2EOFA

Solution structure of the c2h2 type zinc finger (region 411-441) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTGEKPYECNECQKAFNTKSNLMVHQRTHTGESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 411-441) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eofA01
4F6NA 4R2QA 2EJ4A 2RPCA 2GLIA 2EQ1A 2EMFA 1TN9A 1X3CA 2E72A 3UK3C 1YSAC 2YTPA 1JK1A 2ADRA 1BB8A 2EE8A 3M99B 3MHSC 2BB8A 1A1IA 2EN6A 2EOOA 2WBUA 3EPLA 1YUIA 2EOFA 2EP3A 2LCEA 4F2JC 2R1FA 2EN3A 1DGCA 2LV2A 4F6MA 2YTDA 2EM2A 1G2FC 4IJDA 1A1LA 2ENHA 4R2PA 2YTEA 2EOEA 2YSOA 1TF6A 2EM8A 2EPPA 5KL7A 2EL5A 1X6HA 2EM4A 2CSHA 2EL6A 2EMCA 1ZU1A 2EMAA 2EOSA 4R2RA 2DRPA 1X5WA 2EOMA 2WCC3 1BBOA 2EPXA 2EMZA 1B69A 1RMDA 3VHTB 2EMWA 4FK5C 2EORA 2VRDA 2EOJA 2YTQA 2MDGA 2YU8A 1WJPA 1A1JA 2EOIA 2ENCA 2A25A 2EN7A 2PRTA 2EOQA 1JK2A 4GZNC 2I13A 1A1KA 2YSPA 4R2DA 2MKNA 2EMYA 2YTIA 2EN1A 2RSIA 3EPHA 4WSGA 2EMHA 2YU5A 2EPUA 2DLQA 2EM5A 1X6EA 2EMXA 4R2CA 5KL4A 2EOHA 1UBDC 2ELYA 2EMKA 1A1FA 3MHHC 2EPCA 2YTNA 2WBSA 1ZAAC 3EPJA 4R2EA 2J7JA 4R2SA 1ZR9A 3EPKA 2LO3A 2EOYA 4R2AA 2DMIA 2EN4A 2EMLA 2EPRA 1A1GA 2CT1A 2YTOA 2DGCA 2EQ3A 1Z1BA 5KL6A 2EM3A 2EL4A 4IS1C 2EM6A 1F2IG 2ELZA 2EMBA 2JPAA 2EMGA 2EMIA 1AAYA 2EM9A 1KJKA 5KL5A 2EN8A 5KL3A 1TF3A 1UN6B 5KL2A 2EOXA 2YTFA 1MEYC 1LLMC 2ENAA 2YTGA 2LVHA 4X9JA 1G2DC 1YUJA 1P47A 2YRMA 2WBTA 2CTDA 1A1HA 1NCSA 2DLKA 2NABA 2LT7A 2EM7A 2EPAA 2YTJA 2EN2A 2YRHA 2JP9A 2EPZA 2YRKA 2M9AA 4M9VC 2EM0A 2D9HA 2MKDA 2EQ0A 1X6FA 2GHFA 2EOZA 2HGHA
chains in the Genus database with same CATH superfamily
3ADGA 2EJ4A 2L92A 5A2QC 3H09A 1X3CA 2E72A 4B3TE 3J80C 2EE8A 3M99B 4MLVA 1WXRA 4RH8A 4GKJE 2EOOA 3K6QA 4KHPE 1SR9A 1KYQA 4LFCE 2MDRA 2EN3A 1WHNA 1DGCA 2NUEA 4F6MA 2DB2A 3BIDA 1A1LA 4LU9A 2ENHA 1YZ9A 2YTEA 2EOEA 2RS6A 2EPPA 5KL7A 5A69A 2EL5A 4DV4E 2EM4A 4F9AB 4B3RE 2EL6A 2N3HA 1DI2A 2WZOA 1YYKA 3VHTB 1XMQE 1I94E 2MDGA 1L4SA 1UILA 2EOIA 2A25A 3J7Yp 1JK2A 4J8ZA 4GZNC 4NZVA 1A1KA 2I13A 4LF4E 1X48A 2MKNA 3LMLA 2YTIA 4L5NC 2L2MA 1XNRE 2V85A 5TSEA 3EPHA 2YU5A 2EMHA 4R2CA 4BHCA 4BBYA 1UBDC 4MLQA 2WBSA 1T4OA 2V89A 1QU6A 3HTXA 2EPRA 2JWOA 4Q35B 1N33E 4WYQB 4JI1E 4DR4E 1O0WA 2EL4A 4M0VA 3QG5C 1F2IG 3VK6A 4DR1E 4JI5E 2FGGA 1GTKA 1ZBQA 2EM9A 4L8NA 1UN6B 2YTFA 2LVHA 4X8WA 4X9JA 1T4LB 2EPNA 4JI2E 2NABA 2LE2A 4BC9A 3HQ1A 2YRHA 2M9AA 4M9VC 3VYXA 3TQMA 4BCAA 1AH5A 2LO3A 2GHFA 2VQFE 4F6NA 2ODRD 4R03A 3KWRA 2B3TB 3MSWA 4I8OA 3UK3C 3THNA 2YPNA 4P78A 3KZZA 3AUZA 3RMPA 1JK1A 2F8BA 4DV0E 4O24A 4F9CB 1SFEA 2B7VA 3T1YE 4LF7E 1N3GA 2YWQA 2WBUA 3DF6A 1YUIA 4F2JC 2LCEA 4F9BB 4LF9E 3HXLA 4F54A 4DR6E 2YTDA 1G2FC 2RTXA 4ZYHA 4IJDA 2BBGA 4YHHE 4JI4E 4BMJA 1TF6A 1X6HA 5IV8B 4R2RA 1PJTA 2EOSA 2G7HA 5CFFE 2EPOA 1WHQA 2EPXA 1X49A 1RMDA 2EMWA 4JI0E 5A6BD 4DV5E 4K0KE 2ENCA 2UXCE 2EN7A 2LJUA 5AE2A 2YSPA 4R2DA 2VQEE 1STUA 4BC7A 2EM5A 2KONA 2HC5A 2R76A 3BF2A 4O43A 2CPNA 4JI8E 2ELYA 2EMKA 1HNZE 1RQ0A 4GEQB 1X47A 4R2EA 4DV3E 4R2SA 3EPKA 4M30A 2EMLA 1XNQE 2L6MA 2DIXA 3IWDA 2EQ3A 4JYAE 2FTXB 5BR8E 3THOB 1IBLE 2HHHE 3JAMC 1IBKE 1IQOA 3ADIA 2LBSB 4X62E 5LLQA 2ELZA 5KL5A 2EWLA 2Q8UA 5KL3A 1TF3A 2RSMA 1N34E 1T39A 5KL2A 2EOXA 5LMNE 4DMIA 4P7DA 3HPSA 2IHR1 2RS7A 2VE7C 1P47A 2YRMA 2LUPB 2DLKA 2V87A 2ZM6E 4LFAE 4LF8E 3L00A 2EN2A 3C4BA 2LTRA 2JVAA 2EPZA 5AASA 2NUFA 4JI3E 2EM0A 1EH8A 2EQ0A 4LTYA 2GPIA 2EOZA 2HGHA 2JOXA 1GZ6A 2RPCA 3KZYA 1HNXE 1HR0E 2EMFA 2EQ1A 1TN9A 1BBGA 4X66E 5IWAE 3DJWA 5AC4A 2ADRA 1BB8A 4YY3E 4KZSA 2L2NA 2BB8A 1A1IA 2EN6A 4X64E 4N4RB 2UXBE 2ODRC 2EP3A 2EPMX 2LTSA 2K4VA 2B7TA 3C6MA 4AQYE 2DMYA 2LV2A 2LMZA 4DV6E 4TUGA 3J7AG 4KWYA 2YSOA 4DR7E 4X65E 2YZTA 2EMCA 1PJQA 2EMAA 1ZU1A 2V86A 1PJSA 2EZ6A 5A6KA 2EOMA 2WCC3 3FIGA 4FK5C 4R8OA 2EOJA 5A6AA 3ZOQB 2YU8A 1WJPA 1A1JA 2JOBA 1YYOA 2PRTA 4WPYA 1WRJA 2B9DA 4HTGA 3P1XA 2RSIA 5AC5A 3ECRA 2EPLX 2EPUA 2DLQA 3IWCA 1X6EA 1YPNA 2V83A 4WSPA 2RQLA 4NHRA 5KL4A 4DV7E 4DR3E 5IXMB 3BGHA 3MHHC 4BHBA 1ZAAC 2UXDE 3EPJA 4HEIA 4B3ME 4DUZE 2J7JA 4NXME 4B3SE 4TUIA 1ZR9A 3J81C 3T1HE 4R2AA 2DMIA 2EPKX 4DR5E 2CT1A 2HJJA 1MGTA 5AE1A 2DGCA 1Z1BA 2M7QA 4IS1C 4NXNE 1T4NA 3C4TA 3ADLA 2EMIA 3BBGA 1KJKA 1QNTA 2KOUA 4JI7E 2JYAA 2NUGA 3IWBA 5LL6R 1MEYC 2F4VE 2ENAA 2YTGA 2DSYA 2E1MA 1G2DC 5IT9C 1RC7A 1T38A 1PDAA 4ZYDA 4ZYEA 4WXDA 2WBTA 1A1HA 2LUQA 3F6HA 2L2KB 2LT7A 2EM7A 2M1SA 5FLXC 4LFBE 2YRKA 2V88A 2UU9E 2MKDA 1X6FA 4JI6E 4DV1E 2L33A 1B69A 2N8XA 4R2QA 2GLIA 4WX9A 4GKKE 4LF5E 1YYWA 3EQ1A 4WXCA 1YSAC 2UUAE 2YTPA 1FJGE 5A6BA 5A6JA 3MHSC 1IBME 4O4KA 4DV2E 2FV4B 3EPLA 2EOFA 5DNYA 2R1FA 1HNWE 3C6KA 4OOGC 2MC6A 2KHXA 2EM2A 1UHZA 3ADJA 5ADZA 1ZBTA 4R2PA 2EM8A 4Q28A 2CSHA 4RHBB 2DRPA 1J26A 1X5WA 3HPZA 1BBOA 2JR1A 4JV5E 2EMZA 2YT4A 4ZYGA 4M2ZA 2JY9A 2EORA 2VRDA 2L3CA 2H36X 4BS9A 2YTQA 2N3GA 5F3WA 3F6GA 1EH7A 2EOQA 3LLHA 3JTZA 2EMYA 2LRSA 2EN1A 1YFHA 4WSGA 1FKAE 2LJHA 2EMXA 2EOHA 3OTOE 1N32E 5AE3A 1DQ3A 1A1FA 2EPCA 2YTNA 4OX9E 1NEIA 2UUBE 2EOYA 2MC5A 4DKKA 2EN4A 2UUCE 4DR2E 1GQEA 1A1GA 2YTOA 2VF1A 1N36E 5KL6A 1EH6A 2EM3A 2JXPA 2M4IA 2EM6A 2I9IA 2EMBA 2NA2A 2JPAA 2EMGA 1AAYA 5LMUE 1IMUA 2EN8A 4LF6E 1IQSA 1EKZA 4O5GA 1LLMC 2V8QB 1YUJA 2L8TA 3VYYA 1PKPA 4WFTA 4DUYE 2CTDA 1NCSA 3AV0A 2E5LE 2K7IA 5T6JA 2EPAA 2YTJA 2JP9A 2L3JA 3OMLA 1XMOE 2D9HA 3JU0A 1J5EE
chains in the Genus database with same CATH topology
4F6NA 4R2QA 2EJ4A 2RPCA 2GLIA 2EQ1A 2EMFA 1TN9A 1X3CA 2E72A 3UK3C 1YSAC 2YTPA 1JK1A 2ADRA 1BB8A 2EE8A 3M99B 3MHSC 2BB8A 1A1IA 2EN6A 2EOOA 2WBUA 3EPLA 1YUIA 2EOFA 2EP3A 2LCEA 4F2JC 2R1FA 2EN3A 1DGCA 2LV2A 4F6MA 2YTDA 2EM2A 1G2FC 4IJDA 1A1LA 2ENHA 4R2PA 2YTEA 2EOEA 2YSOA 1TF6A 2EM8A 2EPPA 5KL7A 2EL5A 1X6HA 2EM4A 2CSHA 2EL6A 2EMCA 1ZU1A 2EMAA 2EOSA 4R2RA 2DRPA 1X5WA 2EOMA 2WCC3 1BBOA 2EPXA 2EMZA 1B69A 1RMDA 3VHTB 2EMWA 4FK5C 2EORA 2VRDA 2EOJA 2YTQA 2MDGA 2YU8A 1WJPA 1A1JA 2EOIA 2ENCA 2A25A 2EN7A 2PRTA 2EOQA 1JK2A 4GZNC 2I13A 1A1KA 2YSPA 4R2DA 2MKNA 2EMYA 2YTIA 2EN1A 2RSIA 3EPHA 4WSGA 2EMHA 2YU5A 2EPUA 2DLQA 2EM5A 1X6EA 2EMXA 4R2CA 5KL4A 2EOHA 1UBDC 2ELYA 2EMKA 1A1FA 3MHHC 2EPCA 2YTNA 2WBSA 1ZAAC 3EPJA 4R2EA 2J7JA 4R2SA 1ZR9A 3EPKA 2LO3A 2EOYA 4R2AA 2DMIA 2EN4A 2EMLA 2EPRA 1A1GA 2CT1A 2YTOA 2DGCA 2EQ3A 1Z1BA 5KL6A 2EM3A 2EL4A 4IS1C 2EM6A 1F2IG 2ELZA 2EMBA 2JPAA 2EMGA 2EMIA 1AAYA 2EM9A 1KJKA 5KL5A 2EN8A 5KL3A 1TF3A 1UN6B 5KL2A 2EOXA 2YTFA 1MEYC 1LLMC 2ENAA 2YTGA 2LVHA 4X9JA 1G2DC 1YUJA 1P47A 2YRMA 2WBTA 2CTDA 1A1HA 1NCSA 2DLKA 2NABA 2LT7A 2EM7A 2EPAA 2YTJA 2EN2A 2YRHA 2JP9A 2EPZA 2YRKA 2M9AA 4M9VC 2EM0A 2D9HA 2MKDA 2EQ0A 1X6FA 2GHFA 2EOZA 2HGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F6N A;  4R2Q A;  2EJ4 A;  2RPC A;  2GLI A;  2EQ1 A;  2EMF A;  1TN9 A;  1X3C A;  2E72 A;  3UK3 C;  1YSA C;  2YTP A;  1JK1 A;  2ADR A;  1BB8 A;  2EE8 A;  3M99 B;  3MHS C;  2BB8 A;  1A1I A;  2EN6 A;  2EOO A;  2WBU A;  3EPL A;  1YUI A;  2EOF A;  2EP3 A;  2LCE A;  4F2J C;  2R1F A;  2EN3 A;  1DGC A;  2LV2 A;  4F6M A;  2YTD A;  2EM2 A;  1G2F C;  4IJD A;  1A1L A;  2ENH A;  4R2P A;  2YTE A;  2EOE A;  2YSO A;  1TF6 A;  2EM8 A;  2EPP A;  5KL7 A;  2EL5 A;  1X6H A;  2EM4 A;  2CSH A;  2EL6 A;  2EMC A;  1ZU1 A;  2EMA A;  2EOS A;  4R2R A;  2DRP A;  1X5W A;  2EOM A;  2WCC 3;  1BBO A;  2EPX A;  2EMZ A;  1B69 A;  1RMD A;  3VHT B;  2EMW A;  4FK5 C;  2EOR A;  2VRD A;  2EOJ A;  2YTQ A;  2MDG A;  2YU8 A;  1WJP A;  1A1J A;  2EOI A;  2ENC A;  2A25 A;  2EN7 A;  2PRT A;  2EOQ A;  1JK2 A;  4GZN C;  2I13 A;  1A1K A;  2YSP A;  4R2D A;  2MKN A;  2EMY A;  2YTI A;  2EN1 A;  2RSI A;  3EPH A;  4WSG A;  2EMH A;  2YU5 A;  2EPU A;  2DLQ A;  2EM5 A;  1X6E A;  2EMX A;  4R2C A;  5KL4 A;  2EOH A;  1UBD C;  2ELY A;  2EMK A;  1A1F A;  3MHH C;  2EPC A;  2YTN A;  2WBS A;  1ZAA C;  3EPJ A;  4R2E A;  2J7J A;  4R2S A;  1ZR9 A;  3EPK A;  2LO3 A;  2EOY A;  4R2A A;  2DMI A;  2EN4 A;  2EML A;  2EPR A;  1A1G A;  2CT1 A;  2YTO A;  2DGC A;  2EQ3 A;  1Z1B A;  5KL6 A;  2EM3 A;  2EL4 A;  4IS1 C;  2EM6 A;  1F2I G;  2ELZ A;  2EMB A;  2JPA A;  2EMG A;  2EMI A;  1AAY A;  2EM9 A;  1KJK A;  5KL5 A;  2EN8 A;  5KL3 A;  1TF3 A;  1UN6 B;  5KL2 A;  2EOX A;  2YTF A;  1MEY C;  1LLM C;  2ENA A;  2YTG A;  2LVH A;  4X9J A;  1G2D C;  1YUJ A;  1P47 A;  2YRM A;  2WBT A;  2CTD A;  1A1H A;  1NCS A;  2DLK A;  2NAB A;  2LT7 A;  2EM7 A;  2EPA A;  2YTJ A;  2EN2 A;  2YRH A;  2JP9 A;  2EPZ A;  2YRK A;  2M9A A;  4M9V C;  2EM0 A;  2D9H A;  2MKD A;  2EQ0 A;  1X6F A;  2GHF A;  2EOZ A;  2HGH A; 
#chains in the Genus database with same CATH topology
 3ADG A;  2EJ4 A;  2L92 A;  5A2Q C;  3H09 A;  1X3C A;  2E72 A;  4B3T E;  3J80 C;  2EE8 A;  3M99 B;  4MLV A;  1WXR A;  4RH8 A;  4GKJ E;  2EOO A;  3K6Q A;  4KHP E;  1SR9 A;  1KYQ A;  4LFC E;  2MDR A;  2EN3 A;  1WHN A;  1DGC A;  2NUE A;  4F6M A;  2DB2 A;  3BID A;  1A1L A;  4LU9 A;  2ENH A;  1YZ9 A;  2YTE A;  2EOE A;  2RS6 A;  2EPP A;  5KL7 A;  5A69 A;  2EL5 A;  4DV4 E;  2EM4 A;  4F9A B;  4B3R E;  2EL6 A;  2N3H A;  1DI2 A;  2WZO A;  1YYK A;  3VHT B;  1XMQ E;  1I94 E;  2MDG A;  1L4S A;  1UIL A;  2EOI A;  2A25 A;  3J7Y p;  1JK2 A;  4J8Z A;  4GZN C;  4NZV A;  1A1K A;  2I13 A;  4LF4 E;  1X48 A;  2MKN A;  3LML A;  2YTI A;  4L5N C;  2L2M A;  1XNR E;  2V85 A;  5TSE A;  3EPH A;  2YU5 A;  2EMH A;  4R2C A;  4BHC A;  4BBY A;  1UBD C;  4MLQ A;  2WBS A;  1T4O A;  2V89 A;  1QU6 A;  3HTX A;  2EPR A;  2JWO A;  4Q35 B;  1N33 E;  4WYQ B;  4JI1 E;  4DR4 E;  1O0W A;  2EL4 A;  4M0V A;  3QG5 C;  1F2I G;  3VK6 A;  4DR1 E;  4JI5 E;  2FGG A;  1GTK A;  1ZBQ A;  2EM9 A;  4L8N A;  1UN6 B;  2YTF A;  2LVH A;  4X8W A;  4X9J A;  1T4L B;  2EPN A;  4JI2 E;  2NAB A;  2LE2 A;  4BC9 A;  3HQ1 A;  2YRH A;  2M9A A;  4M9V C;  3VYX A;  3TQM A;  4BCA A;  1AH5 A;  2LO3 A;  2GHF A;  2VQF E;  4F6N A;  2ODR D;  4R03 A;  3KWR A;  2B3T B;  3MSW A;  4I8O A;  3UK3 C;  3THN A;  2YPN A;  4P78 A;  3KZZ A;  3AUZ A;  3RMP A;  1JK1 A;  2F8B A;  4DV0 E;  4O24 A;  4F9C B;  1SFE A;  2B7V A;  3T1Y E;  4LF7 E;  1N3G A;  2YWQ A;  2WBU A;  3DF6 A;  1YUI A;  4F2J C;  2LCE A;  4F9B B;  4LF9 E;  3HXL A;  4F54 A;  4DR6 E;  2YTD A;  1G2F C;  2RTX A;  4ZYH A;  4IJD A;  2BBG A;  4YHH E;  4JI4 E;  4BMJ A;  1TF6 A;  1X6H A;  5IV8 B;  4R2R A;  1PJT A;  2EOS A;  2G7H A;  5CFF E;  2EPO A;  1WHQ A;  2EPX A;  1X49 A;  1RMD A;  2EMW A;  4JI0 E;  5A6B D;  4DV5 E;  4K0K E;  2ENC A;  2UXC E;  2EN7 A;  2LJU A;  5AE2 A;  2YSP A;  4R2D A;  2VQE E;  1STU A;  4BC7 A;  2EM5 A;  2KON A;  2HC5 A;  2R76 A;  3BF2 A;  4O43 A;  2CPN A;  4JI8 E;  2ELY A;  2EMK A;  1HNZ E;  1RQ0 A;  4GEQ B;  1X47 A;  4R2E A;  4DV3 E;  4R2S A;  3EPK A;  4M30 A;  2EML A;  1XNQ E;  2L6M A;  2DIX A;  3IWD A;  2EQ3 A;  4JYA E;  2FTX B;  5BR8 E;  3THO B;  1IBL E;  2HHH E;  3JAM C;  1IBK E;  1IQO A;  3ADI A;  2LBS B;  4X62 E;  5LLQ A;  2ELZ A;  5KL5 A;  2EWL A;  2Q8U A;  5KL3 A;  1TF3 A;  2RSM A;  1N34 E;  1T39 A;  5KL2 A;  2EOX A;  5LMN E;  4DMI A;  4P7D A;  3HPS A;  2IHR 1;  2RS7 A;  2VE7 C;  1P47 A;  2YRM A;  2LUP B;  2DLK A;  2V87 A;  2ZM6 E;  4LFA E;  4LF8 E;  3L00 A;  2EN2 A;  3C4B A;  2LTR A;  2JVA A;  2EPZ A;  5AAS A;  2NUF A;  4JI3 E;  2EM0 A;  1EH8 A;  2EQ0 A;  4LTY A;  2GPI A;  2EOZ A;  2HGH A;  2JOX A;  1GZ6 A;  2RPC A;  3KZY A;  1HNX E;  1HR0 E;  2EMF A;  2EQ1 A;  1TN9 A;  1BBG A;  4X66 E;  5IWA E;  3DJW A;  5AC4 A;  2ADR A;  1BB8 A;  4YY3 E;  4KZS A;  2L2N A;  2BB8 A;  1A1I A;  2EN6 A;  4X64 E;  4N4R B;  2UXB E;  2ODR C;  2EP3 A;  2EPM X;  2LTS A;  2K4V A;  2B7T A;  3C6M A;  4AQY E;  2DMY A;  2LV2 A;  2LMZ A;  4DV6 E;  4TUG A;  3J7A G;  4KWY A;  2YSO A;  4DR7 E;  4X65 E;  2YZT A;  2EMC A;  1PJQ A;  2EMA A;  1ZU1 A;  2V86 A;  1PJS A;  2EZ6 A;  5A6K A;  2EOM A;  2WCC 3;  3FIG A;  4FK5 C;  4R8O A;  2EOJ A;  5A6A A;  3ZOQ B;  2YU8 A;  1WJP A;  1A1J A;  2JOB A;  1YYO A;  2PRT A;  4WPY A;  1WRJ A;  2B9D A;  4HTG A;  3P1X A;  2RSI A;  5AC5 A;  3ECR A;  2EPL X;  2EPU A;  2DLQ A;  3IWC A;  1X6E A;  1YPN A;  2V83 A;  4WSP A;  2RQL A;  4NHR A;  5KL4 A;  4DV7 E;  4DR3 E;  5IXM B;  3BGH A;  3MHH C;  4BHB A;  1ZAA C;  2UXD E;  3EPJ A;  4HEI A;  4B3M E;  4DUZ E;  2J7J A;  4NXM E;  4B3S E;  4TUI A;  1ZR9 A;  3J81 C;  3T1H E;  4R2A A;  2DMI A;  2EPK X;  4DR5 E;  2CT1 A;  2HJJ A;  1MGT A;  5AE1 A;  2DGC A;  1Z1B A;  2M7Q A;  4IS1 C;  4NXN E;  1T4N A;  3C4T A;  3ADL A;  2EMI A;  3BBG A;  1KJK A;  1QNT A;  2KOU A;  4JI7 E;  2JYA A;  2NUG A;  3IWB A;  5LL6 R;  1MEY C;  2F4V E;  2ENA A;  2YTG A;  2DSY A;  2E1M A;  1G2D C;  5IT9 C;  1RC7 A;  1T38 A;  1PDA A;  4ZYD A;  4ZYE A;  4WXD A;  2WBT A;  1A1H A;  2LUQ A;  3F6H A;  2L2K B;  2LT7 A;  2EM7 A;  2M1S A;  5FLX C;  4LFB E;  2YRK A;  2V88 A;  2UU9 E;  2MKD A;  1X6F A;  4JI6 E;  4DV1 E;  2L33 A;  1B69 A;  2N8X A;  4R2Q A;  2GLI A;  4WX9 A;  4GKK E;  4LF5 E;  1YYW A;  3EQ1 A;  4WXC A;  1YSA C;  2UUA E;  2YTP A;  1FJG E;  5A6B A;  5A6J A;  3MHS C;  1IBM E;  4O4K A;  4DV2 E;  2FV4 B;  3EPL A;  2EOF A;  5DNY A;  2R1F A;  1HNW E;  3C6K A;  4OOG C;  2MC6 A;  2KHX A;  2EM2 A;  1UHZ A;  3ADJ A;  5ADZ A;  1ZBT A;  4R2P A;  2EM8 A;  4Q28 A;  2CSH A;  4RHB B;  2DRP A;  1J26 A;  1X5W A;  3HPZ A;  1BBO A;  2JR1 A;  4JV5 E;  2EMZ A;  2YT4 A;  4ZYG A;  4M2Z A;  2JY9 A;  2EOR A;  2VRD A;  2L3C A;  2H36 X;  4BS9 A;  2YTQ A;  2N3G A;  5F3W A;  3F6G A;  1EH7 A;  2EOQ A;  3LLH A;  3JTZ A;  2EMY A;  2LRS A;  2EN1 A;  1YFH A;  4WSG A;  1FKA E;  2LJH A;  2EMX A;  2EOH A;  3OTO E;  1N32 E;  5AE3 A;  1DQ3 A;  1A1F A;  2EPC A;  2YTN A;  4OX9 E;  1NEI A;  2UUB E;  2EOY A;  2MC5 A;  4DKK A;  2EN4 A;  2UUC E;  4DR2 E;  1GQE A;  1A1G A;  2YTO A;  2VF1 A;  1N36 E;  5KL6 A;  1EH6 A;  2EM3 A;  2JXP A;  2M4I A;  2EM6 A;  2I9I A;  2EMB A;  2NA2 A;  2JPA A;  2EMG A;  1AAY A;  5LMU E;  1IMU A;  2EN8 A;  4LF6 E;  1IQS A;  1EKZ A;  4O5G A;  1LLM C;  2V8Q B;  1YUJ A;  2L8T A;  3VYY A;  1PKP A;  4WFT A;  4DUY E;  2CTD A;  1NCS A;  3AV0 A;  2E5L E;  2K7I A;  5T6J A;  2EPA A;  2YTJ A;  2JP9 A;  2L3J A;  3OML A;  1XMO E;  2D9H A;  3JU0 A;  1J5E E; 
#chains in the Genus database with same CATH homology
 4F6N A;  4R2Q A;  2EJ4 A;  2RPC A;  2GLI A;  2EQ1 A;  2EMF A;  1TN9 A;  1X3C A;  2E72 A;  3UK3 C;  1YSA C;  2YTP A;  1JK1 A;  2ADR A;  1BB8 A;  2EE8 A;  3M99 B;  3MHS C;  2BB8 A;  1A1I A;  2EN6 A;  2EOO A;  2WBU A;  3EPL A;  1YUI A;  2EOF A;  2EP3 A;  2LCE A;  4F2J C;  2R1F A;  2EN3 A;  1DGC A;  2LV2 A;  4F6M A;  2YTD A;  2EM2 A;  1G2F C;  4IJD A;  1A1L A;  2ENH A;  4R2P A;  2YTE A;  2EOE A;  2YSO A;  1TF6 A;  2EM8 A;  2EPP A;  5KL7 A;  2EL5 A;  1X6H A;  2EM4 A;  2CSH A;  2EL6 A;  2EMC A;  1ZU1 A;  2EMA A;  2EOS A;  4R2R A;  2DRP A;  1X5W A;  2EOM A;  2WCC 3;  1BBO A;  2EPX A;  2EMZ A;  1B69 A;  1RMD A;  3VHT B;  2EMW A;  4FK5 C;  2EOR A;  2VRD A;  2EOJ A;  2YTQ A;  2MDG A;  2YU8 A;  1WJP A;  1A1J A;  2EOI A;  2ENC A;  2A25 A;  2EN7 A;  2PRT A;  2EOQ A;  1JK2 A;  4GZN C;  2I13 A;  1A1K A;  2YSP A;  4R2D A;  2MKN A;  2EMY A;  2YTI A;  2EN1 A;  2RSI A;  3EPH A;  4WSG A;  2EMH A;  2YU5 A;  2EPU A;  2DLQ A;  2EM5 A;  1X6E A;  2EMX A;  4R2C A;  5KL4 A;  2EOH A;  1UBD C;  2ELY A;  2EMK A;  1A1F A;  3MHH C;  2EPC A;  2YTN A;  2WBS A;  1ZAA C;  3EPJ A;  4R2E A;  2J7J A;  4R2S A;  1ZR9 A;  3EPK A;  2LO3 A;  2EOY A;  4R2A A;  2DMI A;  2EN4 A;  2EML A;  2EPR A;  1A1G A;  2CT1 A;  2YTO A;  2DGC A;  2EQ3 A;  1Z1B A;  5KL6 A;  2EM3 A;  2EL4 A;  4IS1 C;  2EM6 A;  1F2I G;  2ELZ A;  2EMB A;  2JPA A;  2EMG A;  2EMI A;  1AAY A;  2EM9 A;  1KJK A;  5KL5 A;  2EN8 A;  5KL3 A;  1TF3 A;  1UN6 B;  5KL2 A;  2EOX A;  2YTF A;  1MEY C;  1LLM C;  2ENA A;  2YTG A;  2LVH A;  4X9J A;  1G2D C;  1YUJ A;  1P47 A;  2YRM A;  2WBT A;  2CTD A;  1A1H A;  1NCS A;  2DLK A;  2NAB A;  2LT7 A;  2EM7 A;  2EPA A;  2YTJ A;  2EN2 A;  2YRH A;  2JP9 A;  2EPZ A;  2YRK A;  2M9A A;  4M9V C;  2EM0 A;  2D9H A;  2MKD A;  2EQ0 A;  1X6F A;  2GHF A;  2EOZ A;  2HGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...