2V87A

Crystal structure of rag2-phd finger in complex with h3r2me2sk4me3 peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v87A01
2V89A 2V85A 2V87A 2JWOA 2V86A 2V83A 2V88A
chains in the Genus database with same CATH superfamily
2V85A 4AQYE 2EN3A 1TF6A 2DLKA 2EOYA 1PJQA 4JI7E 4TUGA 1AAYA 2EM6A 2YRKA 1IQSA 1P47A 2EOFA 2EOIA 3F6HA 4R2QA 1WHNA 4BCAA 3VHTB 4YHHE 5IT9C 2ELYA 5KL7A 1BBOA 4O5GA 5IV8B 2L3CA 4RHBB 3BBGA 4X66E 4HTGA 2L2KB 2A25A 4ZYDA 5IWAE 1A1LA 2VQEE 5ADZA 2UU9E 4DR4E 1BBGA 2YPNA 5AASA 2YT4A 1DGCA 5FLXC 3AV0A 2EN4A 1X49A 1UHZA 2EM9A 5IXMB 2WBUA 2EPMX 3THNA 3THOB 4F9BB 4DR7E 4KHPE 1BB8A 1IQOA 2BB8A 2DSYA 3IWDA 4BC7A 2UUAE 2KONA 1ZBQA 5KL3A 1G2DC 1A1IA 1YYKA 4JI2E 2LO3A 3HTXA 2CSHA 2LCEA 1YSAC 1X6HA 1N36E 2EQ3A 2EPZA 2JY9A 4TUIA 1AH5A 1ZAAC 2R76A 3IWBA 1HNXE 2EOHA 1X48A 4Q28A 1WXRA 4GZNC 2EMAA 4JYAE 2LT7A 4NHRA 1EH6A 2EN8A 2EM7A 1X47A 4R2SA 5AE1A 1A1JA 2LRSA 2EM3A 2EMKA 2VE7C 1IMUA 3MSWA 4ZYEA 5A2QC 4BC9A 4DV4E 4LTYA 1YZ9A 2G7HA 3UK3C 2EMFA 4LF9E 5AC4A 2YTGA 4P78A 2NA2A 1IBME 2EPCA 3C6KA 2F4VE 3JU0A 1A1FA 2N3GA 2EPKX 5LMNE 4FK5C 4KWYA 2UXBE 2K7IA 4X65E 4DV6E 4LFAE 3RMPA 2EQ0A 4WPYA 3J81C 2YZTA 3MHHC 3J7Yp 4M0VA 1GTKA 2KOUA 2Q8UA 2JVAA 4DV0E 1JK1A 2K4VA 1O0WA 1PKPA 4KZSA 2EMZA 2EPPA 4O24A 4X62E 4NZVA 1L4SA 4M30A 4DV5E 2JWOA 4X64E 4X8WA 2B7VA 2EOZA 2RPCA 1WRJA 3TQMA 4IS1C 2GHFA 4F2JC 1RC7A 2WCC3 5TSEA 1A1KA 4B3SE 1YYOA 1PJTA 4JV5E 1GZ6A 2ADRA 4JI8E 4JI1E 5A6BA 3C4BA 2M1SA 2EOSA 5CFFE 2EPXA 1TF3A 1XMQE 4NXNE 3MHSC 3LMLA 3ZOQB 2EMHA 2YTJA 3C6MA 1KJKA 5F3WA 2EOQA 2YTQA 2KHXA 4LF4E 3ADJA 2B7TA 2JOBA 2RS6A 3HPSA 2LBSB 1MEYC 2EPUA 2EJ4A 2V88A 3LLHA 2EOMA 1STUA 2J7JA 2MDGA 2RQLA 2H36X 5A6KA 2LJUA 3T1HE 2YTIA 1PDAA 2EL5A 2DIXA 2EN1A 3OTOE 3JAMC 1Z1BA 2MKNA 5KL5A 4F9CB 2DMIA 2B3TB 2EM0A 2EWLA 2CT1A 2EM8A 2WBSA 4OOGC 2YTFA 2L8TA 4LF8E 1DQ3A 3C4TA 2HGHA 4DUYE 1N33E 2RSMA 2YTDA 3KWRA 5AC5A 5A6JA 2V8QB 4M9VC 3J7AG 2EOEA 4LFBE 2MC5A 1N3GA 4DKKA 4LU9A 3HPZA 1MGTA 2EM2A 5T6JA 1EKZA 2D9HA 2ENHA 2M4IA 1GQEA 2LUQA 1FJGE 2EN6A 2ODRD 1EH7A 2RSIA 4IJDA 4R2DA 2V87A 2IHR1 2LE2A 2RS7A 4BHBA 4R03A 5AE3A 2VF1A 2EN2A 3EPJA 2YRMA 4LF5E 2NUFA 3ADIA 5LL6R 2EOJA 2VQFE 3FIGA 3KZYA 2M9AA 2ODRC 4BHCA 2MDRA 2PRTA 2EOXA 1XNRE 2DB2A 4DV2E 2YRHA 2YTPA 4Q35B 2EL4A 1DI2A 1YUIA 2YSPA 1X3CA 1G2FC 4WX9A 2MKDA 4WXDA 2F8BA 2EPOA 2LV2A 2YTOA 2YWQA 2EMYA 2EN7A 1KYQA 2ENAA 2MC6A 2V89A 1LLMC 2B9DA 2EPNA 3VK6A 1B69A 3DJWA 2I13A 1HNZE 4B3RE 1TN9A 4DR5E 4K0KE 3F6GA 4DR1E 3IWCA 1NCSA 2CPNA 1F2IG 1QNTA 4O4KA 1IBKE 2EPAA 1YUJA 3EPHA 4MLQA 2EMWA 5KL6A 1T4NA 5LMUE 4DR6E 1YYWA 2WZOA 4GKJE 3KZZA 4WFTA 2UXDE 3BGHA 4F6MA 2YU8A 2E1MA 2EM5A 2LMZA 1UILA 2V86A 3QG5C 3EPKA 3HXLA 2EORA 4F6NA 3T1YE 2LUPB 5LLQA 2GLIA 4GEQB 4WYQB 4JI0E 4ZYHA 2FV4B 4R2RA 4DR2E 1HR0E 4I8OA 2L3JA 3J80C 2FGGA 2VRDA 4JI6E 4X9JA 2EZ6A 1X6EA 1XMOE 4BMJA 2I9IA 2LTRA 3H09A 2DLQA 4B3ME 1HNWE 2LVHA 4NXME 2L92A 1X6FA 4B3TE 3EQ1A 1J26A 1WJPA 2JPAA 1T4LB 2UUBE 4R2AA 4BBYA 3K6QA 4LF7E 2L2MA 2EPRA 2EMXA 3JTZA 1XNQE 2UUCE 2E5LE 2L6MA 1UN6B 2L33A 2DGCA 1SFEA 4ZYGA 4GKKE 2DMYA 2UXCE 3M99B 2LJHA 3ADGA 2JR1A 1T4OA 2HHHE 2RTXA 4YY3E 4P7DA 4LF6E 2EPLX 4J8ZA 5A6AA 1N34E 1EH8A 2EMLA 1NEIA 5AE2A 2E72A 1RQ0A 2HC5A 2EE8A 4JI5E 4O43A 2R1FA 2ELZA 1I94E 2WBTA 2EMBA 3EPLA 1A1GA 4R2EA 3BF2A 2EMIA 4M2ZA 2ZM6E 2JXPA 4JI4E 4DMIA 1RMDA 1UBDC 2EQ1A 4RH8A 4WSPA 1SR9A 1ZR9A 4OX9E 1T38A 2M7QA 4DV1E 1J5EE 2EP3A 1YFHA 1T39A 2GPIA 3OMLA 4WSGA 2L2NA 4F9AB 2YTEA 2JYAA 2EMCA 2YU5A 2HJJA 3VYYA 5KL4A 3DF6A 4WXCA 1QU6A 3ADLA 2EM4A 3HQ1A 3P1XA 1WHQA 2BBGA 4JI3E 4MLVA 1A1HA 4R2PA 2ENCA 2FTXB 2YTNA 4N4RB 2LTSA 2NUGA 4R8OA 5DNYA 1PJSA 4DUZE 5A6BD 2EMGA 4L8NA 4DV3E 3AUZA 2EL6A 5BR8E 4L5NC 2CTDA 2N3HA 4F54A 2NABA 2N8XA 2YSOA 1ZBTA 3VYXA 3ECRA 2NUEA 2V83A 4R2CA 1YPNA 2DRPA 2JOXA 5KL2A 4BS9A 5A69A 4HEIA 1FKAE 4LFCE 3L00A 1X5WA 4DV7E 4DR3E 1IBLE 2JP9A 1N32E 2EOOA 3BIDA 1ZU1A 1JK2A
chains in the Genus database with same CATH topology
2M4IA 2E5LE 2UUCE 1GQEA 2L6MA 2LUQA 2V85A 4AQYE 4WPYA 3J81C 2L33A 1FJGE 2YZTA 4GKKE 3J7Yp 2DMYA 4M0VA 2ODRD 2UXCE 2KOUA 2LJHA 3ADGA 4JI7E 4TUGA 2JR1A 1T4OA 2JVAA 2HHHE 2V87A 2IHR1 2LE2A 2RS7A 2RTXA 3F6HA 4YY3E 4R03A 4P7DA 4DV0E 4LF6E 5AE3A 2K4VA 2VF1A 1O0WA 1PKPA 4J8ZA 4KZSA 1N34E 1WHNA 4BCAA 5AE2A 4X62E 1RQ0A 4LF5E 4YHHE 5IT9C 4JI5E 2NUFA 4M30A 4DV5E 3ADIA 2JWOA 5LL6R 2L3CA 4X64E 4X8WA 2VQFE 4X66E 2B7VA 3FIGA 2L2KB 1I94E 2ODRC 2MDRA 5IWAE 1XNRE 2DB2A 4DV2E 2VQEE 4M2ZA 5ADZA 2UU9E 4DR4E 1DI2A 2ZM6E 5AASA 1RC7A 2YT4A 4JI4E 4DMIA 4B3SE 2F8BA 1YYOA 5FLXC 3AV0A 4JV5E 1GZ6A 1X49A 1UHZA 4WSPA 4JI8E 2MC6A 1SR9A 4JI1E 4OX9E 2V89A 3C4BA 2M1SA 2M7QA 2B9DA 4DV1E 5CFFE 3VK6A 4F9BB 4DR7E 1J5EE 4KHPE 3DJWA 1XMQE 2DSYA 4NXNE 3IWDA 4BC7A 3OMLA 1HNZE 2L2NA 4F9AB 3LMLA 4B3RE 2UUAE 2KONA 3ZOQB 1ZBQA 4DR5E 4K0KE 3VYYA 3F6GA 4DR1E 5F3WA 3DF6A 1QU6A 3ADLA 3IWCA 1YYKA 4JI2E 2CPNA 3HTXA 3HQ1A 2KHXA 4LF4E 3P1XA 1WHQA 1IBKE 3ADJA 2B7TA 2JOBA 4JI3E 1N36E 2RS6A 3HPSA 2LBSB 2JY9A 4TUIA 1HNXE 3IWBA 2V88A 3LLHA 1T4NA 2FTXB 5LMUE 4DR6E 1YYWA 2WZOA 4GKJE 4WFTA 1STUA 2UXDE 2LTSA 1X48A 4Q28A 1WXRA 2H36X 2NUGA 4R8OA 2E1MA 2V86A 2LMZA 1UILA 4JYAE 3HXLA 3T1HE 5DNYA 4LFAE 4DUZE 3T1YE 2DIXA 2LUPB 4GEQB 4L8NA 4WYQB 4JI0E 2FV4B 3OTOE 4DV3E 3JAMC 4DR2E 1X47A 3AUZA 1HR0E 4I8OA 5AE1A 1XNQE 5BR8E 2L3JA 4L5NC 4F9CB 2LRSA 2FGGA 2VE7C 3J80C 2B3TB 2N3HA 3MSWA 4JI6E 2EWLA 5A2QC 2EZ6A 1XMOE 4F54A 4BMJA 4OOGC 3H09A 2LTRA 4BC9A 2L8TA 4DV4E 4LTYA 4B3ME 4LF8E 1ZBTA 1DQ3A 3C4TA 2NUEA 3VYXA 1HNWE 4DUYE 1YZ9A 2G7HA 2V83A 4NXME 2JOXA 1N33E 2L92A 4LF9E 2RSMA 4BS9A 3KWRA 4B3TE 4P78A 2NA2A 1FKAE 2V8QB 1IBME 3J7AG 4LFCE 1J26A 4LFBE 2F4VE 2MC5A 3JU0A 2N3GA 5LMNE 4DV7E 1T4LB 4DKKA 4DR3E 1IBLE 4LU9A 2UUBE 3HPZA 1N32E 4BBYA 2UXBE 3K6QA 4X65E 4LF7E 2L2MA 4DV6E 3JTZA 5T6JA 1EKZA 3RMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V89 A;  2V85 A;  2V87 A;  2JWO A;  2V86 A;  2V83 A;  2V88 A; 
#chains in the Genus database with same CATH topology
 2V85 A;  4AQY E;  2EN3 A;  1TF6 A;  2DLK A;  2EOY A;  1PJQ A;  4JI7 E;  4TUG A;  1AAY A;  2EM6 A;  2YRK A;  1IQS A;  1P47 A;  2EOF A;  2EOI A;  3F6H A;  4R2Q A;  1WHN A;  4BCA A;  3VHT B;  4YHH E;  5IT9 C;  2ELY A;  5KL7 A;  1BBO A;  4O5G A;  5IV8 B;  2L3C A;  4RHB B;  3BBG A;  4X66 E;  4HTG A;  2L2K B;  2A25 A;  4ZYD A;  5IWA E;  1A1L A;  2VQE E;  5ADZ A;  2UU9 E;  4DR4 E;  1BBG A;  2YPN A;  5AAS A;  2YT4 A;  1DGC A;  5FLX C;  3AV0 A;  2EN4 A;  1X49 A;  1UHZ A;  2EM9 A;  5IXM B;  2WBU A;  2EPM X;  3THN A;  3THO B;  4F9B B;  4DR7 E;  4KHP E;  1BB8 A;  1IQO A;  2BB8 A;  2DSY A;  3IWD A;  4BC7 A;  2UUA E;  2KON A;  1ZBQ A;  5KL3 A;  1G2D C;  1A1I A;  1YYK A;  4JI2 E;  2LO3 A;  3HTX A;  2CSH A;  2LCE A;  1YSA C;  1X6H A;  1N36 E;  2EQ3 A;  2EPZ A;  2JY9 A;  4TUI A;  1AH5 A;  1ZAA C;  2R76 A;  3IWB A;  1HNX E;  2EOH A;  1X48 A;  4Q28 A;  1WXR A;  4GZN C;  2EMA A;  4JYA E;  2LT7 A;  4NHR A;  1EH6 A;  2EN8 A;  2EM7 A;  1X47 A;  4R2S A;  5AE1 A;  1A1J A;  2LRS A;  2EM3 A;  2EMK A;  2VE7 C;  1IMU A;  3MSW A;  4ZYE A;  5A2Q C;  4BC9 A;  4DV4 E;  4LTY A;  1YZ9 A;  2G7H A;  3UK3 C;  2EMF A;  4LF9 E;  5AC4 A;  2YTG A;  4P78 A;  2NA2 A;  1IBM E;  2EPC A;  3C6K A;  2F4V E;  3JU0 A;  1A1F A;  2N3G A;  2EPK X;  5LMN E;  4FK5 C;  4KWY A;  2UXB E;  2K7I A;  4X65 E;  4DV6 E;  4LFA E;  3RMP A;  2EQ0 A;  4WPY A;  3J81 C;  2YZT A;  3MHH C;  3J7Y p;  4M0V A;  1GTK A;  2KOU A;  2Q8U A;  2JVA A;  4DV0 E;  1JK1 A;  2K4V A;  1O0W A;  1PKP A;  4KZS A;  2EMZ A;  2EPP A;  4O24 A;  4X62 E;  4NZV A;  1L4S A;  4M30 A;  4DV5 E;  2JWO A;  4X64 E;  4X8W A;  2B7V A;  2EOZ A;  2RPC A;  1WRJ A;  3TQM A;  4IS1 C;  2GHF A;  4F2J C;  1RC7 A;  2WCC 3;  5TSE A;  1A1K A;  4B3S E;  1YYO A;  1PJT A;  4JV5 E;  1GZ6 A;  2ADR A;  4JI8 E;  4JI1 E;  5A6B A;  3C4B A;  2M1S A;  2EOS A;  5CFF E;  2EPX A;  1TF3 A;  1XMQ E;  4NXN E;  3MHS C;  3LML A;  3ZOQ B;  2EMH A;  2YTJ A;  3C6M A;  1KJK A;  5F3W A;  2EOQ A;  2YTQ A;  2KHX A;  4LF4 E;  3ADJ A;  2B7T A;  2JOB A;  2RS6 A;  3HPS A;  2LBS B;  1MEY C;  2EPU A;  2EJ4 A;  2V88 A;  3LLH A;  2EOM A;  1STU A;  2J7J A;  2MDG A;  2RQL A;  2H36 X;  5A6K A;  2LJU A;  3T1H E;  2YTI A;  1PDA A;  2EL5 A;  2DIX A;  2EN1 A;  3OTO E;  3JAM C;  1Z1B A;  2MKN A;  5KL5 A;  4F9C B;  2DMI A;  2B3T B;  2EM0 A;  2EWL A;  2CT1 A;  2EM8 A;  2WBS A;  4OOG C;  2YTF A;  2L8T A;  4LF8 E;  1DQ3 A;  3C4T A;  2HGH A;  4DUY E;  1N33 E;  2RSM A;  2YTD A;  3KWR A;  5AC5 A;  5A6J A;  2V8Q B;  4M9V C;  3J7A G;  2EOE A;  4LFB E;  2MC5 A;  1N3G A;  4DKK A;  4LU9 A;  3HPZ A;  1MGT A;  2EM2 A;  5T6J A;  1EKZ A;  2D9H A;  2ENH A;  2M4I A;  1GQE A;  2LUQ A;  1FJG E;  2EN6 A;  2ODR D;  1EH7 A;  2RSI A;  4IJD A;  4R2D A;  2V87 A;  2IHR 1;  2LE2 A;  2RS7 A;  4BHB A;  4R03 A;  5AE3 A;  2VF1 A;  2EN2 A;  3EPJ A;  2YRM A;  4LF5 E;  2NUF A;  3ADI A;  5LL6 R;  2EOJ A;  2VQF E;  3FIG A;  3KZY A;  2M9A A;  2ODR C;  4BHC A;  2MDR A;  2PRT A;  2EOX A;  1XNR E;  2DB2 A;  4DV2 E;  2YRH A;  2YTP A;  4Q35 B;  2EL4 A;  1DI2 A;  1YUI A;  2YSP A;  1X3C A;  1G2F C;  4WX9 A;  2MKD A;  4WXD A;  2F8B A;  2EPO A;  2LV2 A;  2YTO A;  2YWQ A;  2EMY A;  2EN7 A;  1KYQ A;  2ENA A;  2MC6 A;  2V89 A;  1LLM C;  2B9D A;  2EPN A;  3VK6 A;  1B69 A;  3DJW A;  2I13 A;  1HNZ E;  4B3R E;  1TN9 A;  4DR5 E;  4K0K E;  3F6G A;  4DR1 E;  3IWC A;  1NCS A;  2CPN A;  1F2I G;  1QNT A;  4O4K A;  1IBK E;  2EPA A;  1YUJ A;  3EPH A;  4MLQ A;  2EMW A;  5KL6 A;  1T4N A;  5LMU E;  4DR6 E;  1YYW A;  2WZO A;  4GKJ E;  3KZZ A;  4WFT A;  2UXD E;  3BGH A;  4F6M A;  2YU8 A;  2E1M A;  2EM5 A;  2LMZ A;  1UIL A;  2V86 A;  3QG5 C;  3EPK A;  3HXL A;  2EOR A;  4F6N A;  3T1Y E;  2LUP B;  5LLQ A;  2GLI A;  4GEQ B;  4WYQ B;  4JI0 E;  4ZYH A;  2FV4 B;  4R2R A;  4DR2 E;  1HR0 E;  4I8O A;  2L3J A;  3J80 C;  2FGG A;  2VRD A;  4JI6 E;  4X9J A;  2EZ6 A;  1X6E A;  1XMO E;  4BMJ A;  2I9I A;  2LTR A;  3H09 A;  2DLQ A;  4B3M E;  1HNW E;  2LVH A;  4NXM E;  2L92 A;  1X6F A;  4B3T E;  3EQ1 A;  1J26 A;  1WJP A;  2JPA A;  1T4L B;  2UUB E;  4R2A A;  4BBY A;  3K6Q A;  4LF7 E;  2L2M A;  2EPR A;  2EMX A;  3JTZ A;  1XNQ E;  2UUC E;  2E5L E;  2L6M A;  1UN6 B;  2L33 A;  2DGC A;  1SFE A;  4ZYG A;  4GKK E;  2DMY A;  2UXC E;  3M99 B;  2LJH A;  3ADG A;  2JR1 A;  1T4O A;  2HHH E;  2RTX A;  4YY3 E;  4P7D A;  4LF6 E;  2EPL X;  4J8Z A;  5A6A A;  1N34 E;  1EH8 A;  2EML A;  1NEI A;  5AE2 A;  2E72 A;  1RQ0 A;  2HC5 A;  2EE8 A;  4JI5 E;  4O43 A;  2R1F A;  2ELZ A;  1I94 E;  2WBT A;  2EMB A;  3EPL A;  1A1G A;  4R2E A;  3BF2 A;  2EMI A;  4M2Z A;  2ZM6 E;  2JXP A;  4JI4 E;  4DMI A;  1RMD A;  1UBD C;  2EQ1 A;  4RH8 A;  4WSP A;  1SR9 A;  1ZR9 A;  4OX9 E;  1T38 A;  2M7Q A;  4DV1 E;  1J5E E;  2EP3 A;  1YFH A;  1T39 A;  2GPI A;  3OML A;  4WSG A;  2L2N A;  4F9A B;  2YTE A;  2JYA A;  2EMC A;  2YU5 A;  2HJJ A;  3VYY A;  5KL4 A;  3DF6 A;  4WXC A;  1QU6 A;  3ADL A;  2EM4 A;  3HQ1 A;  3P1X A;  1WHQ A;  2BBG A;  4JI3 E;  4MLV A;  1A1H A;  4R2P A;  2ENC A;  2FTX B;  2YTN A;  4N4R B;  2LTS A;  2NUG A;  4R8O A;  5DNY A;  1PJS A;  4DUZ E;  5A6B D;  2EMG A;  4L8N A;  4DV3 E;  3AUZ A;  2EL6 A;  5BR8 E;  4L5N C;  2CTD A;  2N3H A;  4F54 A;  2NAB A;  2N8X A;  2YSO A;  1ZBT A;  3VYX A;  3ECR A;  2NUE A;  2V83 A;  4R2C A;  1YPN A;  2DRP A;  2JOX A;  5KL2 A;  4BS9 A;  5A69 A;  4HEI A;  1FKA E;  4LFC E;  3L00 A;  1X5W A;  4DV7 E;  4DR3 E;  1IBL E;  2JP9 A;  1N32 E;  2EOO A;  3BID A;  1ZU1 A;  1JK2 A; 
#chains in the Genus database with same CATH homology
 2M4I A;  2E5L E;  2UUC E;  1GQE A;  2L6M A;  2LUQ A;  2V85 A;  4AQY E;  4WPY A;  3J81 C;  2L33 A;  1FJG E;  2YZT A;  4GKK E;  3J7Y p;  2DMY A;  4M0V A;  2ODR D;  2UXC E;  2KOU A;  2LJH A;  3ADG A;  4JI7 E;  4TUG A;  2JR1 A;  1T4O A;  2JVA A;  2HHH E;  2V87 A;  2IHR 1;  2LE2 A;  2RS7 A;  2RTX A;  3F6H A;  4YY3 E;  4R03 A;  4P7D A;  4DV0 E;  4LF6 E;  5AE3 A;  2K4V A;  2VF1 A;  1O0W A;  1PKP A;  4J8Z A;  4KZS A;  1N34 E;  1WHN A;  4BCA A;  5AE2 A;  4X62 E;  1RQ0 A;  4LF5 E;  4YHH E;  5IT9 C;  4JI5 E;  2NUF A;  4M30 A;  4DV5 E;  3ADI A;  2JWO A;  5LL6 R;  2L3C A;  4X64 E;  4X8W A;  2VQF E;  4X66 E;  2B7V A;  3FIG A;  2L2K B;  1I94 E;  2ODR C;  2MDR A;  5IWA E;  1XNR E;  2DB2 A;  4DV2 E;  2VQE E;  4M2Z A;  5ADZ A;  2UU9 E;  4DR4 E;  1DI2 A;  2ZM6 E;  5AAS A;  1RC7 A;  2YT4 A;  4JI4 E;  4DMI A;  4B3S E;  2F8B A;  1YYO A;  5FLX C;  3AV0 A;  4JV5 E;  1GZ6 A;  1X49 A;  1UHZ A;  4WSP A;  4JI8 E;  2MC6 A;  1SR9 A;  4JI1 E;  4OX9 E;  2V89 A;  3C4B A;  2M1S A;  2M7Q A;  2B9D A;  4DV1 E;  5CFF E;  3VK6 A;  4F9B B;  4DR7 E;  1J5E E;  4KHP E;  3DJW A;  1XMQ E;  2DSY A;  4NXN E;  3IWD A;  4BC7 A;  3OML A;  1HNZ E;  2L2N A;  4F9A B;  3LML A;  4B3R E;  2UUA E;  2KON A;  3ZOQ B;  1ZBQ A;  4DR5 E;  4K0K E;  3VYY A;  3F6G A;  4DR1 E;  5F3W A;  3DF6 A;  1QU6 A;  3ADL A;  3IWC A;  1YYK A;  4JI2 E;  2CPN A;  3HTX A;  3HQ1 A;  2KHX A;  4LF4 E;  3P1X A;  1WHQ A;  1IBK E;  3ADJ A;  2B7T A;  2JOB A;  4JI3 E;  1N36 E;  2RS6 A;  3HPS A;  2LBS B;  2JY9 A;  4TUI A;  1HNX E;  3IWB A;  2V88 A;  3LLH A;  1T4N A;  2FTX B;  5LMU E;  4DR6 E;  1YYW A;  2WZO A;  4GKJ E;  4WFT A;  1STU A;  2UXD E;  2LTS A;  1X48 A;  4Q28 A;  1WXR A;  2H36 X;  2NUG A;  4R8O A;  2E1M A;  2V86 A;  2LMZ A;  1UIL A;  4JYA E;  3HXL A;  3T1H E;  5DNY A;  4LFA E;  4DUZ E;  3T1Y E;  2DIX A;  2LUP B;  4GEQ B;  4L8N A;  4WYQ B;  4JI0 E;  2FV4 B;  3OTO E;  4DV3 E;  3JAM C;  4DR2 E;  1X47 A;  3AUZ A;  1HR0 E;  4I8O A;  5AE1 A;  1XNQ E;  5BR8 E;  2L3J A;  4L5N C;  4F9C B;  2LRS A;  2FGG A;  2VE7 C;  3J80 C;  2B3T B;  2N3H A;  3MSW A;  4JI6 E;  2EWL A;  5A2Q C;  2EZ6 A;  1XMO E;  4F54 A;  4BMJ A;  4OOG C;  3H09 A;  2LTR A;  4BC9 A;  2L8T A;  4DV4 E;  4LTY A;  4B3M E;  4LF8 E;  1ZBT A;  1DQ3 A;  3C4T A;  2NUE A;  3VYX A;  1HNW E;  4DUY E;  1YZ9 A;  2G7H A;  2V83 A;  4NXM E;  2JOX A;  1N33 E;  2L92 A;  4LF9 E;  2RSM A;  4BS9 A;  3KWR A;  4B3T E;  4P78 A;  2NA2 A;  1FKA E;  2V8Q B;  1IBM E;  3J7A G;  4LFC E;  1J26 A;  4LFB E;  2F4V E;  2MC5 A;  3JU0 A;  2N3G A;  5LMN E;  4DV7 E;  1T4L B;  4DKK A;  4DR3 E;  1IBL E;  4LU9 A;  2UUB E;  3HPZ A;  1N32 E;  4BBY A;  2UXB E;  3K6Q A;  4X65 E;  4LF7 E;  2L2M A;  4DV6 E;  3JTZ A;  5T6J A;  1EKZ A;  3RMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...