2V87A

Crystal structure of rag2-phd finger in complex with h3r2me2sk4me3 peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
total genus 15
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v87A01
2V83A 2V86A 2JWOA 2V87A 2V85A 2V89A 2V88A
chains in the Genus database with same CATH superfamily
2EL4A 2VE7C 2YRMA 4WYQB 2PRTA 1KYQA 2RPCA 2BB8A 1A1IA 2EMGA 1YYKA 3UK3C 2UXCE 2L6MA 2EPAA 3HPZA 5F3WA 3J7AG 2M9AA 1RC7A 5LLQA 2EORA 4NXME 3VHTB 3BIDA 1JK2A 1TF3A 1T38A 1A1GA 1QU6A 2D9HA 4K0KE 2EM4A 3P1XA 2YRHA 2EWLA 2KOUA 2EOFA 1ZBQA 2MDGA 5A6BD 1J26A 4JI1E 2JOBA 2L2NA 4MLVA 4DR5E 4X65E 2DLKA 4HTGA 2EQ1A 2EM3A 4B3SE 2B3TB 2YU5A 3EPHA 1XNRE 2YTEA 1X48A 2EN3A 1YUIA 3KZYA 4LF5E 1X3CA 2EJ4A 4JI4E 2RS6A 2YRKA 3OTOE 1PDAA 4O5GA 1A1HA 2V83A 3EPLA 2EOJA 4IS1C 2EMIA 2EN8A 4BC7A 3T1HE 4JI0E 4DV4E 2R76A 2JPAA 5IV8B 2EOYA 2JOXA 3BGHA 4TUGA 3ADLA 2B9DA 2EMCA 4X64E 2ENHA 4LF6E 2DMYA 3OMLA 3VYXA 5CFFE 5A2QC 4R2CA 3EPJA 2EM5A 2E5LE 1X49A 4BC9A 1ZU1A 5FLXC 1YSAC 2WZOA 2MDRA 2LMZA 2RS7A 2FV4B 4JI8E 4M30A 2M4IA 2VRDA 1ZR9A 2EPRA 4F9AB 2L33A 1T4LB 3J7Yp 2CTDA 5IWAE 2EMBA 3JU0A 3MSWA 2YSOA 5A6AA 1N33E 2J7JA 3MHSC 1T39A 3H09A 4BBYA 5KL7A 4LF7E 2EOQA 1GQEA 1N32E 1AAYA 2EM2A 1WXRA 4R2PA 1N34E 4F54A 2V85A 2GHFA 2EN4A 1BBGA 1X6FA 2ELYA 2EN7A 1HNZE 2EPZA 2E72A 2EPKX 4R2SA 2EL6A 4JI5E 2L2KB 3VYYA 2EPCA 2LUQA 4R2QA 1UHZA 2LJUA 4M0VA 2RQLA 3VK6A 1X6EA 4F9CB 4X9JA 2HHHE 2YT4A 1BB8A 3ZOQB 2CSHA 2VF1A 1PJQA 4JV5E 4GKKE 4L5NC 1YFHA 2EM9A 2EMFA 4DV1E 2YSPA 4WSGA 2F8BA 2K7IA 2WBUA 1L4SA 1IQSA 4YY3E 2MKDA 1WHQA 4KZSA 2JWOA 4GEQB 4DR6E 2V89A 1IBLE 1YYOA 1HNWE 2L3JA 4DKKA 2UUCE 1I94E 2V87A 2LE2A 1NEIA 2N3GA 2UXDE 1YPNA 2DMIA 2ELZA 4RH8A 5IXMB 2LJHA 4IJDA 2EPNA 2RSMA 1X47A 4B3TE 4R8OA 1G2DC 1YYWA 2YTPA 4GKJE 3KZZA 1A1JA 4BS9A 3HPSA 2V86A 5AC4A 2EQ3A 2EMYA 2M7QA 4R2DA 2NABA 2LVHA 2JP9A 2V8QB 3TQMA 1EH6A 4RHBB 5AE2A 3ECRA 2DB2A 2EMZA 2RSIA 2M1SA 1EKZA 1IQOA 4KWYA 2EOIA 2L2MA 2LO3A 1T4OA 2VQEE 1XMOE 2EMHA 4WPYA 1A1LA 2JYAA 3JAMC 2ZM6E 4LTYA 4JI3E 1BBOA 1HR0E 4Q28A 2B7TA 1TN9A 3EPKA 1MEYC 1PJSA 2YTIA 2NA2A 3AV0A 2MKNA 1ZBTA 2CT1A 2EOEA 4BMJA 4O24A 2EN1A 3LLHA 2LUPB 2EOHA 3ADIA 2L8TA 2EL5A 1P47A 4B3RE 2L3CA 1UILA 1WJPA 4ZYGA 1IBKE 1AH5A 4DV2E 4LFBE 3THOB 1XMQE 2I13A 2LV2A 2EMAA 2JVAA 2DGCA 1B69A 1JK1A 2WBSA 3LMLA 2EMLA 2E1MA 1PKPA 2EN2A 2EN6A 2G7HA 1EH7A 2YU8A 4J8ZA 1DQ3A 1DI2A 1A1KA 4LFCE 4ZYDA 2EZ6A 2FGGA 2GPIA 2WCC3 2EPUA 1GTKA 1J5EE 2YWQA 5AE1A 1WHNA 1FJGE 4L8NA 2ODRD 2UUBE 2K4VA 4X66E 5ADZA 3HTXA 2R1FA 4WSPA 1G2FC 2YPNA 2EOXA 2GLIA 3JTZA 3C6MA 1RQ0A 2FTXB 2HC5A 4BHCA 1WRJA 2VQFE 4LU9A 1EH8A 1IMUA 3C6KA 2LTRA 1FKAE 1PJTA 3ADGA 4DV3E 1TF6A 2JR1A 1IBME 2Q8UA 5KL4A 4YHHE 4LF4E 5KL3A 3IWCA 2YTFA 2YZTA 1F2IG 4LF9E 4DV7E 2EQ0A 2EPLX 2ENAA 4JI2E 2EPPA 3BF2A 2IHR1 2RTXA 2ENCA 2MC6A 4DR2E 4I8OA 1YZ9A 5AC5A 3THNA 2UXBE 1GZ6A 1SR9A 2BBGA 3AUZA 3L00A 4BCAA 4F9BB 2LRSA 3HXLA 4X62E 3EQ1A 4KHPE 3M99B 2DLQA 3C4BA 5AE3A 2DRPA 4WXDA 2EE8A 4HEIA 1SFEA 1RMDA 2DIXA 4AQYE 2NUFA 1KJKA 2JXPA 1YUJA 3IWBA 3KWRA 5IT9C 2EMXA 4BHBA 3QG5C 4P78A 1HNXE 2EPXA 2LCEA 2EOMA 1XNQE 2LBSB 4DV0E 3T1YE 4N4RB 2EPOA 1O0WA 5A6BA 4GZNC 5LL6R 4ZYEA 2JY9A 4DUYE 4MLQA 5DNYA 4LFAE 1UN6B 4FK5C 2EM6A 4OOGC 1X5WA 3IWDA 4DUZE 2EMKA 4F6MA 5A6KA 4NXNE 4R2RA 5KL2A 5KL6A 5TSEA 1ZAAC 2NUGA 4DR1E 3K6QA 4DV5E 2UUAE 3C4TA 2L92A 2V88A 4WFTA 3BBGA 3J80C 2EP3A 2YTGA 2EMWA 2EM0A 2NUEA 2LTSA 5AASA 3F6HA 5LMUE 4F2JC 2MC5A 1MGTA 2DSYA 4X8WA 1N3GA 2ODRC 4TUIA 1STUA 2HJJA 4DR4E 2HGHA 1DGCA 2EM8A 3ADJA 4DR3E 2KONA 5A69A 2EPMX 1T4NA 2H36X 2EOOA 3HQ1A 1N36E 2YTQA 4R03A 4NZVA 3FIGA 3J81C 1LLMC 3DF6A 1A1FA 2F4VE 2N3HA 4OX9E 2CPNA 4O4KA 1UBDC 4F6NA 2EOSA 2LT7A 4ZYHA 1QNTA 4DV6E 2YTDA 4JI7E 3F6GA 4P7DA 2N8XA 2YTNA 1Z1BA 4M9VC 5LMNE 2ADRA 4NHRA 4DR7E 5T6JA 2EOZA 2EM7A 1X6HA 3RMPA 4DMIA 5A6JA 2YTJA 4M2ZA 2KHXA 4R2EA 4WX9A 2A25A 5BR8E 4LF8E 4JI6E 4JYAE 1NCSA 4WXCA 4R2AA 3DJWA 2I9IA 3MHHC 2WBTA 2UU9E 4B3ME 4O43A 5KL5A 4Q35B 2YTOA 2B7VA
chains in the Genus database with same CATH topology
4P78A 2NA2A 2VE7C 3AV0A 1ZBTA 4F54A 4WYQB 2V85A 1HNXE 1XNQE 2LBSB 4DV0E 3T1YE 4BMJA 1HNZE 3LLHA 1YYKA 2LUPB 1O0WA 3ADIA 2L8TA 2UXCE 5LL6R 2L6MA 4B3RE 2JY9A 3HPZA 2L3CA 4DUYE 1UILA 5F3WA 1IBKE 3J7AG 4JI5E 5DNYA 4LFAE 2L2KB 3VYYA 1RC7A 4DV2E 4LFBE 4NXME 2LUQA 1UHZA 4OOGC 3IWDA 1XMQE 4M0VA 3VK6A 4DUZE 4F9CB 2HHHE 2YT4A 1QU6A 2JVAA 4K0KE 3ZOQB 1N34E 2VF1A 3LMLA 3P1XA 4JV5E 2EWLA 2KOUA 2E1MA 4NXNE 1PKPA 4GKKE 2G7HA 4DR1E 2NUGA 1ZBQA 3K6QA 4L5NC 4DV5E 2UUAE 1J26A 3C4TA 4J8ZA 2L92A 2V88A 4WFTA 1DQ3A 2JOBA 4DV1E 4JI1E 2F8BA 2L2NA 3J80C 1DI2A 4DR5E 4X65E 4LFCE 2EZ6A 4B3SE 2NUEA 2B3TB 4YY3E 2FGGA 2LTSA 3F6HA 5AASA 1XNRE 5LMUE 1X48A 2MC5A 1WHQA 4KZSA 2JWOA 2DSYA 4X8WA 4GEQB 1J5EE 4LF5E 2ODRC 5AE1A 4TUIA 1WHNA 1STUA 1FJGE 2V89A 4L8NA 1IBLE 2ODRD 4JI4E 2RS6A 3OTOE 1YYOA 4DR4E 1HNWE 2L3JA 4DKKA 2UUBE 2K4VA 2V83A 3ADJA 4DR3E 2UUCE 4X66E 2V87A 5ADZA 2KONA 1I94E 3HTXA 2LE2A 2N3GA 4BC7A 3T1HE 4JI0E 4WSPA 4DV4E 2UXDE 1T4NA 2LJHA 2H36X 3HQ1A 1N36E 2RSMA 3JTZA 4R03A 1RQ0A 1X47A 2FTXB 4B3TE 3FIGA 3J81C 4R8OA 3DF6A 2VQFE 2JOXA 4LU9A 2F4VE 3ADLA 4TUGA 2B9DA 1YYWA 4DR6E 2N3HA 4OX9E 4GKJE 4X64E 2CPNA 4BS9A 1FKAE 2LTRA 3HPSA 3ADGA 4LF6E 2V86A 4DV3E 2JR1A 2DMYA 3OMLA 1IBME 4YHHE 3VYXA 4LF4E 2M7QA 5CFFE 4DV6E 5A2QC 3IWCA 4JI7E 3F6GA 2YZTA 2E5LE 4LF9E 2V8QB 1X49A 4BC9A 4DV7E 5FLXC 4P7DA 4JI2E 2WZOA 2MDRA 2LMZA 2IHR1 5AE2A 2RS7A 5LMNE 2RTXA 2DB2A 4DR2E 2MC6A 1EKZA 2M1SA 2FV4B 4I8OA 4M30A 4JI8E 2M4IA 5T6JA 1YZ9A 4DR7E 2UXBE 1GZ6A 4F9AB 1SR9A 2L2MA 2L33A 1T4LB 3AUZA 4BCAA 4F9BB 2LRSA 3HXLA 3J7Yp 1T4OA 3RMPA 4X62E 4DMIA 2VQEE 1XMOE 4WPYA 4M2ZA 2KHXA 5BR8E 5IWAE 4KHPE 3C4BA 3JU0A 3MSWA 3JAMC 5AE3A 2ZM6E 4LTYA 1N33E 4LF8E 4JI3E 4JI6E 4JYAE 1HR0E 4Q28A 2DIXA 3H09A 3DJWA 4BBYA 4AQYE 2B7TA 2NUFA 2UU9E 4B3ME 4LF7E 3IWBA 3KWRA 5IT9C 1GQEA 1N32E 1WXRA 2B7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V83 A;  2V86 A;  2JWO A;  2V87 A;  2V85 A;  2V89 A;  2V88 A; 
#chains in the Genus database with same CATH topology
 2EL4 A;  2VE7 C;  2YRM A;  4WYQ B;  2PRT A;  1KYQ A;  2RPC A;  2BB8 A;  1A1I A;  2EMG A;  1YYK A;  3UK3 C;  2UXC E;  2L6M A;  2EPA A;  3HPZ A;  5F3W A;  3J7A G;  2M9A A;  1RC7 A;  5LLQ A;  2EOR A;  4NXM E;  3VHT B;  3BID A;  1JK2 A;  1TF3 A;  1T38 A;  1A1G A;  1QU6 A;  2D9H A;  4K0K E;  2EM4 A;  3P1X A;  2YRH A;  2EWL A;  2KOU A;  2EOF A;  1ZBQ A;  2MDG A;  5A6B D;  1J26 A;  4JI1 E;  2JOB A;  2L2N A;  4MLV A;  4DR5 E;  4X65 E;  2DLK A;  4HTG A;  2EQ1 A;  2EM3 A;  4B3S E;  2B3T B;  2YU5 A;  3EPH A;  1XNR E;  2YTE A;  1X48 A;  2EN3 A;  1YUI A;  3KZY A;  4LF5 E;  1X3C A;  2EJ4 A;  4JI4 E;  2RS6 A;  2YRK A;  3OTO E;  1PDA A;  4O5G A;  1A1H A;  2V83 A;  3EPL A;  2EOJ A;  4IS1 C;  2EMI A;  2EN8 A;  4BC7 A;  3T1H E;  4JI0 E;  4DV4 E;  2R76 A;  2JPA A;  5IV8 B;  2EOY A;  2JOX A;  3BGH A;  4TUG A;  3ADL A;  2B9D A;  2EMC A;  4X64 E;  2ENH A;  4LF6 E;  2DMY A;  3OML A;  3VYX A;  5CFF E;  5A2Q C;  4R2C A;  3EPJ A;  2EM5 A;  2E5L E;  1X49 A;  4BC9 A;  1ZU1 A;  5FLX C;  1YSA C;  2WZO A;  2MDR A;  2LMZ A;  2RS7 A;  2FV4 B;  4JI8 E;  4M30 A;  2M4I A;  2VRD A;  1ZR9 A;  2EPR A;  4F9A B;  2L33 A;  1T4L B;  3J7Y p;  2CTD A;  5IWA E;  2EMB A;  3JU0 A;  3MSW A;  2YSO A;  5A6A A;  1N33 E;  2J7J A;  3MHS C;  1T39 A;  3H09 A;  4BBY A;  5KL7 A;  4LF7 E;  2EOQ A;  1GQE A;  1N32 E;  1AAY A;  2EM2 A;  1WXR A;  4R2P A;  1N34 E;  4F54 A;  2V85 A;  2GHF A;  2EN4 A;  1BBG A;  1X6F A;  2ELY A;  2EN7 A;  1HNZ E;  2EPZ A;  2E72 A;  2EPK X;  4R2S A;  2EL6 A;  4JI5 E;  2L2K B;  3VYY A;  2EPC A;  2LUQ A;  4R2Q A;  1UHZ A;  2LJU A;  4M0V A;  2RQL A;  3VK6 A;  1X6E A;  4F9C B;  4X9J A;  2HHH E;  2YT4 A;  1BB8 A;  3ZOQ B;  2CSH A;  2VF1 A;  1PJQ A;  4JV5 E;  4GKK E;  4L5N C;  1YFH A;  2EM9 A;  2EMF A;  4DV1 E;  2YSP A;  4WSG A;  2F8B A;  2K7I A;  2WBU A;  1L4S A;  1IQS A;  4YY3 E;  2MKD A;  1WHQ A;  4KZS A;  2JWO A;  4GEQ B;  4DR6 E;  2V89 A;  1IBL E;  1YYO A;  1HNW E;  2L3J A;  4DKK A;  2UUC E;  1I94 E;  2V87 A;  2LE2 A;  1NEI A;  2N3G A;  2UXD E;  1YPN A;  2DMI A;  2ELZ A;  4RH8 A;  5IXM B;  2LJH A;  4IJD A;  2EPN A;  2RSM A;  1X47 A;  4B3T E;  4R8O A;  1G2D C;  1YYW A;  2YTP A;  4GKJ E;  3KZZ A;  1A1J A;  4BS9 A;  3HPS A;  2V86 A;  5AC4 A;  2EQ3 A;  2EMY A;  2M7Q A;  4R2D A;  2NAB A;  2LVH A;  2JP9 A;  2V8Q B;  3TQM A;  1EH6 A;  4RHB B;  5AE2 A;  3ECR A;  2DB2 A;  2EMZ A;  2RSI A;  2M1S A;  1EKZ A;  1IQO A;  4KWY A;  2EOI A;  2L2M A;  2LO3 A;  1T4O A;  2VQE E;  1XMO E;  2EMH A;  4WPY A;  1A1L A;  2JYA A;  3JAM C;  2ZM6 E;  4LTY A;  4JI3 E;  1BBO A;  1HR0 E;  4Q28 A;  2B7T A;  1TN9 A;  3EPK A;  1MEY C;  1PJS A;  2YTI A;  2NA2 A;  3AV0 A;  2MKN A;  1ZBT A;  2CT1 A;  2EOE A;  4BMJ A;  4O24 A;  2EN1 A;  3LLH A;  2LUP B;  2EOH A;  3ADI A;  2L8T A;  2EL5 A;  1P47 A;  4B3R E;  2L3C A;  1UIL A;  1WJP A;  4ZYG A;  1IBK E;  1AH5 A;  4DV2 E;  4LFB E;  3THO B;  1XMQ E;  2I13 A;  2LV2 A;  2EMA A;  2JVA A;  2DGC A;  1B69 A;  1JK1 A;  2WBS A;  3LML A;  2EML A;  2E1M A;  1PKP A;  2EN2 A;  2EN6 A;  2G7H A;  1EH7 A;  2YU8 A;  4J8Z A;  1DQ3 A;  1DI2 A;  1A1K A;  4LFC E;  4ZYD A;  2EZ6 A;  2FGG A;  2GPI A;  2WCC 3;  2EPU A;  1GTK A;  1J5E E;  2YWQ A;  5AE1 A;  1WHN A;  1FJG E;  4L8N A;  2ODR D;  2UUB E;  2K4V A;  4X66 E;  5ADZ A;  3HTX A;  2R1F A;  4WSP A;  1G2F C;  2YPN A;  2EOX A;  2GLI A;  3JTZ A;  3C6M A;  1RQ0 A;  2FTX B;  2HC5 A;  4BHC A;  1WRJ A;  2VQF E;  4LU9 A;  1EH8 A;  1IMU A;  3C6K A;  2LTR A;  1FKA E;  1PJT A;  3ADG A;  4DV3 E;  1TF6 A;  2JR1 A;  1IBM E;  2Q8U A;  5KL4 A;  4YHH E;  4LF4 E;  5KL3 A;  3IWC A;  2YTF A;  2YZT A;  1F2I G;  4LF9 E;  4DV7 E;  2EQ0 A;  2EPL X;  2ENA A;  4JI2 E;  2EPP A;  3BF2 A;  2IHR 1;  2RTX A;  2ENC A;  2MC6 A;  4DR2 E;  4I8O A;  1YZ9 A;  5AC5 A;  3THN A;  2UXB E;  1GZ6 A;  1SR9 A;  2BBG A;  3AUZ A;  3L00 A;  4BCA A;  4F9B B;  2LRS A;  3HXL A;  4X62 E;  3EQ1 A;  4KHP E;  3M99 B;  2DLQ A;  3C4B A;  5AE3 A;  2DRP A;  4WXD A;  2EE8 A;  4HEI A;  1SFE A;  1RMD A;  2DIX A;  4AQY E;  2NUF A;  1KJK A;  2JXP A;  1YUJ A;  3IWB A;  3KWR A;  5IT9 C;  2EMX A;  4BHB A;  3QG5 C;  4P78 A;  1HNX E;  2EPX A;  2LCE A;  2EOM A;  1XNQ E;  2LBS B;  4DV0 E;  3T1Y E;  4N4R B;  2EPO A;  1O0W A;  5A6B A;  4GZN C;  5LL6 R;  4ZYE A;  2JY9 A;  4DUY E;  4MLQ A;  5DNY A;  4LFA E;  1UN6 B;  4FK5 C;  2EM6 A;  4OOG C;  1X5W A;  3IWD A;  4DUZ E;  2EMK A;  4F6M A;  5A6K A;  4NXN E;  4R2R A;  5KL2 A;  5KL6 A;  5TSE A;  1ZAA C;  2NUG A;  4DR1 E;  3K6Q A;  4DV5 E;  2UUA E;  3C4T A;  2L92 A;  2V88 A;  4WFT A;  3BBG A;  3J80 C;  2EP3 A;  2YTG A;  2EMW A;  2EM0 A;  2NUE A;  2LTS A;  5AAS A;  3F6H A;  5LMU E;  4F2J C;  2MC5 A;  1MGT A;  2DSY A;  4X8W A;  1N3G A;  2ODR C;  4TUI A;  1STU A;  2HJJ A;  4DR4 E;  2HGH A;  1DGC A;  2EM8 A;  3ADJ A;  4DR3 E;  2KON A;  5A69 A;  2EPM X;  1T4N A;  2H36 X;  2EOO A;  3HQ1 A;  1N36 E;  2YTQ A;  4R03 A;  4NZV A;  3FIG A;  3J81 C;  1LLM C;  3DF6 A;  1A1F A;  2F4V E;  2N3H A;  4OX9 E;  2CPN A;  4O4K A;  1UBD C;  4F6N A;  2EOS A;  2LT7 A;  4ZYH A;  1QNT A;  4DV6 E;  2YTD A;  4JI7 E;  3F6G A;  4P7D A;  2N8X A;  2YTN A;  1Z1B A;  4M9V C;  5LMN E;  2ADR A;  4NHR A;  4DR7 E;  5T6J A;  2EOZ A;  2EM7 A;  1X6H A;  3RMP A;  4DMI A;  5A6J A;  2YTJ A;  4M2Z A;  2KHX A;  4R2E A;  4WX9 A;  2A25 A;  5BR8 E;  4LF8 E;  4JI6 E;  4JYA E;  1NCS A;  4WXC A;  4R2A A;  3DJW A;  2I9I A;  3MHH C;  2WBT A;  2UU9 E;  4B3M E;  4O43 A;  5KL5 A;  4Q35 B;  2YTO A;  2B7V A; 
#chains in the Genus database with same CATH homology
 4P78 A;  2NA2 A;  2VE7 C;  3AV0 A;  1ZBT A;  4F54 A;  4WYQ B;  2V85 A;  1HNX E;  1XNQ E;  2LBS B;  4DV0 E;  3T1Y E;  4BMJ A;  1HNZ E;  3LLH A;  1YYK A;  2LUP B;  1O0W A;  3ADI A;  2L8T A;  2UXC E;  5LL6 R;  2L6M A;  4B3R E;  2JY9 A;  3HPZ A;  2L3C A;  4DUY E;  1UIL A;  5F3W A;  1IBK E;  3J7A G;  4JI5 E;  5DNY A;  4LFA E;  2L2K B;  3VYY A;  1RC7 A;  4DV2 E;  4LFB E;  4NXM E;  2LUQ A;  1UHZ A;  4OOG C;  3IWD A;  1XMQ E;  4M0V A;  3VK6 A;  4DUZ E;  4F9C B;  2HHH E;  2YT4 A;  1QU6 A;  2JVA A;  4K0K E;  3ZOQ B;  1N34 E;  2VF1 A;  3LML A;  3P1X A;  4JV5 E;  2EWL A;  2KOU A;  2E1M A;  4NXN E;  1PKP A;  4GKK E;  2G7H A;  4DR1 E;  2NUG A;  1ZBQ A;  3K6Q A;  4L5N C;  4DV5 E;  2UUA E;  1J26 A;  3C4T A;  4J8Z A;  2L92 A;  2V88 A;  4WFT A;  1DQ3 A;  2JOB A;  4DV1 E;  4JI1 E;  2F8B A;  2L2N A;  3J80 C;  1DI2 A;  4DR5 E;  4X65 E;  4LFC E;  2EZ6 A;  4B3S E;  2NUE A;  2B3T B;  4YY3 E;  2FGG A;  2LTS A;  3F6H A;  5AAS A;  1XNR E;  5LMU E;  1X48 A;  2MC5 A;  1WHQ A;  4KZS A;  2JWO A;  2DSY A;  4X8W A;  4GEQ B;  1J5E E;  4LF5 E;  2ODR C;  5AE1 A;  4TUI A;  1WHN A;  1STU A;  1FJG E;  2V89 A;  4L8N A;  1IBL E;  2ODR D;  4JI4 E;  2RS6 A;  3OTO E;  1YYO A;  4DR4 E;  1HNW E;  2L3J A;  4DKK A;  2UUB E;  2K4V A;  2V83 A;  3ADJ A;  4DR3 E;  2UUC E;  4X66 E;  2V87 A;  5ADZ A;  2KON A;  1I94 E;  3HTX A;  2LE2 A;  2N3G A;  4BC7 A;  3T1H E;  4JI0 E;  4WSP A;  4DV4 E;  2UXD E;  1T4N A;  2LJH A;  2H36 X;  3HQ1 A;  1N36 E;  2RSM A;  3JTZ A;  4R03 A;  1RQ0 A;  1X47 A;  2FTX B;  4B3T E;  3FIG A;  3J81 C;  4R8O A;  3DF6 A;  2VQF E;  2JOX A;  4LU9 A;  2F4V E;  3ADL A;  4TUG A;  2B9D A;  1YYW A;  4DR6 E;  2N3H A;  4OX9 E;  4GKJ E;  4X64 E;  2CPN A;  4BS9 A;  1FKA E;  2LTR A;  3HPS A;  3ADG A;  4LF6 E;  2V86 A;  4DV3 E;  2JR1 A;  2DMY A;  3OML A;  1IBM E;  4YHH E;  3VYX A;  4LF4 E;  2M7Q A;  5CFF E;  4DV6 E;  5A2Q C;  3IWC A;  4JI7 E;  3F6G A;  2YZT A;  2E5L E;  4LF9 E;  2V8Q B;  1X49 A;  4BC9 A;  4DV7 E;  5FLX C;  4P7D A;  4JI2 E;  2WZO A;  2MDR A;  2LMZ A;  2IHR 1;  5AE2 A;  2RS7 A;  5LMN E;  2RTX A;  2DB2 A;  4DR2 E;  2MC6 A;  1EKZ A;  2M1S A;  2FV4 B;  4I8O A;  4M30 A;  4JI8 E;  2M4I A;  5T6J A;  1YZ9 A;  4DR7 E;  2UXB E;  1GZ6 A;  4F9A B;  1SR9 A;  2L2M A;  2L33 A;  1T4L B;  3AUZ A;  4BCA A;  4F9B B;  2LRS A;  3HXL A;  3J7Y p;  1T4O A;  3RMP A;  4X62 E;  4DMI A;  2VQE E;  1XMO E;  4WPY A;  4M2Z A;  2KHX A;  5BR8 E;  5IWA E;  4KHP E;  3C4B A;  3JU0 A;  3MSW A;  3JAM C;  5AE3 A;  2ZM6 E;  4LTY A;  1N33 E;  4LF8 E;  4JI3 E;  4JI6 E;  4JYA E;  1HR0 E;  4Q28 A;  2DIX A;  3H09 A;  3DJW A;  4BBY A;  4AQY E;  2B7T A;  2NUF A;  2UU9 E;  4B3M E;  4LF7 E;  3IWB A;  3KWR A;  5IT9 C;  1GQE A;  1N32 E;  1WXR A;  2B7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...