2V87A

Crystal structure of rag2-phd finger in complex with h3r2me2sk4me3 peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
b'SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 15
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v87A01
2V89A 2V85A 2V87A 2V86A 2V83A 2V88A 2JWOA
chains in the Genus database with same CATH superfamily
2EM4A 4DR7E 3FIGA 4NXME 2EOQA 2WBTA 3T1HE 4BCAA 1EKZA 4LF8E 2EPNA 5AC4A 2FTXB 4F6MA 1YZ9A 3ADIA 2EMFA 3C4BA 5T6JA 5KL6A 5AC5A 3VYXA 5A6BA 3DJWA 2EM5A 1UBDC 1HNXE 4I8OA 1A1LA 4WXDA 1LLMC 1KYQA 1WHQA 4LF6E 2LCEA 2D9HA 3ADLA 3C6MA 4F9AB 4B3TE 2EMYA 2YTFA 4DUYE 2EOHA 4ZYHA 4DV2E 4LTYA 4P7DA 3EQ1A 3HQ1A 1TF6A 2YTJA 5IV8B 2EM8A 2EQ3A 4AQYE 1FKAE 1T4NA 2L3JA 2EQ1A 2EMBA 2EZ6A 3OMLA 4P78A 1HNWE 2EOFA 3J7AG 2NUGA 4RH8A 4LFBE 4NZVA 3UK3C 2KOUA 2CTDA 2EPZA 2B7VA 4B3ME 2JOXA 4JI5E 3F6HA 1PJSA 4F54A 2GHFA 4WSPA 1N34E 3LMLA 2YTPA 3VYYA 5LMUE 2EN6A 4BC9A 2HGHA 2VE7C 4DV6E 2YWQA 2EL5A 2V85A 2V87A 1ZBTA 2M9AA 2B7TA 2ODRD 4KZSA 2NUEA 2EM3A 4X62E 4DKKA 2EN8A 1G2DC 4F9CB 2EL4A 4R8OA 2YRHA 2L8TA 2J7JA 2WZOA 3ZOQB 1MEYC 2JP9A 2LE2A 2L3CA 2GPIA 4ZYGA 2EOEA 2ZM6E 5KL7A 4TUIA 2YTGA 4Q28A 1ZR9A 3THOB 2V8QB 1IBKE 4X64E 2LUPB 2HHHE 3J80C 3P1XA 3KWRA 5A6KA 4LFCE 1T4LB 2DLQA 4GZNC 1PJQA 3DF6A 3C4TA 4IJDA 4DUZE 2EMGA 1ZBQA 2EP3A 1X6HA 5A6BD 2EPLX 4R2QA 2WBSA 2LTSA 2V89A 1B69A 4Q35B 5A6JA 1XMOE 2M1SA 5KL2A 5KL5A 4R2PA 1BBGA 2MC5A 2E5LE 2EMXA 4O24A 2DGCA 4F6NA 1BB8A 2LVHA 5A69A 4DR6E 2LRSA 2CSHA 2RS7A 1YFHA 1UILA 2EPMX 2EN7A 2MKNA 1IBLE 2EMCA 2YTIA 4TUGA 2DRPA 2FGGA 1GZ6A 4X8WA 2I9IA 2EPKX 4O4KA 3EPJA 1AH5A 3OTOE 3EPLA 1O0WA 3HXLA 1TF3A 1N3GA 4R2EA 2LMZA 4NHRA 2BB8A 3HPSA 2ENHA 4M0VA 4JI8E 2DSYA 4YY3E 2EPAA 1BBOA 1DQ3A 5A6AA 2EOXA 4WX9A 4GKJE 4L8NA 1GTKA 2E1MA 2Q8UA 2IHR1 1YYKA 4BMJA 2MC6A 1EH6A 3IWCA 1UHZA 2I13A 2JOBA 2YU5A 1SR9A 3F6GA 1X3CA 4FK5C 2RTXA 2UU9E 2MDGA 4J8ZA 4R2SA 2WCC3 2EMLA 2EMHA 1EH7A 4B3SE 1UN6B 4NXNE 2JYAA 1F2IG 2LO3A 2NABA 4LFAE 2HJJA 3JTZA 2EN2A 5AASA 4WYQB 1YPNA 4OX9E 2R76A 4JI7E 2UUBE 4DR5E 2DB2A 2LV2A 4DR4E 2JVAA 2YTOA 1FJGE 1L4SA 4DV1E 3MSWA 1QNTA 5LL6R 2M4IA 2LJUA 2ELYA 4R2AA 4R03A 2CT1A 2EQ0A 4LF4E 1XMQE 4DV7E 5FLXC 1PJTA 4N4RB 2YT4A 2DMIA 2JY9A 3HPZA 1IQOA 2F8BA 1XNRE 1PDAA 4YHHE 2H36X 2EJ4A 4WXCA 2EPCA 5KL4A 3KZZA 2UUAE 2EM7A 3L00A 1DGCA 2VF1A 4LF5E 2ENAA 2N3GA 5F3WA 4B3RE 4HTGA 2VQEE 4R2RA 2YTQA 4OOGC 1A1GA 1WJPA 3H09A 2VQFE 4JI1E 1EH8A 2EM0A 3QG5C 1MGTA 4F9BB 2EM6A 1GQEA 3BGHA 2BBGA 5AE1A 1AAYA 4BC7A 1HNZE 5A2QC 4DV5E 2GLIA 4JI4E 1DI2A 2YTNA 2EM2A 2EPPA 3C6KA 2EOSA 4JI2E 3HTXA 1IBME 2EMAA 4MLVA 2HC5A 2CPNA 1WXRA 2JXPA 4ZYDA 1JK1A 2EE8A 3EPHA 4BBYA 3EPKA 5ADZA 4BS9A 2EOJA 1XNQE 1QU6A 4JI3E 5DNYA 1STUA 2EOOA 5AE3A 4X9JA 2PRTA 1A1HA 2WBUA 4DV3E 4DR3E 3RMPA 2DIXA 5AE2A 3M99B 2B9DA 1A1JA 4IS1C 5LMNE 4DR1E 1YSAC 2EMKA 4RHBB 2K7IA 2RQLA 2EOMA 1N33E 2NUFA 2EORA 2YPNA 4WSGA 3IWDA 4F2JC 1WRJA 2EMWA 2EN4A 4WPYA 2YRKA 2L92A 2JR1A 2NA2A 4GKKE 1ZU1A 4KHPE 2YRMA 2YU8A 4GEQB 1RQ0A 1IQSA 2KHXA 2EPUA 4LF7E 2YZTA 3TQMA 2EMIA 1Z1BA 5LLQA 4M9VC 2JWOA 2YTDA 3KZYA 1HR0E 2E72A 3T1YE 2EOIA 2V88A 4DR2E 1X49A 2UXDE 2RS6A 5KL3A 4HEIA 2EWLA 4X65E 2LBSB 4LF9E 2KONA 3J7Yp 1NCSA 2LUQA 2JPAA 2YSPA 2N3HA 5IT9C 1YUIA 2RSIA 3ADJA 2EN1A 3IWBA 2LTRA 4JI6E 2MDRA 1I94E 4JI0E 2EPXA 4DV0E 1X48A 2ADRA 2R1FA 2EOZA 2G7HA 4BHBA 3BIDA 1YYWA 5IXMB 1A1KA 1X6EA 2YSOA 2L2NA 4ZYEA 2DLKA 2L2KB 2MKDA 1G2FC 1X5WA 2EL6A 2RSMA 1X6FA 2VRDA 1KJKA 3ECRA 2EPOA 3LLHA 1SFEA 2ENCA 5BR8E 3AV0A 1PKPA 2LT7A 4O5GA 2M7QA 2ELZA 2YTEA 2UXCE 4R2DA 2F4VE 1IMUA 2B3TB 3ADGA 1P47A 1RMDA 2K4VA 1TN9A 5CFFE 1J26A 4JV5E 2EM9A 2L33A 2RPCA 2EMZA 2L6MA 3JAMC 2A25A 4BHCA 1T4OA 3THNA 2UXBE 2DMYA 4M2ZA 5TSEA 3MHSC 5IWAE 1ZAAC 4O43A 1N32E 4X66E 1NEIA 4JYAE 3VK6A 2EN3A 4DV4E 1J5EE 2UUCE 1T38A 2N8XA 3J81C 3AUZA 2LJHA 3K6QA 2L2MA 3VHTB 4WFTA 1N36E 1X47A 2FV4B 4L5NC 1RC7A 3BF2A 4LU9A 3JU0A 4DMIA 3BBGA 4R2CA 1T39A 4MLQA 2EPRA 4K0KE 1WHNA 1A1IA 1YUJA 1A1FA 4KWYA 2V86A 2V83A 2ODRC 1YYOA 3MHHC 2EOYA 1JK2A 4M30A
chains in the Genus database with same CATH topology
2M4IA 1HR0E 4DR7E 3FIGA 4NXME 3T1HE 3T1YE 3DF6A 4R03A 2V88A 4BCAA 1EKZA 4DR2E 1X49A 4LF8E 2UXDE 2RS6A 3C4TA 2EWLA 2FTXB 4DUZE 4X65E 2LBSB 1YZ9A 4LF9E 2KONA 3J7Yp 3ADIA 1ZBQA 2LUQA 3C4BA 5T6JA 4DV7E 5FLXC 1XMQE 4LF4E 2N3HA 5IT9C 3VYXA 2LTSA 2V89A 3ADJA 2YT4A 2JY9A 3DJWA 3HPZA 2F8BA 1XNRE 1XMOE 2M1SA 3IWBA 2H36X 2LTRA 4YHHE 4JI6E 2MDRA 1HNXE 4I8OA 2MC5A 2E5LE 1I94E 4JI0E 4DV0E 2UUAE 1WHQA 4LF6E 3ADLA 4DR6E 2LRSA 2RS7A 1X48A 4F9AB 4B3TE 4GKKE 2G7HA 2VF1A 4DUYE 4LF5E 1UILA 1YYWA 2N3GA 4DV2E 5F3WA 4B3RE 4LTYA 2VQEE 2L2NA 4P7DA 4OOGC 3HQ1A 3H09A 2VQFE 2L2KB 4JI1E 1IBLE 4AQYE 4F9BB 1FKAE 1T4NA 1GQEA 2L3JA 4TUGA 5AE1A 2FGGA 2RSMA 1GZ6A 4X8WA 4BC7A 5A2QC 4DV5E 3OMLA 4P78A 1HNZE 4JI4E 2EZ6A 1DI2A 1HNWE 3J7AG 3LLHA 5BR8E 2NUGA 4LFBE 3AV0A 1PKPA 3OTOE 2KOUA 4JI2E 3HTXA 1O0WA 3HXLA 2M7QA 1IBME 2UXCE 2F4VE 2B7VA 2CPNA 2B3TB 2JOXA 2LMZA 3ADGA 1WXRA 4B3ME 4JI5E 3F6HA 3HPSA 4F54A 4M0VA 4BBYA 4JI8E 2K4VA 4BS9A 2DSYA 5ADZA 4WSPA 5CFFE 4YY3E 1J26A 1N34E 1XNQE 1QU6A 3LMLA 4JV5E 4JI3E 3VYYA 1DQ3A 2L33A 1STUA 5DNYA 5LMUE 4BC9A 2L6MA 3JAMC 5AE3A 4GKJE 4L8NA 1T4OA 2UXBE 2E1MA 2IHR1 2DMYA 4DV3E 1YYKA 4DR3E 3RMPA 2DIXA 4M2ZA 2VE7C 4BMJA 5AE2A 4DV6E 2B9DA 5IWAE 2MC6A 3IWCA 1UHZA 5LMNE 2V85A 4DR1E 2JOBA 2V87A 1ZBTA 1SR9A 1N32E 2B7TA 3F6GA 2ODRD 4KZSA 4X66E 2NUEA 4JYAE 3VK6A 4DV4E 1J5EE 2UUCE 2RTXA 2UU9E 4X62E 1N33E 2NUFA 4J8ZA 4DKKA 4F9CB 3IWDA 3J81C 4R8OA 3AUZA 2L8TA 2WZOA 2LJHA 3ZOQB 3K6QA 4WPYA 2L2MA 1N36E 4WFTA 4B3SE 2L92A 1X47A 2FV4B 2JR1A 2LE2A 2NA2A 4L5NC 4NXNE 4LFAE 2L3CA 1RC7A 4KHPE 3JTZA 2ZM6E 5AASA 4GEQB 4LU9A 4TUIA 3JU0A 1RQ0A 4Q28A 4WYQB 4DMIA 2KHXA 4LF7E 4OX9E 4JI7E 4K0KE 2V8QB 1IBKE 4X64E 2YZTA 1WHNA 4DR5E 2LUPB 3J80C 2HHHE 2UUBE 2DB2A 3P1XA 3KWRA 2V86A 2V83A 2JVAA 2ODRC 1FJGE 4LFCE 1YYOA 4DR4E 4DV1E 2JWOA 1T4LB 3MSWA 4M30A 5LL6R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V89 A;  2V85 A;  2V87 A;  2V86 A;  2V83 A;  2V88 A;  2JWO A; 
#chains in the Genus database with same CATH topology
 2EM4 A;  4DR7 E;  3FIG A;  4NXM E;  2EOQ A;  2WBT A;  3T1H E;  4BCA A;  1EKZ A;  4LF8 E;  2EPN A;  5AC4 A;  2FTX B;  4F6M A;  1YZ9 A;  3ADI A;  2EMF A;  3C4B A;  5T6J A;  5KL6 A;  5AC5 A;  3VYX A;  5A6B A;  3DJW A;  2EM5 A;  1UBD C;  1HNX E;  4I8O A;  1A1L A;  4WXD A;  1LLM C;  1KYQ A;  1WHQ A;  4LF6 E;  2LCE A;  2D9H A;  3ADL A;  3C6M A;  4F9A B;  4B3T E;  2EMY A;  2YTF A;  4DUY E;  2EOH A;  4ZYH A;  4DV2 E;  4LTY A;  4P7D A;  3EQ1 A;  3HQ1 A;  1TF6 A;  2YTJ A;  5IV8 B;  2EM8 A;  2EQ3 A;  4AQY E;  1FKA E;  1T4N A;  2L3J A;  2EQ1 A;  2EMB A;  2EZ6 A;  3OML A;  4P78 A;  1HNW E;  2EOF A;  3J7A G;  2NUG A;  4RH8 A;  4LFB E;  4NZV A;  3UK3 C;  2KOU A;  2CTD A;  2EPZ A;  2B7V A;  4B3M E;  2JOX A;  4JI5 E;  3F6H A;  1PJS A;  4F54 A;  2GHF A;  4WSP A;  1N34 E;  3LML A;  2YTP A;  3VYY A;  5LMU E;  2EN6 A;  4BC9 A;  2HGH A;  2VE7 C;  4DV6 E;  2YWQ A;  2EL5 A;  2V85 A;  2V87 A;  1ZBT A;  2M9A A;  2B7T A;  2ODR D;  4KZS A;  2NUE A;  2EM3 A;  4X62 E;  4DKK A;  2EN8 A;  1G2D C;  4F9C B;  2EL4 A;  4R8O A;  2YRH A;  2L8T A;  2J7J A;  2WZO A;  3ZOQ B;  1MEY C;  2JP9 A;  2LE2 A;  2L3C A;  2GPI A;  4ZYG A;  2EOE A;  2ZM6 E;  5KL7 A;  4TUI A;  2YTG A;  4Q28 A;  1ZR9 A;  3THO B;  2V8Q B;  1IBK E;  4X64 E;  2LUP B;  2HHH E;  3J80 C;  3P1X A;  3KWR A;  5A6K A;  4LFC E;  1T4L B;  2DLQ A;  4GZN C;  1PJQ A;  3DF6 A;  3C4T A;  4IJD A;  4DUZ E;  2EMG A;  1ZBQ A;  2EP3 A;  1X6H A;  5A6B D;  2EPL X;  4R2Q A;  2WBS A;  2LTS A;  2V89 A;  1B69 A;  4Q35 B;  5A6J A;  1XMO E;  2M1S A;  5KL2 A;  5KL5 A;  4R2P A;  1BBG A;  2MC5 A;  2E5L E;  2EMX A;  4O24 A;  2DGC A;  4F6N A;  1BB8 A;  2LVH A;  5A69 A;  4DR6 E;  2LRS A;  2CSH A;  2RS7 A;  1YFH A;  1UIL A;  2EPM X;  2EN7 A;  2MKN A;  1IBL E;  2EMC A;  2YTI A;  4TUG A;  2DRP A;  2FGG A;  1GZ6 A;  4X8W A;  2I9I A;  2EPK X;  4O4K A;  3EPJ A;  1AH5 A;  3OTO E;  3EPL A;  1O0W A;  3HXL A;  1TF3 A;  1N3G A;  4R2E A;  2LMZ A;  4NHR A;  2BB8 A;  3HPS A;  2ENH A;  4M0V A;  4JI8 E;  2DSY A;  4YY3 E;  2EPA A;  1BBO A;  1DQ3 A;  5A6A A;  2EOX A;  4WX9 A;  4GKJ E;  4L8N A;  1GTK A;  2E1M A;  2Q8U A;  2IHR 1;  1YYK A;  4BMJ A;  2MC6 A;  1EH6 A;  3IWC A;  1UHZ A;  2I13 A;  2JOB A;  2YU5 A;  1SR9 A;  3F6G A;  1X3C A;  4FK5 C;  2RTX A;  2UU9 E;  2MDG A;  4J8Z A;  4R2S A;  2WCC 3;  2EML A;  2EMH A;  1EH7 A;  4B3S E;  1UN6 B;  4NXN E;  2JYA A;  1F2I G;  2LO3 A;  2NAB A;  4LFA E;  2HJJ A;  3JTZ A;  2EN2 A;  5AAS A;  4WYQ B;  1YPN A;  4OX9 E;  2R76 A;  4JI7 E;  2UUB E;  4DR5 E;  2DB2 A;  2LV2 A;  4DR4 E;  2JVA A;  2YTO A;  1FJG E;  1L4S A;  4DV1 E;  3MSW A;  1QNT A;  5LL6 R;  2M4I A;  2LJU A;  2ELY A;  4R2A A;  4R03 A;  2CT1 A;  2EQ0 A;  4LF4 E;  1XMQ E;  4DV7 E;  5FLX C;  1PJT A;  4N4R B;  2YT4 A;  2DMI A;  2JY9 A;  3HPZ A;  1IQO A;  2F8B A;  1XNR E;  1PDA A;  4YHH E;  2H36 X;  2EJ4 A;  4WXC A;  2EPC A;  5KL4 A;  3KZZ A;  2UUA E;  2EM7 A;  3L00 A;  1DGC A;  2VF1 A;  4LF5 E;  2ENA A;  2N3G A;  5F3W A;  4B3R E;  4HTG A;  2VQE E;  4R2R A;  2YTQ A;  4OOG C;  1A1G A;  1WJP A;  3H09 A;  2VQF E;  4JI1 E;  1EH8 A;  2EM0 A;  3QG5 C;  1MGT A;  4F9B B;  2EM6 A;  1GQE A;  3BGH A;  2BBG A;  5AE1 A;  1AAY A;  4BC7 A;  1HNZ E;  5A2Q C;  4DV5 E;  2GLI A;  4JI4 E;  1DI2 A;  2YTN A;  2EM2 A;  2EPP A;  3C6K A;  2EOS A;  4JI2 E;  3HTX A;  1IBM E;  2EMA A;  4MLV A;  2HC5 A;  2CPN A;  1WXR A;  2JXP A;  4ZYD A;  1JK1 A;  2EE8 A;  3EPH A;  4BBY A;  3EPK A;  5ADZ A;  4BS9 A;  2EOJ A;  1XNQ E;  1QU6 A;  4JI3 E;  5DNY A;  1STU A;  2EOO A;  5AE3 A;  4X9J A;  2PRT A;  1A1H A;  2WBU A;  4DV3 E;  4DR3 E;  3RMP A;  2DIX A;  5AE2 A;  3M99 B;  2B9D A;  1A1J A;  4IS1 C;  5LMN E;  4DR1 E;  1YSA C;  2EMK A;  4RHB B;  2K7I A;  2RQL A;  2EOM A;  1N33 E;  2NUF A;  2EOR A;  2YPN A;  4WSG A;  3IWD A;  4F2J C;  1WRJ A;  2EMW A;  2EN4 A;  4WPY A;  2YRK A;  2L92 A;  2JR1 A;  2NA2 A;  4GKK E;  1ZU1 A;  4KHP E;  2YRM A;  2YU8 A;  4GEQ B;  1RQ0 A;  1IQS A;  2KHX A;  2EPU A;  4LF7 E;  2YZT A;  3TQM A;  2EMI A;  1Z1B A;  5LLQ A;  4M9V C;  2JWO A;  2YTD A;  3KZY A;  1HR0 E;  2E72 A;  3T1Y E;  2EOI A;  2V88 A;  4DR2 E;  1X49 A;  2UXD E;  2RS6 A;  5KL3 A;  4HEI A;  2EWL A;  4X65 E;  2LBS B;  4LF9 E;  2KON A;  3J7Y p;  1NCS A;  2LUQ A;  2JPA A;  2YSP A;  2N3H A;  5IT9 C;  1YUI A;  2RSI A;  3ADJ A;  2EN1 A;  3IWB A;  2LTR A;  4JI6 E;  2MDR A;  1I94 E;  4JI0 E;  2EPX A;  4DV0 E;  1X48 A;  2ADR A;  2R1F A;  2EOZ A;  2G7H A;  4BHB A;  3BID A;  1YYW A;  5IXM B;  1A1K A;  1X6E A;  2YSO A;  2L2N A;  4ZYE A;  2DLK A;  2L2K B;  2MKD A;  1G2F C;  1X5W A;  2EL6 A;  2RSM A;  1X6F A;  2VRD A;  1KJK A;  3ECR A;  2EPO A;  3LLH A;  1SFE A;  2ENC A;  5BR8 E;  3AV0 A;  1PKP A;  2LT7 A;  4O5G A;  2M7Q A;  2ELZ A;  2YTE A;  2UXC E;  4R2D A;  2F4V E;  1IMU A;  2B3T B;  3ADG A;  1P47 A;  1RMD A;  2K4V A;  1TN9 A;  5CFF E;  1J26 A;  4JV5 E;  2EM9 A;  2L33 A;  2RPC A;  2EMZ A;  2L6M A;  3JAM C;  2A25 A;  4BHC A;  1T4O A;  3THN A;  2UXB E;  2DMY A;  4M2Z A;  5TSE A;  3MHS C;  5IWA E;  1ZAA C;  4O43 A;  1N32 E;  4X66 E;  1NEI A;  4JYA E;  3VK6 A;  2EN3 A;  4DV4 E;  1J5E E;  2UUC E;  1T38 A;  2N8X A;  3J81 C;  3AUZ A;  2LJH A;  3K6Q A;  2L2M A;  3VHT B;  4WFT A;  1N36 E;  1X47 A;  2FV4 B;  4L5N C;  1RC7 A;  3BF2 A;  4LU9 A;  3JU0 A;  4DMI A;  3BBG A;  4R2C A;  1T39 A;  4MLQ A;  2EPR A;  4K0K E;  1WHN A;  1A1I A;  1YUJ A;  1A1F A;  4KWY A;  2V86 A;  2V83 A;  2ODR C;  1YYO A;  3MHH C;  2EOY A;  1JK2 A;  4M30 A; 
#chains in the Genus database with same CATH homology
 2M4I A;  1HR0 E;  4DR7 E;  3FIG A;  4NXM E;  3T1H E;  3T1Y E;  3DF6 A;  4R03 A;  2V88 A;  4BCA A;  1EKZ A;  4DR2 E;  1X49 A;  4LF8 E;  2UXD E;  2RS6 A;  3C4T A;  2EWL A;  2FTX B;  4DUZ E;  4X65 E;  2LBS B;  1YZ9 A;  4LF9 E;  2KON A;  3J7Y p;  3ADI A;  1ZBQ A;  2LUQ A;  3C4B A;  5T6J A;  4DV7 E;  5FLX C;  1XMQ E;  4LF4 E;  2N3H A;  5IT9 C;  3VYX A;  2LTS A;  2V89 A;  3ADJ A;  2YT4 A;  2JY9 A;  3DJW A;  3HPZ A;  2F8B A;  1XNR E;  1XMO E;  2M1S A;  3IWB A;  2H36 X;  2LTR A;  4YHH E;  4JI6 E;  2MDR A;  1HNX E;  4I8O A;  2MC5 A;  2E5L E;  1I94 E;  4JI0 E;  4DV0 E;  2UUA E;  1WHQ A;  4LF6 E;  3ADL A;  4DR6 E;  2LRS A;  2RS7 A;  1X48 A;  4F9A B;  4B3T E;  4GKK E;  2G7H A;  2VF1 A;  4DUY E;  4LF5 E;  1UIL A;  1YYW A;  2N3G A;  4DV2 E;  5F3W A;  4B3R E;  4LTY A;  2VQE E;  2L2N A;  4P7D A;  4OOG C;  3HQ1 A;  3H09 A;  2VQF E;  2L2K B;  4JI1 E;  1IBL E;  4AQY E;  4F9B B;  1FKA E;  1T4N A;  1GQE A;  2L3J A;  4TUG A;  5AE1 A;  2FGG A;  2RSM A;  1GZ6 A;  4X8W A;  4BC7 A;  5A2Q C;  4DV5 E;  3OML A;  4P78 A;  1HNZ E;  4JI4 E;  2EZ6 A;  1DI2 A;  1HNW E;  3J7A G;  3LLH A;  5BR8 E;  2NUG A;  4LFB E;  3AV0 A;  1PKP A;  3OTO E;  2KOU A;  4JI2 E;  3HTX A;  1O0W A;  3HXL A;  2M7Q A;  1IBM E;  2UXC E;  2F4V E;  2B7V A;  2CPN A;  2B3T B;  2JOX A;  2LMZ A;  3ADG A;  1WXR A;  4B3M E;  4JI5 E;  3F6H A;  3HPS A;  4F54 A;  4M0V A;  4BBY A;  4JI8 E;  2K4V A;  4BS9 A;  2DSY A;  5ADZ A;  4WSP A;  5CFF E;  4YY3 E;  1J26 A;  1N34 E;  1XNQ E;  1QU6 A;  3LML A;  4JV5 E;  4JI3 E;  3VYY A;  1DQ3 A;  2L33 A;  1STU A;  5DNY A;  5LMU E;  4BC9 A;  2L6M A;  3JAM C;  5AE3 A;  4GKJ E;  4L8N A;  1T4O A;  2UXB E;  2E1M A;  2IHR 1;  2DMY A;  4DV3 E;  1YYK A;  4DR3 E;  3RMP A;  2DIX A;  4M2Z A;  2VE7 C;  4BMJ A;  5AE2 A;  4DV6 E;  2B9D A;  5IWA E;  2MC6 A;  3IWC A;  1UHZ A;  5LMN E;  2V85 A;  4DR1 E;  2JOB A;  2V87 A;  1ZBT A;  1SR9 A;  1N32 E;  2B7T A;  3F6G A;  2ODR D;  4KZS A;  4X66 E;  2NUE A;  4JYA E;  3VK6 A;  4DV4 E;  1J5E E;  2UUC E;  2RTX A;  2UU9 E;  4X62 E;  1N33 E;  2NUF A;  4J8Z A;  4DKK A;  4F9C B;  3IWD A;  3J81 C;  4R8O A;  3AUZ A;  2L8T A;  2WZO A;  2LJH A;  3ZOQ B;  3K6Q A;  4WPY A;  2L2M A;  1N36 E;  4WFT A;  4B3S E;  2L92 A;  1X47 A;  2FV4 B;  2JR1 A;  2LE2 A;  2NA2 A;  4L5N C;  4NXN E;  4LFA E;  2L3C A;  1RC7 A;  4KHP E;  3JTZ A;  2ZM6 E;  5AAS A;  4GEQ B;  4LU9 A;  4TUI A;  3JU0 A;  1RQ0 A;  4Q28 A;  4WYQ B;  4DMI A;  2KHX A;  4LF7 E;  4OX9 E;  4JI7 E;  4K0K E;  2V8Q B;  1IBK E;  4X64 E;  2YZT A;  1WHN A;  4DR5 E;  2LUP B;  3J80 C;  2HHH E;  2UUB E;  2DB2 A;  3P1X A;  3KWR A;  2V86 A;  2V83 A;  2JVA A;  2ODR C;  1FJG E;  4LFC E;  1YYO A;  4DR4 E;  4DV1 E;  2JWO A;  1T4L B;  3MSW A;  4M30 A;  5LL6 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...