 C;  2ENH A;  2YSO A;  1JK1 A;  4R2P A;  2GHF A;  2EOO A;  4R2S A;  2EN2 A;  2EN3 A;  2EML A;  4F6M A;  1JK2 A;  2ELZ A;  2M9A A;  2CTD A;  1F2I G;  2DLK A;  2EMF A;  2R1F A;  1WJP A;  2EOY A;  2EMA A;  2EPC A;  2EN4 A;  3VHT B;  5KL2 A;  2YSP A;  2EOZ A; 
#chains in the Genus database with same CATH topology
 4M30 A;  2KHX A;  2EOI A;  4J8Z A;  2EZ6 A;  5T6J A;  2E5L E;  1AAY A;  4DV3 E;  2F8B A;  4DUZ E;  1XNQ E;  2YU8 A;  4JI5 E;  4HEI A;  4B3M E;  1UHZ A;  2EOE A;  1RMD A;  3C4T A;  3MSW A;  1YYK A;  2EPL X;  1I94 E;  1XNR E;  3EPK A;  2A25 A;  2EPZ A;  2YTI A;  4X65 E;  2WCC 3;  4WSP A;  3H09 A;  1EH6 A;  5KL3 A;  2EOM A;  2RPC A;  1YPN A;  4DMI A;  3J7Y p;  1HR0 E;  4L5N C;  4KZS A;  1QNT A;  1ZBT A;  1GZ6 A;  2HC5 A;  4AQY E;  4JI6 E;  1AH5 A;  3QG5 C;  4MLV A;  3FIG A;  3EPH A;  1FJG E;  2IHR 1;  4ZYG A;  2EPM X;  2DMI A;  1ZBQ A;  1J5E E;  4K0K E;  2YRK A;  4X9J A;  2L8T A;  2EM3 A;  4X66 E;  1PKP A;  4O24 A;  4LF9 E;  2JPA A;  4LF7 E;  1X48 A;  1UN6 B;  3EPL A;  2RQL A;  5BR8 E;  4R2E A;  4R2C A;  1STU A;  1WRJ A;  4GEQ B;  4WSG A;  1A1K A;  3F6H A;  1T4L B;  4JI8 E;  2EM6 A;  5A2Q C;  4LU9 A;  4L8N A;  1QU6 A;  5IXM B;  4ZYH A;  2YTG A;  3BF2 A;  4RHB B;  2JP9 A;  1EH7 A;  2EMX A;  2L2K B;  4JI2 E;  1G2F C;  2V8Q B;  2B3T B;  2EM5 A;  2LMZ A;  2BB8 A;  4NZV A;  2EWL A;  5A6A A;  2ENH A;  2YSO A;  1JK1 A;  2BBG A;  1YFH A;  3ADL A;  3HPZ A;  4O43 A;  4MLQ A;  1JK2 A;  2YT4 A;  5A6J A;  2V83 A;  2RS6 A;  2DLK A;  1F2I G;  1X49 A;  1WXR A;  1WHN A;  5IWA E;  3HXL A;  2M4I A;  4BBY A;  2LJU A;  2RSI A;  3KWR A;  2LUQ A;  2EMH A;  4F9B B;  2VE7 C;  1A1L A;  1SFE A;  1IQS A;  1KYQ A;  4X62 E;  2L92 A;  1IBM E;  4IJD A;  2NAB A;  1A1I A;  2YTQ A;  2LUP B;  2EM2 A;  4X64 E;  2H36 X;  4JI3 E;  3BBG A;  5LMU E;  1O0W A;  2NA2 A;  3THN A;  5KL5 A;  2EL6 A;  2EMK A;  3DF6 A;  4OOG C;  2PRT A;  1BB8 A;  4LF4 E;  3IWB A;  2EOR A;  2ENC A;  2I13 A;  1N36 E;  3EPJ A;  5ADZ A;  1X6H A;  1UIL A;  2LTS A;  1RC7 A;  2UUA E;  2EPP A;  5DNY A;  3UK3 C;  2V88 A;  2YTO A;  2CT1 A;  1L4S A;  2EOQ A;  1IBL E;  2NUE A;  2MC5 A;  2CPN A;  3MHS C;  2N3H A;  4R2D A;  3ZOQ B;  4BCA A;  2EMW A;  2DRP A;  4DKK A;  1X6E A;  1HNW E;  1IBK E;  1XMQ E;  4F9C B;  3T1H E;  1TF3 A;  2RSM A;  2UXB E;  3J7A G;  4BC9 A;  4DR5 E;  1P47 A;  2J7J A;  2EM9 A;  5LMN E;  4LF8 E;  2ELY A;  1A1G A;  4F9A B;  2YPN A;  2VRD A;  1A1F A;  3RMP A;  1N3G A;  4DV2 E;  2EL4 A;  2JWO A;  4I8O A;  5AE3 A;  2EOF A;  3JU0 A;  2GPI A;  2ODR C;  4DUY E;  1MEY C;  4BMJ A;  5A69 A;  2YU5 A;  2EMG A;  4YHH E;  2EN7 A;  2DGC A;  2MDR A;  5AC5 A;  2EE8 A;  2LV2 A;  2V85 A;  2LJH A;  3AV0 A;  4F6N A;  1EH8 A;  1IQO A;  3EQ1 A;  3LML A;  1X5W A;  2YTF A;  3J81 C;  4WXD A;  4HTG A;  2ODR D;  4TUG A;  2EOO A;  2EN2 A;  2ELZ A;  2M9A A;  4JV5 E;  2UXC E;  1T38 A;  1WJP A;  2EPO A;  2EPC A;  2VQF E;  3IWC A;  3HTX A;  4WFT A;  5KL2 A;  4BHC A;  2YSP A;  3KZY A;  2JOB A;  4O5G A;  3M99 B;  4M9V C;  4TUI A;  4R2A A;  2DB2 A;  1Z1B A;  2YTD A;  5AE1 A;  5AE2 A;  2EOS A;  2EJ4 A;  2LE2 A;  3JAM C;  4DR7 E;  1YUI A;  1BBG A;  3C6M A;  2MKN A;  2B7V A;  2B7T A;  2RTX A;  1DGC A;  3K6Q A;  3ECR A;  2LO3 A;  4YY3 E;  3C6K A;  2EPR A;  2EMC A;  2MKD A;  1HNX E;  4NXM E;  2JR1 A;  1TF6 A;  3P1X A;  1PJS A;  2DIX A;  2EOX A;  1PDA A;  2EPN A;  4JI0 E;  4DV7 E;  3F6G A;  5A6K A;  2WBU A;  3BGH A;  1ZU1 A;  2M1S A;  4B3T E;  2LTR A;  4B3S E;  1DI2 A;  1J26 A;  4DR2 E;  4DV5 E;  2YTN A;  3JTZ A;  2EPX A;  2FGG A;  2V87 A;  3KZZ A;  2WBT A;  2EOJ A;  3L00 A;  1WHQ A;  1TN9 A;  5FLX C;  2LCE A;  4Q35 B;  2L3J A;  1YUJ A;  2Q8U A;  1BBO A;  3TQM A;  2R76 A;  4WX9 A;  2YTE A;  2JOX A;  1G2D C;  5KL4 A;  1GQE A;  3HQ1 A;  4DR4 E;  2EQ3 A;  5F3W A;  5KL6 A;  3IWD A;  2ZM6 E;  1UBD C;  1T4O A;  4WXC A;  4OX9 E;  2V89 A;  2VF1 A;  4LFB E;  4M0V A;  4JI4 E;  2EPU A;  2EQ1 A;  3ADI A;  1ZAA C;  3OML A;  4RH8 A;  1RQ0 A;  4R2R A;  1FKA E;  2YZT A;  3ADJ A;  4O4K A;  1X6F A;  4ZYD A;  4FK5 C;  3T1Y E;  1YYW A;  1SR9 A;  4DV6 E;  4JI7 E;  1LLM C;  2UXD E;  4R2Q A;  4DR3 E;  1N34 E;  2NUF A;  4IS1 C;  4R2P A;  2GHF A;  4R2S A;  2EN3 A;  4F6M A;  2EML A;  2UUC E;  1X47 A;  2N3G A;  4GKK E;  4NHR A;  2FV4 B;  2CTD A;  2EMF A;  2R1F A;  2EPK X;  4Q28 A;  4BC7 A;  2EMA A;  2EN4 A;  4B3R E;  3ADG A;  3BID A;  2N8X A;  3HPS A;  4WYQ B;  2EOZ A;  4ZYE A;  3AUZ A;  2L33 A;  5LL6 R;  2ENA A;  2UUB E;  2D9H A;  2F4V E;  4GKJ E;  2EPA A;  1A1J A;  2HGH A;  4BHB A;  1PJT A;  2EN1 A;  2MC6 A;  4M2Z A;  2YTP A;  2YTJ A;  3THO B;  2KON A;  5TSE A;  5IV8 B;  1N32 E;  2JY9 A;  2EM8 A;  2B9D A;  2EP3 A;  5AC4 A;  5LLQ A;  2V86 A;  4GZN C;  1GTK A;  4F2J C;  3C4B A;  2HHH E;  1PJQ A;  2DMY A;  2I9I A;  2MDG A;  4DR1 E;  2GLI A;  2EL5 A;  2HJJ A;  2DLQ A;  4P7D A;  1IMU A;  2DSY A;  2JYA A;  1ZR9 A;  2EQ0 A;  1DQ3 A;  3DJW A;  5KL7 A;  2M7Q A;  2EM7 A;  4DV4 E;  2EM4 A;  2CSH A;  2LVH A;  4LFA E;  1YYO A;  3VYX A;  1B69 A;  4LTY A;  2WBS A;  2JXP A;  2LT7 A;  2K4V A;  2K7I A;  3OTO E;  2ADR A;  3LLH A;  4KWY A;  4N4R B;  5AAS A;  2FTX B;  3VK6 A;  1NCS A;  1KJK A;  1T4N A;  2L2M A;  1A1H A;  4R8O A;  4P78 A;  3VYY A;  4WPY A;  2UU9 E;  4NXN E;  2EN8 A;  4LF6 E;  2EM0 A;  2EOH A;  4LF5 E;  2YRM A;  2KOU A;  2LRS A;  2EMZ A;  4DV1 E;  2EMY A;  2EN6 A;  1X3C A;  2L2N A;  3J80 C;  3MHH C;  2YRH A;  1MGT A;  1T39 A;  2EMB A;  1XMO E;  4R03 A;  4DV0 E;  4KHP E;  2EMI A;  2WZO A;  2E72 A;  1YZ9 A;  2L3C A;  4X8W A;  4LFC E;  2JVA A;  2NUG A;  2LBS B;  1YSA C;  5CFF E;  2YWQ A;  1HNZ E;  2RS7 A;  5IT9 C;  2G7H A;  2E1M A;  1EKZ A;  4DR6 E;  4BS9 A;  2EOY A;  4F54 A;  1N33 E;  3VHT B;  2VQE E;  5A6B D;  5A6B A;  1NEI A;  4JYA E;  2L6M A;  4JI1 E; 
#chains in the Genus database with same CATH homology
 2EOI A;  2EMH A;  3M99 B;  4M9V C;  4R2A A;  1Z1B A;  1A1L A;  2ENA A;  2YTD A;  2D9H A;  2EPA A;  2EOS A;  1A1J A;  2EJ4 A;  1AAY A;  2HGH A;  4IJD A;  2EN1 A;  2YTP A;  2NAB A;  2YTJ A;  2YU8 A;  2EM8 A;  1A1I A;  1YUI A;  2YTQ A;  2EM2 A;  2EOE A;  1RMD A;  2EP3 A;  2MKN A;  1DGC A;  3EPK A;  4GZN C;  4F2J C;  2LO3 A;  2MDG A;  2GLI A;  2EPR A;  2A25 A;  2EPZ A;  2YTI A;  2EMC A;  2MKD A;  2EL5 A;  2DLQ A;  5KL5 A;  2EL6 A;  2EMK A;  2WCC 3;  1TF6 A;  5KL3 A;  2EOM A;  2PRT A;  2RPC A;  2EOX A;  1ZR9 A;  1BB8 A;  2EQ0 A;  2EOR A;  2ENC A;  2I13 A;  2WBU A;  1ZU1 A;  5KL7 A;  2EM7 A;  2EM4 A;  3EPJ A;  2CSH A;  2LVH A;  1X6H A;  1B69 A;  2EPP A;  2YTN A;  3UK3 C;  2EPX A;  2WBS A;  3EPH A;  2LT7 A;  2YTO A;  2CT1 A;  2EOQ A;  2ADR A;  2WBT A;  2DMI A;  2EOJ A;  3MHS C;  1TN9 A;  4R2D A;  2YRK A;  4X9J A;  2RSI A;  2EM3 A;  1NCS A;  2LCE A;  1KJK A;  2EMW A;  1A1H A;  1YUJ A;  2DRP A;  1BBO A;  1X6E A;  2YTE A;  2JPA A;  2EN8 A;  1TF3 A;  2EM0 A;  2EOH A;  3EPL A;  1UN6 B;  1G2D C;  5KL4 A;  2YRM A;  2EQ3 A;  4R2E A;  2EMZ A;  4R2C A;  5KL6 A;  2EMY A;  1P47 A;  2J7J A;  2EN6 A;  2EM9 A;  1X3C A;  2ELY A;  4WSG A;  1A1G A;  1A1K A;  1UBD C;  2VRD A;  3MHH C;  2YRH A;  1A1F A;  2EM6 A;  2EMB A;  2EL4 A;  2EMI A;  2EPU A;  2EOF A;  2EQ1 A;  1ZAA C;  2YTG A;  2E72 A;  1MEY C;  2JP9 A;  2EMX A;  2YU5 A;  2EMG A;  4R2R A;  2EN7 A;  2DGC A;  1X6F A;  4FK5 C;  1G2F C;  1LLM C;  2EE8 A;  2LV2 A;  4R2Q A;  4F6N A;  2EM5 A;  2BB8 A;  1X5W A;  2YTF A;  1YSA C;  4IS1 C;  2ENH A;  2YSO A;  1JK1 A;  4R2P A;  2GHF A;  2EOO A;  4R2S A;  2EN2 A;  2EN3 A;  2EML A;  4F6M A;  1JK2 A;  2ELZ A;  2M9A A;  2CTD A;  1F2I G;  2DLK A;  2EMF A;  2R1F A;  1WJP A;  2EOY A;  2EMA A;  2EPC A;  2EN4 A;  3VHT B;  5KL2 A;  2YSP A;  2EOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...