2V87A

Crystal structure of rag2-phd finger in complex with h3r2me2sk4me3 peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 15
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v87A01
2JWOA 2V89A 2V83A 2V86A 2V85A 2V88A 2V87A
chains in the Genus database with same CATH superfamily
5AE2A 2LUQA 3K6QA 2EPMX 1Z1BA 2L3JA 4JI3E 1RC7A 2UXDE 2IHR1 1IQSA 2EPLX 1FKAE 1XNRE 2UUAE 4DR3E 4AQYE 2EE8A 2A25A 1T39A 2EN6A 4F9BB 1TF3A 2YPNA 4BHCA 4RHBB 2YSPA 2EWLA 2ELZA 2F8BA 3VK6A 3F6GA 3BBGA 4ZYEA 1JK1A 4JI6E 2CPNA 1AH5A 1ZBQA 2LTRA 4J8ZA 5IT9C 4BS9A 1GZ6A 3VYYA 5F3WA 4JI4E 4MLVA 2ADRA 2KOUA 1P47A 2WBUA 1EH7A 2EOMA 4FK5C 4R2QA 2L6MA 4N4RB 2EN4A 5DNYA 1FJGE 5A6AA 2DLQA 2EMIA 1G2DC 5A2QC 4F2JC 1X48A 2EMAA 2ENAA 4BMJA 4IS1C 3JTZA 2HC5A 2LVHA 2B3TB 1WJPA 4LF7E 3IWDA 1YPNA 4DV6E 3KWRA 4WX9A 1UBDC 1ZU1A 2LV2A 4R2RA 5IWAE 1N32E 2H36X 2N8XA 5A69A 5IV8B 2EPPA 5AE1A 2N3HA 2M9AA 3J7Yp 2LJHA 1PKPA 1BBOA 1N36E 4WXCA 2EMYA 5T6JA 1JK2A 2YRMA 3F6HA 4BC7A 2V83A 2EMWA 2L2MA 2L3CA 2ZM6E 2NABA 2NUFA 5CFFE 2EOEA 1DGCA 4O43A 3J80C 2EOOA 4GKKE 1G2FC 2RSMA 4B3ME 5A6BA 1STUA 1AAYA 4WPYA 1WRJA 2EOXA 2RSIA 2EPAA 3IWBA 1IMUA 1X6HA 2E1MA 2YTDA 4M2ZA 1XMQE 2EMGA 3LMLA 2YU5A 5KL7A 4ZYDA 1I94E 4LF8E 4GZNC 3HXLA 2ENCA 3JU0A 4LF6E 4F6NA 2F4VE 2EJ4A 4LTYA 4DR1E 2YTJA 1T38A 4R2SA 1X6FA 2DB2A 4X64E 2G7HA 2YTPA 2JVAA 3ZOQB 2EOIA 1YYWA 2GLIA 2EN2A 2LJUA 3H09A 2EOZA 4BHBA 5KL3A 1GQEA 5KL2A 2I13A 4GKJE 2EOQA 2WCC3 2Q8UA 3M99B 2YTEA 5AC4A 2DSYA 1PJTA 3MHSC 2EM7A 2LRSA 4JI1E 2RS7A 2MKNA 1PJQA 5A6KA 2EOYA 2LCEA 2EOJA 4DMIA 2DMYA 2K4VA 2PRTA 1YFHA 3EPLA 2EQ3A 3MHHC 4R8OA 5LLQA 1WHNA 2M4IA 1T4LB 2KHXA 2E72A 2EMBA 2EMHA 2YWQA 1A1FA 1J5EE 2RQLA 4B3TE 1PJSA 4WSPA 2JYAA 5KL5A 3BGHA 2JOXA 3P1XA 3ADIA 2EPZA 4LF4E 2JP9A 4P7DA 1B69A 2EM0A 4DR7E 2EZ6A 4NHRA 2EPNA 2EP3A 1YUJA 4JI0E 4LFCE 3RMPA 3J81C 4GEQB 4DR5E 2V85A 2JXPA 4DV0E 2M1SA 1ZR9A 4BBYA 2YZTA 4B3SE 2EL5A 2UUBE 2WBSA 2EL6A 2R76A 2LTSA 2EMKA 1XMOE 2LE2A 1N3GA 2NUGA 2VQEE 2CSHA 2L2KB 1ZBTA 4Q35B 4LFAE 2WBTA 2VQFE 1O0WA 4DR4E 2LT7A 1TF6A 2EN3A 4YY3E 2YU8A 1T4NA 2EPOA 3HQ1A 5AC5A 2MC5A 4K0KE 3THOB 2LO3A 4F54A 4F9AB 2EQ1A 2DGCA 1KYQA 1IBLE 3J7AG 4JI5E 2EMCA 2EM3A 4DR2E 1A1GA 5A6JA 3L00A 3ADGA 2YTGA 2YTOA 4HEIA 2MKDA 2ODRC 1X3CA 1X5WA 3IWCA 1N34E 2FTXB 2L2NA 3ADJA 4LF9E 2GPIA 2L92A 4R2EA 3BF2A 1L4SA 2R1FA 2ELYA 1NEIA 2B7TA 2EMXA 4ZYGA 1HNZE 4OX9E 2MDGA 4YHHE 1PDAA 2EM6A 2UXCE 4L5NC 2EMZA 1GTKA 3T1YE 2NA2A 2UUCE 4R2PA 1RMDA 3C4BA 3LLHA 4X66E 2EOHA 2LUPB 1YZ9A 2MDRA 5LL6R 2M7QA 1XNQE 1A1IA 2WZOA 2YTIA 4X8WA 5KL6A 1TN9A 2EOSA 4MLQA 4OOGC 3UK3C 2B9DA 2DMIA 2EORA 3OMLA 3JAMC 1T4OA 2YT4A 2V8QB 3BIDA 2EN7A 4JI2E 1UN6B 2EPUA 1N33E 1X49A 5ADZA 2DLKA 1SR9A 4DUZE 4JI8E 3KZZA 4F9CB 5A6BD 1QU6A 4IJDA 4DV1E 1HNWE 2EM5A 2JOBA 4R2AA 4WFTA 4JV5E 1KJKA 4R2DA 2EPKX 1EH8A 4O5GA 4M9VC 4X62E 4DV2E 2RTXA 2VE7C 4KZSA 5LMNE 4DKKA 2EMLA 2J7JA 2JR1A 1YUIA 2YTQA 2CTDA 3AUZA 2EPCA 5BR8E 3HPZA 4I8OA 2YSOA 1IBKE 1QNTA 2LBSB 3THNA 2EL4A 2ENHA 4TUIA 1YYOA 2EM2A 1EH6A 4X65E 4NXME 2CT1A 1A1LA 4X9JA 2MC6A 4R03A 1ZAAC 2HGHA 2EMFA 4DR6E 1X6EA 4M30A 1YSAC 1A1JA 2I9IA 2V88A 5KL4A 2DRPA 2DIXA 2YRHA 1RQ0A 3ECRA 4WXDA 3DF6A 3TQMA 1X47A 4DV7E 4P78A 1DI2A 1EKZA 5LMUE 2EM4A 4DV3E 4DV5E 3T1HE 4DV4E 2K7IA 5AASA 2LMZA 4B3RE 1UHZA 3ADLA 4KHPE 1MGTA 2EPRA 2V86A 2EN1A 1DQ3A 4M0VA 2YTFA 4NZVA 4JI7E 3VHTB 3HPSA 1BB8A 2B7VA 3DJWA 2BB8A 5FLXC 2EQ0A 4LU9A 4HTGA 4BC9A 2NUEA 1MEYC 2E5LE 3VYXA 2EOFA 1F2IG 2KONA 1A1KA 4ZYHA 3EPKA 1SFEA 3EPJA 2HHHE 2RPCA 2UU9E 1WXRA 2D9HA 2YTNA 1IQOA 4O24A 3MSWA 4TUGA 1YYKA 2UXBE 2L8TA 3AV0A 5IXMB 1IBME 2VF1A 4O4KA 2HJJA 3C6MA 3EQ1A 4Q28A 1LLMC 2V87A 3C4TA 4L8NA 5AE3A 4R2CA 4KWYA 2EM8A 1J26A 2ODRD 3OTOE 4F6MA 2JPAA 2YRKA 2JWOA 1HNXE 4NXNE 1NCSA 1UILA 2EM9A 2JY9A 4BCAA 4LFBE 3KZYA 3C6KA 1BBGA 2GHFA 3EPHA 4JYAE 1WHQA 4WSGA 4DUYE 2FV4B 3HTXA 2N3GA 4RH8A 2RS6A 2L33A 1HR0E 3FIGA 5TSEA 2EPXA 2FGGA 1A1HA 2EN8A 2VRDA 4LF5E 2V89A 4WYQB 2BBGA 3QG5C
chains in the Genus database with same CATH topology
5AE2A 2LUQA 3JU0A 3K6QA 4LF6E 4DR6E 3ADGA 4M30A 2L3JA 1RC7A 4JI3E 2V88A 2UXDE 2IHR1 2F4VE 2DIXA 1FKAE 3IWCA 2ODRC 1XNRE 2UUAE 1N34E 1RQ0A 4LTYA 2FTXB 3DF6A 4DR1E 4DR3E 2L2NA 1X47A 3ADJA 4AQYE 4DV7E 4P78A 2DB2A 4X64E 1EKZA 2G7HA 4F9BB 4LF9E 1DI2A 5LMUE 2JVAA 4DV5E 4DV3E 3ZOQB 2L92A 3T1HE 1YYWA 3H09A 4DV4E 4OX9E 5AASA 2B7TA 2EWLA 2LMZA 1UHZA 1HNZE 2F8BA 3ADLA 1GQEA 4B3RE 4KHPE 3VK6A 4YHHE 2V86A 3F6GA 4GKJE 4JI6E 1DQ3A 4M0VA 2UXCE 4L5NC 2CPNA 2DSYA 4JI7E 1ZBQA 2LTRA 4J8ZA 5IT9C 2LRSA 3HPSA 4BS9A 2B7VA 1GZ6A 3VYYA 3T1YE 2NA2A 3DJWA 5FLXC 5F3WA 4JI1E 2UUCE 4JI4E 2RS7A 4LU9A 2KOUA 3C4BA 4DMIA 2DMYA 2K4VA 3LLHA 4BC9A 2NUEA 4X66E 2LUPB 1YZ9A 2E5LE 2L6MA 3VYXA 2MDRA 4R8OA 5LL6R 2M7QA 5DNYA 1FJGE 1XNQE 1WHNA 2M4IA 2KONA 1T4LB 2KHXA 2WZOA 4X8WA 1J5EE 5A2QC 2HHHE 4B3TE 4WSPA 1X48A 4OOGC 4BMJA 2UU9E 1WXRA 2JOXA 3P1XA 3JTZA 3ADIA 2B9DA 3OMLA 3JAMC 3MSWA 4LF4E 2B3TB 1T4OA 2V8QB 2YT4A 4LF7E 3IWDA 4P7DA 4DV6E 4JI2E 1N33E 4DR7E 2EZ6A 3KWRA 4TUGA 1X49A 5IWAE 1YYKA 1N32E 2H36X 5ADZA 2L8TA 4JI0E 2UXBE 1SR9A 4DUZE 4JI8E 5AE1A 2N3HA 4F9CB 3AV0A 4LFCE 3RMPA 1IBME 3J81C 1QU6A 2VF1A 4GEQB 3J7Yp 4DV1E 4DR5E 1HNWE 2JOBA 2LJHA 1PKPA 2V85A 4Q28A 4WFTA 2V87A 4DV0E 1N36E 2M1SA 4JV5E 3C4TA 4L8NA 5T6JA 4BBYA 5AE3A 3F6HA 2YZTA 4BC7A 2V83A 4B3SE 1J26A 4X62E 2UUBE 2L2MA 2L3CA 2ZM6E 2ODRD 2RTXA 2VE7C 4DV2E 2LTSA 1XMOE 2NUFA 2LE2A 4KZSA 5CFFE 3OTOE 2VQEE 4NXNE 1HNXE 2JWOA 2L2KB 1ZBTA 1UILA 4DKKA 5LMNE 4LFAE 2JY9A 4BCAA 2JR1A 3J80C 4LFBE 2VQFE 4GKKE 3AUZA 1O0WA 2RSMA 5BR8E 4B3ME 4DR4E 3HPZA 1STUA 4I8OA 4WPYA 1IBKE 4JYAE 1WHQA 4YY3E 4DUYE 2LBSB 2FV4B 3HTXA 2NUGA 3IWBA 1T4NA 2N3GA 3HQ1A 2RS6A 2L33A 1HR0E 3FIGA 2MC5A 4TUIA 1YYOA 2FGGA 4K0KE 2E1MA 4LF5E 4M2ZA 4F54A 4X65E 1XMQE 4NXME 2V89A 4F9AB 3LMLA 4WYQB 1IBLE 3J7AG 4JI5E 1I94E 2MC6A 4LF8E 4DR2E 3HXLA 4R03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWO A;  2V89 A;  2V83 A;  2V86 A;  2V85 A;  2V88 A;  2V87 A; 
#chains in the Genus database with same CATH topology
 5AE2 A;  2LUQ A;  3K6Q A;  2EPM X;  1Z1B A;  2L3J A;  4JI3 E;  1RC7 A;  2UXD E;  2IHR 1;  1IQS A;  2EPL X;  1FKA E;  1XNR E;  2UUA E;  4DR3 E;  4AQY E;  2EE8 A;  2A25 A;  1T39 A;  2EN6 A;  4F9B B;  1TF3 A;  2YPN A;  4BHC A;  4RHB B;  2YSP A;  2EWL A;  2ELZ A;  2F8B A;  3VK6 A;  3F6G A;  3BBG A;  4ZYE A;  1JK1 A;  4JI6 E;  2CPN A;  1AH5 A;  1ZBQ A;  2LTR A;  4J8Z A;  5IT9 C;  4BS9 A;  1GZ6 A;  3VYY A;  5F3W A;  4JI4 E;  4MLV A;  2ADR A;  2KOU A;  1P47 A;  2WBU A;  1EH7 A;  2EOM A;  4FK5 C;  4R2Q A;  2L6M A;  4N4R B;  2EN4 A;  5DNY A;  1FJG E;  5A6A A;  2DLQ A;  2EMI A;  1G2D C;  5A2Q C;  4F2J C;  1X48 A;  2EMA A;  2ENA A;  4BMJ A;  4IS1 C;  3JTZ A;  2HC5 A;  2LVH A;  2B3T B;  1WJP A;  4LF7 E;  3IWD A;  1YPN A;  4DV6 E;  3KWR A;  4WX9 A;  1UBD C;  1ZU1 A;  2LV2 A;  4R2R A;  5IWA E;  1N32 E;  2H36 X;  2N8X A;  5A69 A;  5IV8 B;  2EPP A;  5AE1 A;  2N3H A;  2M9A A;  3J7Y p;  2LJH A;  1PKP A;  1BBO A;  1N36 E;  4WXC A;  2EMY A;  5T6J A;  1JK2 A;  2YRM A;  3F6H A;  4BC7 A;  2V83 A;  2EMW A;  2L2M A;  2L3C A;  2ZM6 E;  2NAB A;  2NUF A;  5CFF E;  2EOE A;  1DGC A;  4O43 A;  3J80 C;  2EOO A;  4GKK E;  1G2F C;  2RSM A;  4B3M E;  5A6B A;  1STU A;  1AAY A;  4WPY A;  1WRJ A;  2EOX A;  2RSI A;  2EPA A;  3IWB A;  1IMU A;  1X6H A;  2E1M A;  2YTD A;  4M2Z A;  1XMQ E;  2EMG A;  3LML A;  2YU5 A;  5KL7 A;  4ZYD A;  1I94 E;  4LF8 E;  4GZN C;  3HXL A;  2ENC A;  3JU0 A;  4LF6 E;  4F6N A;  2F4V E;  2EJ4 A;  4LTY A;  4DR1 E;  2YTJ A;  1T38 A;  4R2S A;  1X6F A;  2DB2 A;  4X64 E;  2G7H A;  2YTP A;  2JVA A;  3ZOQ B;  2EOI A;  1YYW A;  2GLI A;  2EN2 A;  2LJU A;  3H09 A;  2EOZ A;  4BHB A;  5KL3 A;  1GQE A;  5KL2 A;  2I13 A;  4GKJ E;  2EOQ A;  2WCC 3;  2Q8U A;  3M99 B;  2YTE A;  5AC4 A;  2DSY A;  1PJT A;  3MHS C;  2EM7 A;  2LRS A;  4JI1 E;  2RS7 A;  2MKN A;  1PJQ A;  5A6K A;  2EOY A;  2LCE A;  2EOJ A;  4DMI A;  2DMY A;  2K4V A;  2PRT A;  1YFH A;  3EPL A;  2EQ3 A;  3MHH C;  4R8O A;  5LLQ A;  1WHN A;  2M4I A;  1T4L B;  2KHX A;  2E72 A;  2EMB A;  2EMH A;  2YWQ A;  1A1F A;  1J5E E;  2RQL A;  4B3T E;  1PJS A;  4WSP A;  2JYA A;  5KL5 A;  3BGH A;  2JOX A;  3P1X A;  3ADI A;  2EPZ A;  4LF4 E;  2JP9 A;  4P7D A;  1B69 A;  2EM0 A;  4DR7 E;  2EZ6 A;  4NHR A;  2EPN A;  2EP3 A;  1YUJ A;  4JI0 E;  4LFC E;  3RMP A;  3J81 C;  4GEQ B;  4DR5 E;  2V85 A;  2JXP A;  4DV0 E;  2M1S A;  1ZR9 A;  4BBY A;  2YZT A;  4B3S E;  2EL5 A;  2UUB E;  2WBS A;  2EL6 A;  2R76 A;  2LTS A;  2EMK A;  1XMO E;  2LE2 A;  1N3G A;  2NUG A;  2VQE E;  2CSH A;  2L2K B;  1ZBT A;  4Q35 B;  4LFA E;  2WBT A;  2VQF E;  1O0W A;  4DR4 E;  2LT7 A;  1TF6 A;  2EN3 A;  4YY3 E;  2YU8 A;  1T4N A;  2EPO A;  3HQ1 A;  5AC5 A;  2MC5 A;  4K0K E;  3THO B;  2LO3 A;  4F54 A;  4F9A B;  2EQ1 A;  2DGC A;  1KYQ A;  1IBL E;  3J7A G;  4JI5 E;  2EMC A;  2EM3 A;  4DR2 E;  1A1G A;  5A6J A;  3L00 A;  3ADG A;  2YTG A;  2YTO A;  4HEI A;  2MKD A;  2ODR C;  1X3C A;  1X5W A;  3IWC A;  1N34 E;  2FTX B;  2L2N A;  3ADJ A;  4LF9 E;  2GPI A;  2L92 A;  4R2E A;  3BF2 A;  1L4S A;  2R1F A;  2ELY A;  1NEI A;  2B7T A;  2EMX A;  4ZYG A;  1HNZ E;  4OX9 E;  2MDG A;  4YHH E;  1PDA A;  2EM6 A;  2UXC E;  4L5N C;  2EMZ A;  1GTK A;  3T1Y E;  2NA2 A;  2UUC E;  4R2P A;  1RMD A;  3C4B A;  3LLH A;  4X66 E;  2EOH A;  2LUP B;  1YZ9 A;  2MDR A;  5LL6 R;  2M7Q A;  1XNQ E;  1A1I A;  2WZO A;  2YTI A;  4X8W A;  5KL6 A;  1TN9 A;  2EOS A;  4MLQ A;  4OOG C;  3UK3 C;  2B9D A;  2DMI A;  2EOR A;  3OML A;  3JAM C;  1T4O A;  2YT4 A;  2V8Q B;  3BID A;  2EN7 A;  4JI2 E;  1UN6 B;  2EPU A;  1N33 E;  1X49 A;  5ADZ A;  2DLK A;  1SR9 A;  4DUZ E;  4JI8 E;  3KZZ A;  4F9C B;  5A6B D;  1QU6 A;  4IJD A;  4DV1 E;  1HNW E;  2EM5 A;  2JOB A;  4R2A A;  4WFT A;  4JV5 E;  1KJK A;  4R2D A;  2EPK X;  1EH8 A;  4O5G A;  4M9V C;  4X62 E;  4DV2 E;  2RTX A;  2VE7 C;  4KZS A;  5LMN E;  4DKK A;  2EML A;  2J7J A;  2JR1 A;  1YUI A;  2YTQ A;  2CTD A;  3AUZ A;  2EPC A;  5BR8 E;  3HPZ A;  4I8O A;  2YSO A;  1IBK E;  1QNT A;  2LBS B;  3THN A;  2EL4 A;  2ENH A;  4TUI A;  1YYO A;  2EM2 A;  1EH6 A;  4X65 E;  4NXM E;  2CT1 A;  1A1L A;  4X9J A;  2MC6 A;  4R03 A;  1ZAA C;  2HGH A;  2EMF A;  4DR6 E;  1X6E A;  4M30 A;  1YSA C;  1A1J A;  2I9I A;  2V88 A;  5KL4 A;  2DRP A;  2DIX A;  2YRH A;  1RQ0 A;  3ECR A;  4WXD A;  3DF6 A;  3TQM A;  1X47 A;  4DV7 E;  4P78 A;  1DI2 A;  1EKZ A;  5LMU E;  2EM4 A;  4DV3 E;  4DV5 E;  3T1H E;  4DV4 E;  2K7I A;  5AAS A;  2LMZ A;  4B3R E;  1UHZ A;  3ADL A;  4KHP E;  1MGT A;  2EPR A;  2V86 A;  2EN1 A;  1DQ3 A;  4M0V A;  2YTF A;  4NZV A;  4JI7 E;  3VHT B;  3HPS A;  1BB8 A;  2B7V A;  3DJW A;  2BB8 A;  5FLX C;  2EQ0 A;  4LU9 A;  4HTG A;  4BC9 A;  2NUE A;  1MEY C;  2E5L E;  3VYX A;  2EOF A;  1F2I G;  2KON A;  1A1K A;  4ZYH A;  3EPK A;  1SFE A;  3EPJ A;  2HHH E;  2RPC A;  2UU9 E;  1WXR A;  2D9H A;  2YTN A;  1IQO A;  4O24 A;  3MSW A;  4TUG A;  1YYK A;  2UXB E;  2L8T A;  3AV0 A;  5IXM B;  1IBM E;  2VF1 A;  4O4K A;  2HJJ A;  3C6M A;  3EQ1 A;  4Q28 A;  1LLM C;  2V87 A;  3C4T A;  4L8N A;  5AE3 A;  4R2C A;  4KWY A;  2EM8 A;  1J26 A;  2ODR D;  3OTO E;  4F6M A;  2JPA A;  2YRK A;  2JWO A;  1HNX E;  4NXN E;  1NCS A;  1UIL A;  2EM9 A;  2JY9 A;  4BCA A;  4LFB E;  3KZY A;  3C6K A;  1BBG A;  2GHF A;  3EPH A;  4JYA E;  1WHQ A;  4WSG A;  4DUY E;  2FV4 B;  3HTX A;  2N3G A;  4RH8 A;  2RS6 A;  2L33 A;  1HR0 E;  3FIG A;  5TSE A;  2EPX A;  2FGG A;  1A1H A;  2EN8 A;  2VRD A;  4LF5 E;  2V89 A;  4WYQ B;  2BBG A;  3QG5 C; 
#chains in the Genus database with same CATH homology
 5AE2 A;  2LUQ A;  3JU0 A;  3K6Q A;  4LF6 E;  4DR6 E;  3ADG A;  4M30 A;  2L3J A;  1RC7 A;  4JI3 E;  2V88 A;  2UXD E;  2IHR 1;  2F4V E;  2DIX A;  1FKA E;  3IWC A;  2ODR C;  1XNR E;  2UUA E;  1N34 E;  1RQ0 A;  4LTY A;  2FTX B;  3DF6 A;  4DR1 E;  4DR3 E;  2L2N A;  1X47 A;  3ADJ A;  4AQY E;  4DV7 E;  4P78 A;  2DB2 A;  4X64 E;  1EKZ A;  2G7H A;  4F9B B;  4LF9 E;  1DI2 A;  5LMU E;  2JVA A;  4DV5 E;  4DV3 E;  3ZOQ B;  2L92 A;  3T1H E;  1YYW A;  3H09 A;  4DV4 E;  4OX9 E;  5AAS A;  2B7T A;  2EWL A;  2LMZ A;  1UHZ A;  1HNZ E;  2F8B A;  3ADL A;  1GQE A;  4B3R E;  4KHP E;  3VK6 A;  4YHH E;  2V86 A;  3F6G A;  4GKJ E;  4JI6 E;  1DQ3 A;  4M0V A;  2UXC E;  4L5N C;  2CPN A;  2DSY A;  4JI7 E;  1ZBQ A;  2LTR A;  4J8Z A;  5IT9 C;  2LRS A;  3HPS A;  4BS9 A;  2B7V A;  1GZ6 A;  3VYY A;  3T1Y E;  2NA2 A;  3DJW A;  5FLX C;  5F3W A;  4JI1 E;  2UUC E;  4JI4 E;  2RS7 A;  4LU9 A;  2KOU A;  3C4B A;  4DMI A;  2DMY A;  2K4V A;  3LLH A;  4BC9 A;  2NUE A;  4X66 E;  2LUP B;  1YZ9 A;  2E5L E;  2L6M A;  3VYX A;  2MDR A;  4R8O A;  5LL6 R;  2M7Q A;  5DNY A;  1FJG E;  1XNQ E;  1WHN A;  2M4I A;  2KON A;  1T4L B;  2KHX A;  2WZO A;  4X8W A;  1J5E E;  5A2Q C;  2HHH E;  4B3T E;  4WSP A;  1X48 A;  4OOG C;  4BMJ A;  2UU9 E;  1WXR A;  2JOX A;  3P1X A;  3JTZ A;  3ADI A;  2B9D A;  3OML A;  3JAM C;  3MSW A;  4LF4 E;  2B3T B;  1T4O A;  2V8Q B;  2YT4 A;  4LF7 E;  3IWD A;  4P7D A;  4DV6 E;  4JI2 E;  1N33 E;  4DR7 E;  2EZ6 A;  3KWR A;  4TUG A;  1X49 A;  5IWA E;  1YYK A;  1N32 E;  2H36 X;  5ADZ A;  2L8T A;  4JI0 E;  2UXB E;  1SR9 A;  4DUZ E;  4JI8 E;  5AE1 A;  2N3H A;  4F9C B;  3AV0 A;  4LFC E;  3RMP A;  1IBM E;  3J81 C;  1QU6 A;  2VF1 A;  4GEQ B;  3J7Y p;  4DV1 E;  4DR5 E;  1HNW E;  2JOB A;  2LJH A;  1PKP A;  2V85 A;  4Q28 A;  4WFT A;  2V87 A;  4DV0 E;  1N36 E;  2M1S A;  4JV5 E;  3C4T A;  4L8N A;  5T6J A;  4BBY A;  5AE3 A;  3F6H A;  2YZT A;  4BC7 A;  2V83 A;  4B3S E;  1J26 A;  4X62 E;  2UUB E;  2L2M A;  2L3C A;  2ZM6 E;  2ODR D;  2RTX A;  2VE7 C;  4DV2 E;  2LTS A;  1XMO E;  2NUF A;  2LE2 A;  4KZS A;  5CFF E;  3OTO E;  2VQE E;  4NXN E;  1HNX E;  2JWO A;  2L2K B;  1ZBT A;  1UIL A;  4DKK A;  5LMN E;  4LFA E;  2JY9 A;  4BCA A;  2JR1 A;  3J80 C;  4LFB E;  2VQF E;  4GKK E;  3AUZ A;  1O0W A;  2RSM A;  5BR8 E;  4B3M E;  4DR4 E;  3HPZ A;  1STU A;  4I8O A;  4WPY A;  1IBK E;  4JYA E;  1WHQ A;  4YY3 E;  4DUY E;  2LBS B;  2FV4 B;  3HTX A;  2NUG A;  3IWB A;  1T4N A;  2N3G A;  3HQ1 A;  2RS6 A;  2L33 A;  1HR0 E;  3FIG A;  2MC5 A;  4TUI A;  1YYO A;  2FGG A;  4K0K E;  2E1M A;  4LF5 E;  4M2Z A;  4F54 A;  4X65 E;  1XMQ E;  4NXM E;  2V89 A;  4F9A B;  3LML A;  4WYQ B;  1IBL E;  3J7A G;  4JI5 E;  1I94 E;  2MC6 A;  4LF8 E;  4DR2 E;  3HXL A;  4R03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...