1X5WA

Solution structure of the c2h2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GSSGSSGHPEKCSECSYSCSSKAALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKKFHGDMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 64, isoforms 1
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13909 zf-H2C2_5 C2H2-type zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x5wA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x5wA01
2EMYA 2LT7A 1G2DC 2EP3A 3UK3C 2D9HA 2EM4A 2DLQA 2EPXA 2EPPA 2EPAA 2EOSA 1X3CA 4R2QA 2HGHA 2EMWA 4IS1C 4F6NA 1RMDA 4FK5C 2LO3A 2ENCA 2EOFA 2EN4A 2CTDA 2EOYA 2EMHA 2EN3A 1ZAAC 2EJ4A 2EOOA 2MDGA 2DGCA 1A1FA 2LCEA 1F2IG 1A1LA 2EPZA 2GHFA 2YRHA 2EMIA 2EM2A 1X6FA 1A1KA 2VRDA 2DRPA 2EM9A 2YTEA 2EQ1A 2EORA 2RPCA 2RSIA 2CSHA 1UBDC 2EMZA 4R2SA 1JK2A 1JK1A 2EOJA 1UN6B 1MEYC 2EE8A 2NABA 2YSPA 4WSGA 2EMAA 2EM5A 1X6HA 2EMBA 4R2CA 4R2AA 1A1GA 2YTQA 4R2PA 2I13A 1TN9A 2A25A 1P47A 1A1JA 2WCC3 3VHTB 3M99B 2DMIA 4GZNC 2BB8A 2EOIA 2YTOA 1BBOA 2EM3A 1A1IA 2LVHA 2ADRA 5KL6A 2YU8A 2LV2A 2YTDA 3EPJA 3MHSC 2EM7A 4R2DA 2ENAA 1A1HA 2ELZA 1AAYA 2YTIA 2EOEA 2YTNA 2EOQA 2EN8A 2YRMA 2ENHA 2EN6A 1YUIA 1TF6A 2M9AA 2R1FA 2EM0A 1NCSA 2EOXA 2MKDA 1B69A 2EM8A 1Z1BA 2EOMA 1YUJA 2YU5A 3EPLA 2EMGA 2EMFA 2YTFA 2EN1A 2YSOA 1TF3A 2YTPA 1X5WA 2J7JA 2EQ0A 2YRKA 2EMXA 1DGCA 1ZR9A 2EN7A 5KL5A 2EMLA 2EL6A 5KL4A 5KL7A 4M9VC 2YTJA 2JPAA 1YSAC 1BB8A 3EPHA 4F6MA 2EPCA 2EPRA 2EOHA 2WBUA 2YTGA 2CT1A 2E72A 1LLMC 1ZU1A 2EL4A 1WJPA 1X6EA 2EL5A 2EOZA 2WBSA 5KL2A 2EN2A 4X9JA 2EM6A 2MKNA 2GLIA 1KJKA 2PRTA 4R2RA 3EPKA 5KL3A 2EMKA 2EMCA 4IJDA 2ELYA 2DLKA 2EQ3A 1G2FC 4F2JC 2JP9A 4R2EA 2WBTA 3MHHC 2EPUA
chains in the Genus database with same CATH superfamily
2YZTA 2MC5A 2EP3A 2KONA 2EPAA 4NHRA 4KHPE 4Q35B 5FLXC 1YZ9A 1N3GA 2KHXA 4JYAE 2UXBE 4DUYE 4FK5C 4BBYA 2JOBA 2EOYA 2JXPA 1WRJA 2GHFA 3ZOQB 2LJUA 2EMIA 3ADLA 1MGTA 2UUCE 2RPCA 1XMOE 4M0VA 2L92A 4R2SA 2FV4B 4LFCE 3C4TA 1GQEA 4JI3E 4BCAA 2LTSA 2EE8A 2HC5A 4JI8E 2EMAA 4GEQB 2RQLA 4R2AA 1A1GA 4NXME 4JI2E 2LUQA 3TQMA 4LF8E 4BC7A 1P47A 1HNWE 4JI7E 2YPNA 3C6KA 2L3JA 4B3TE 4LF4E 4JI4E 3M99B 2E1MA 3THOB 4DKKA 4DV4E 4O5GA 4DR4E 1BBOA 1A1IA 2LVHA 4WPYA 5KL6A 2Q8UA 4L8NA 3F6GA 2F8BA 5IT9C 1L4SA 2RSMA 1XMQE 1AAYA 2YTIA 2YTNA 1T4OA 2YRMA 4YHHE 1TF6A 2M9AA 4DV6E 1RQ0A 3ADIA 1B69A 2YTFA 1HNXE 2YTPA 2CPNA 2UUAE 1X5WA 2EQ0A 2YRKA 4P7DA 3MSWA 5AE1A 4LF7E 5KL5A 5LMNE 2M4IA 2EMLA 4DV5E 2WZOA 4O4KA 2JPAA 3OMLA 2CT1A 2E72A 1XNQE 3HQ1A 2LBSB 2EOZA 2DB2A 2EL5A 4GKKE 3P1XA 5AE2A 4R2RA 3EPKA 4IJDA 4JI6E 2DLKA 4F2JC 4M2ZA 2ZM6E 1GTKA 3MHHC 2EMYA 1G2DC 1N34E 3UK3C 4DV7E 2EPXA 4DR3E 2EOSA 4DR1E 2VF1A 1X3CA 4X65E 2EMWA 2UXDE 3HPZA 3HPSA 1FKAE 1PKPA 4Q28A 2LO3A 2ENCA 1UILA 3JU0A 5A6JA 2V87A 2EMHA 2EJ4A 2EOOA 2MDGA 1A1FA 4R03A 2RS6A 2L2NA 4DR7E 2EM2A 3ADJA 1IQSA 1X6FA 2GPIA 2EM9A 2V8QB 2RSIA 2DSYA 1YYWA 1JK2A 2DMYA 1JK1A 1IBLE 4MLQA 1PDAA 4ZYGA 2NABA 2RS7A 3AV0A 2L2MA 5A6BD 3IWBA 2EM5A 4OOGC 1J26A 1NEIA 2EPMX 2I13A 1AH5A 4X66E 1TN9A 2A25A 5T6JA 3VK6A 2BBGA 2EOIA 2NUFA 4X62E 2YTOA 4BC9A 4ZYHA 5BR8E 2F4VE 5A6KA 2L3CA 4ZYDA 3EPJA 1HR0E 2EM7A 4BMJA 1T39A 2ENAA 5A6BA 3IWCA 1N36E 2B7TA 2EOEA 2JR1A 5A2QC 3H09A 2DIXA 4BHBA 2EOXA 2YU5A 2EMGA 2EMFA 4WFTA 2N3GA 3ADGA 2EN1A 1ZBQA 2YSOA 4LU9A 2I9IA 2H36X 2J7JA 2KOUA 2EMXA 4TUGA 3K6QA 1SFEA 1IBKE 2EN7A 3ECRA 2K7IA 2EPNA 4RHBB 5KL4A 4M9VC 1YSAC 2HHHE 1BB8A 3EPHA 2EOHA 4BHCA 2YTGA 1LLMC 4F9AB 1X6EA 2WBSA 2B3TB 5KL2A 4X9JA 2EM6A 2R76A 2GLIA 2MDRA 2FGGA 5KL3A 2EMKA 1YYOA 2EQ3A 3KZZA 5DNYA 1G2FC 2JP9A 4WXDA 1STUA 4R2EA 3AUZA 5LMUE 2M7QA 2EPUA 1T4NA 4AQYE 4NXNE 2LT7A 2V83A 2EM4A 2DLQA 2EPPA 1ZBTA 2B9DA 1GZ6A 2JY9A 2L6MA 2JOXA 4LF6E 1EH8A 2V89A 5AC5A 3VYYA 4F9BB 4O24A 4YY3E 2LRSA 2DGCA 4DMIA 4F9CB 1O0WA 2LCEA 2JVAA 1F2IG 4JI5E 1A1LA 5ADZA 2EZ6A 3VYXA 4WXCA 4KZSA 2VRDA 2DRPA 5AE3A 3JTZA 2CSHA 2EMZA 4ZYEA 1MEYC 3KZYA 4LF5E 1T38A 4WSGA 2NA2A 5A6AA 1X6HA 2EMBA 4R2PA 2JWOA 1QNTA 2EPKX 3T1YE 4JV5E 3LMLA 4L5NC 2L33A 2EPLX 1PJTA 4DV2E 5AASA 4GZNC 2UXCE 2BB8A 2EPOA 3BF2A 1PJQA 2ADRA 4DR2E 3J80C 2YU8A 5IWAE 3MHSC 4B3SE 4LTYA 2YT4A 1EH6A 4GKJE 1YYKA 2EOQA 2EN8A 4TUIA 1YUIA 1N33E 2JYAA 1WXRA 2EM0A 1DQ3A 3DJWA 2M1SA 3EPLA 2ODRC 4MLVA 3F6HA 1TF3A 1N32E 2VQFE 3KWRA 1IQOA 3T1HE 1ZR9A 4DV1E 1X48A 1IBME 2EL6A 4J8ZA 5CFFE 1FJGE 2EPCA 2EPRA 2WBUA 2N3HA 4WYQB 2EL4A 4RH8A 2EN2A 2VQEE 3JAMC 5A69A 2PRTA 1HNZE 4LFAE 2EMCA 1WHQA 2K4VA 4OX9E 2LTRA 2LE2A 4R2QA 3J81C 1UHZA 2NUGA 2D9HA 3HXLA 2HGHA 4IS1C 4B3RE 1EH7A 2L8TA 2L2KB 3C6MA 1PJSA 4F6NA 1RMDA 2EOFA 2EN4A 2FTXB 2CTDA 3THNA 4I8OA 4JI1E 5LLQA 2EN3A 3J7Yp 1ZAAC 1SR9A 4P78A 2UU9E 2EPZA 1YFHA 2HJJA 2YRHA 2G7HA 1X47A 2LMZA 1A1KA 2YTEA 2EQ1A 2EORA 1UBDC 4WX9A 2ODRD 2EOJA 1UN6B 2MC6A 5AC4A 2IHR1 2YSPA 3LLHA 4KWYA 2E5LE 4DV0E 4R2CA 4F54A 4X64E 2YTQA 4DV3E 1IMUA 1DI2A 4M30A 4HTGA 3HTXA 1T4LB 1A1JA 2WCC3 3VHTB 3FIGA 4DUZE 4LF9E 3OTOE 2DMIA 1RC7A 1I94E 2EM3A 2V86A 2LV2A 2YTDA 2UUBE 3IWDA 4R2DA 4O43A 1A1HA 4B3ME 1QU6A 2ELZA 2V88A 3EQ1A 2NUEA 3DF6A 5F3WA 4NZVA 3BIDA 4K0KE 5LL6R 2ENHA 1X49A 2EN6A 2EWLA 2R1FA 1NCSA 2N8XA 2YWQA 2MKDA 2EM8A 1Z1BA 2EOMA 1YUJA 3QG5C 3BGHA 1J5EE 4R8OA 3J7AG 5IXMB 4BS9A 1DGCA 1EKZA 2V85A 2VE7C 2LJHA 3L00A 3C4BA 5TSEA 4N4RB 5KL7A 2B7VA 3RMPA 2YTJA 3BBGA 4F6MA 1WHNA 4LFBE 1ZU1A 2LUPB 1WJPA 4X8WA 2RTXA 4HEIA 2MKNA 4JI0E 1XNRE 1KJKA 5IV8B 4DR6E 1KYQA 2ELYA 1BBGA 1YPNA 4DR5E 2WBTA 4WSPA
chains in the Genus database with same CATH topology
2EMYA 2LT7A 1G2DC 2EP3A 3UK3C 2D9HA 2EM4A 2DLQA 2EPXA 2EPPA 2EPAA 2EOSA 1X3CA 4R2QA 2HGHA 2EMWA 4IS1C 4F6NA 1RMDA 4FK5C 2LO3A 2ENCA 2EOFA 2EN4A 2CTDA 2EOYA 2EMHA 2EN3A 1ZAAC 2EJ4A 2EOOA 2MDGA 2DGCA 1A1FA 2LCEA 1F2IG 1A1LA 2EPZA 2GHFA 2YRHA 2EMIA 2EM2A 1X6FA 1A1KA 2VRDA 2DRPA 2EM9A 2YTEA 2EQ1A 2EORA 2RPCA 2RSIA 2CSHA 1UBDC 2EMZA 4R2SA 1JK2A 1JK1A 2EOJA 1UN6B 1MEYC 2EE8A 2NABA 2YSPA 4WSGA 2EMAA 2EM5A 1X6HA 2EMBA 4R2CA 4R2AA 1A1GA 2YTQA 4R2PA 2I13A 1TN9A 2A25A 1P47A 1A1JA 2WCC3 3VHTB 3M99B 2DMIA 4GZNC 2BB8A 2EOIA 2YTOA 1BBOA 2EM3A 1A1IA 2LVHA 2ADRA 5KL6A 2YU8A 2LV2A 2YTDA 3EPJA 3MHSC 2EM7A 4R2DA 2ENAA 1A1HA 2ELZA 1AAYA 2YTIA 2EOEA 2YTNA 2EOQA 2EN8A 2YRMA 2ENHA 2EN6A 1YUIA 1TF6A 2M9AA 2R1FA 2EM0A 1NCSA 2EOXA 2MKDA 1B69A 2EM8A 1Z1BA 2EOMA 1YUJA 2YU5A 3EPLA 2EMGA 2EMFA 2YTFA 2EN1A 2YSOA 1TF3A 2YTPA 1X5WA 2J7JA 2EQ0A 2YRKA 2EMXA 1DGCA 1ZR9A 2EN7A 5KL5A 2EMLA 2EL6A 5KL4A 5KL7A 4M9VC 2YTJA 2JPAA 1YSAC 1BB8A 3EPHA 4F6MA 2EPCA 2EPRA 2EOHA 2WBUA 2YTGA 2CT1A 2E72A 1LLMC 1ZU1A 2EL4A 1WJPA 1X6EA 2EL5A 2EOZA 2WBSA 5KL2A 2EN2A 4X9JA 2EM6A 2MKNA 2GLIA 1KJKA 2PRTA 4R2RA 3EPKA 5KL3A 2EMKA 2EMCA 4IJDA 2ELYA 2DLKA 2EQ3A 1G2FC 4F2JC 2JP9A 4R2EA 2WBTA 3MHHC 2EPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMY A;  2LT7 A;  1G2D C;  2EP3 A;  3UK3 C;  2D9H A;  2EM4 A;  2DLQ A;  2EPX A;  2EPP A;  2EPA A;  2EOS A;  1X3C A;  4R2Q A;  2HGH A;  2EMW A;  4IS1 C;  4F6N A;  1RMD A;  4FK5 C;  2LO3 A;  2ENC A;  2EOF A;  2EN4 A;  2CTD A;  2EOY A;  2EMH A;  2EN3 A;  1ZAA C;  2EJ4 A;  2EOO A;  2MDG A;  2DGC A;  1A1F A;  2LCE A;  1F2I G;  1A1L A;  2EPZ A;  2GHF A;  2YRH A;  2EMI A;  2EM2 A;  1X6F A;  1A1K A;  2VRD A;  2DRP A;  2EM9 A;  2YTE A;  2EQ1 A;  2EOR A;  2RPC A;  2RSI A;  2CSH A;  1UBD C;  2EMZ A;  4R2S A;  1JK2 A;  1JK1 A;  2EOJ A;  1UN6 B;  1MEY C;  2EE8 A;  2NAB A;  2YSP A;  4WSG A;  2EMA A;  2EM5 A;  1X6H A;  2EMB A;  4R2C A;  4R2A A;  1A1G A;  2YTQ A;  4R2P A;  2I13 A;  1TN9 A;  2A25 A;  1P47 A;  1A1J A;  2WCC 3;  3VHT B;  3M99 B;  2DMI A;  4GZN C;  2BB8 A;  2EOI A;  2YTO A;  1BBO A;  2EM3 A;  1A1I A;  2LVH A;  2ADR A;  5KL6 A;  2YU8 A;  2LV2 A;  2YTD A;  3EPJ A;  3MHS C;  2EM7 A;  4R2D A;  2ENA A;  1A1H A;  2ELZ A;  1AAY A;  2YTI A;  2EOE A;  2YTN A;  2EOQ A;  2EN8 A;  2YRM A;  2ENH A;  2EN6 A;  1YUI A;  1TF6 A;  2M9A A;  2R1F A;  2EM0 A;  1NCS A;  2EOX A;  2MKD A;  1B69 A;  2EM8 A;  1Z1B A;  2EOM A;  1YUJ A;  2YU5 A;  3EPL A;  2EMG A;  2EMF A;  2YTF A;  2EN1 A;  2YSO A;  1TF3 A;  2YTP A;  1X5W A;  2J7J A;  2EQ0 A;  2YRK A;  2EMX A;  1DGC A;  1ZR9 A;  2EN7 A;  5KL5 A;  2EML A;  2EL6 A;  5KL4 A;  5KL7 A;  4M9V C;  2YTJ A;  2JPA A;  1YSA C;  1BB8 A;  3EPH A;  4F6M A;  2EPC A;  2EPR A;  2EOH A;  2WBU A;  2YTG A;  2CT1 A;  2E72 A;  1LLM C;  1ZU1 A;  2EL4 A;  1WJP A;  1X6E A;  2EL5 A;  2EOZ A;  2WBS A;  5KL2 A;  2EN2 A;  4X9J A;  2EM6 A;  2MKN A;  2GLI A;  1KJK A;  2PRT A;  4R2R A;  3EPK A;  5KL3 A;  2EMK A;  2EMC A;  4IJD A;  2ELY A;  2DLK A;  2EQ3 A;  1G2F C;  4F2J C;  2JP9 A;  4R2E A;  2WBT A;  3MHH C;  2EPU A; 
#chains in the Genus database with same CATH topology
 2YZT A;  2MC5 A;  2EP3 A;  2KON A;  2EPA A;  4NHR A;  4KHP E;  4Q35 B;  5FLX C;  1YZ9 A;  1N3G A;  2KHX A;  4JYA E;  2UXB E;  4DUY E;  4FK5 C;  4BBY A;  2JOB A;  2EOY A;  2JXP A;  1WRJ A;  2GHF A;  3ZOQ B;  2LJU A;  2EMI A;  3ADL A;  1MGT A;  2UUC E;  2RPC A;  1XMO E;  4M0V A;  2L92 A;  4R2S A;  2FV4 B;  4LFC E;  3C4T A;  1GQE A;  4JI3 E;  4BCA A;  2LTS A;  2EE8 A;  2HC5 A;  4JI8 E;  2EMA A;  4GEQ B;  2RQL A;  4R2A A;  1A1G A;  4NXM E;  4JI2 E;  2LUQ A;  3TQM A;  4LF8 E;  4BC7 A;  1P47 A;  1HNW E;  4JI7 E;  2YPN A;  3C6K A;  2L3J A;  4B3T E;  4LF4 E;  4JI4 E;  3M99 B;  2E1M A;  3THO B;  4DKK A;  4DV4 E;  4O5G A;  4DR4 E;  1BBO A;  1A1I A;  2LVH A;  4WPY A;  5KL6 A;  2Q8U A;  4L8N A;  3F6G A;  2F8B A;  5IT9 C;  1L4S A;  2RSM A;  1XMQ E;  1AAY A;  2YTI A;  2YTN A;  1T4O A;  2YRM A;  4YHH E;  1TF6 A;  2M9A A;  4DV6 E;  1RQ0 A;  3ADI A;  1B69 A;  2YTF A;  1HNX E;  2YTP A;  2CPN A;  2UUA E;  1X5W A;  2EQ0 A;  2YRK A;  4P7D A;  3MSW A;  5AE1 A;  4LF7 E;  5KL5 A;  5LMN E;  2M4I A;  2EML A;  4DV5 E;  2WZO A;  4O4K A;  2JPA A;  3OML A;  2CT1 A;  2E72 A;  1XNQ E;  3HQ1 A;  2LBS B;  2EOZ A;  2DB2 A;  2EL5 A;  4GKK E;  3P1X A;  5AE2 A;  4R2R A;  3EPK A;  4IJD A;  4JI6 E;  2DLK A;  4F2J C;  4M2Z A;  2ZM6 E;  1GTK A;  3MHH C;  2EMY A;  1G2D C;  1N34 E;  3UK3 C;  4DV7 E;  2EPX A;  4DR3 E;  2EOS A;  4DR1 E;  2VF1 A;  1X3C A;  4X65 E;  2EMW A;  2UXD E;  3HPZ A;  3HPS A;  1FKA E;  1PKP A;  4Q28 A;  2LO3 A;  2ENC A;  1UIL A;  3JU0 A;  5A6J A;  2V87 A;  2EMH A;  2EJ4 A;  2EOO A;  2MDG A;  1A1F A;  4R03 A;  2RS6 A;  2L2N A;  4DR7 E;  2EM2 A;  3ADJ A;  1IQS A;  1X6F A;  2GPI A;  2EM9 A;  2V8Q B;  2RSI A;  2DSY A;  1YYW A;  1JK2 A;  2DMY A;  1JK1 A;  1IBL E;  4MLQ A;  1PDA A;  4ZYG A;  2NAB A;  2RS7 A;  3AV0 A;  2L2M A;  5A6B D;  3IWB A;  2EM5 A;  4OOG C;  1J26 A;  1NEI A;  2EPM X;  2I13 A;  1AH5 A;  4X66 E;  1TN9 A;  2A25 A;  5T6J A;  3VK6 A;  2BBG A;  2EOI A;  2NUF A;  4X62 E;  2YTO A;  4BC9 A;  4ZYH A;  5BR8 E;  2F4V E;  5A6K A;  2L3C A;  4ZYD A;  3EPJ A;  1HR0 E;  2EM7 A;  4BMJ A;  1T39 A;  2ENA A;  5A6B A;  3IWC A;  1N36 E;  2B7T A;  2EOE A;  2JR1 A;  5A2Q C;  3H09 A;  2DIX A;  4BHB A;  2EOX A;  2YU5 A;  2EMG A;  2EMF A;  4WFT A;  2N3G A;  3ADG A;  2EN1 A;  1ZBQ A;  2YSO A;  4LU9 A;  2I9I A;  2H36 X;  2J7J A;  2KOU A;  2EMX A;  4TUG A;  3K6Q A;  1SFE A;  1IBK E;  2EN7 A;  3ECR A;  2K7I A;  2EPN A;  4RHB B;  5KL4 A;  4M9V C;  1YSA C;  2HHH E;  1BB8 A;  3EPH A;  2EOH A;  4BHC A;  2YTG A;  1LLM C;  4F9A B;  1X6E A;  2WBS A;  2B3T B;  5KL2 A;  4X9J A;  2EM6 A;  2R76 A;  2GLI A;  2MDR A;  2FGG A;  5KL3 A;  2EMK A;  1YYO A;  2EQ3 A;  3KZZ A;  5DNY A;  1G2F C;  2JP9 A;  4WXD A;  1STU A;  4R2E A;  3AUZ A;  5LMU E;  2M7Q A;  2EPU A;  1T4N A;  4AQY E;  4NXN E;  2LT7 A;  2V83 A;  2EM4 A;  2DLQ A;  2EPP A;  1ZBT A;  2B9D A;  1GZ6 A;  2JY9 A;  2L6M A;  2JOX A;  4LF6 E;  1EH8 A;  2V89 A;  5AC5 A;  3VYY A;  4F9B B;  4O24 A;  4YY3 E;  2LRS A;  2DGC A;  4DMI A;  4F9C B;  1O0W A;  2LCE A;  2JVA A;  1F2I G;  4JI5 E;  1A1L A;  5ADZ A;  2EZ6 A;  3VYX A;  4WXC A;  4KZS A;  2VRD A;  2DRP A;  5AE3 A;  3JTZ A;  2CSH A;  2EMZ A;  4ZYE A;  1MEY C;  3KZY A;  4LF5 E;  1T38 A;  4WSG A;  2NA2 A;  5A6A A;  1X6H A;  2EMB A;  4R2P A;  2JWO A;  1QNT A;  2EPK X;  3T1Y E;  4JV5 E;  3LML A;  4L5N C;  2L33 A;  2EPL X;  1PJT A;  4DV2 E;  5AAS A;  4GZN C;  2UXC E;  2BB8 A;  2EPO A;  3BF2 A;  1PJQ A;  2ADR A;  4DR2 E;  3J80 C;  2YU8 A;  5IWA E;  3MHS C;  4B3S E;  4LTY A;  2YT4 A;  1EH6 A;  4GKJ E;  1YYK A;  2EOQ A;  2EN8 A;  4TUI A;  1YUI A;  1N33 E;  2JYA A;  1WXR A;  2EM0 A;  1DQ3 A;  3DJW A;  2M1S A;  3EPL A;  2ODR C;  4MLV A;  3F6H A;  1TF3 A;  1N32 E;  2VQF E;  3KWR A;  1IQO A;  3T1H E;  1ZR9 A;  4DV1 E;  1X48 A;  1IBM E;  2EL6 A;  4J8Z A;  5CFF E;  1FJG E;  2EPC A;  2EPR A;  2WBU A;  2N3H A;  4WYQ B;  2EL4 A;  4RH8 A;  2EN2 A;  2VQE E;  3JAM C;  5A69 A;  2PRT A;  1HNZ E;  4LFA E;  2EMC A;  1WHQ A;  2K4V A;  4OX9 E;  2LTR A;  2LE2 A;  4R2Q A;  3J81 C;  1UHZ A;  2NUG A;  2D9H A;  3HXL A;  2HGH A;  4IS1 C;  4B3R E;  1EH7 A;  2L8T A;  2L2K B;  3C6M A;  1PJS A;  4F6N A;  1RMD A;  2EOF A;  2EN4 A;  2FTX B;  2CTD A;  3THN A;  4I8O A;  4JI1 E;  5LLQ A;  2EN3 A;  3J7Y p;  1ZAA C;  1SR9 A;  4P78 A;  2UU9 E;  2EPZ A;  1YFH A;  2HJJ A;  2YRH A;  2G7H A;  1X47 A;  2LMZ A;  1A1K A;  2YTE A;  2EQ1 A;  2EOR A;  1UBD C;  4WX9 A;  2ODR D;  2EOJ A;  1UN6 B;  2MC6 A;  5AC4 A;  2IHR 1;  2YSP A;  3LLH A;  4KWY A;  2E5L E;  4DV0 E;  4R2C A;  4F54 A;  4X64 E;  2YTQ A;  4DV3 E;  1IMU A;  1DI2 A;  4M30 A;  4HTG A;  3HTX A;  1T4L B;  1A1J A;  2WCC 3;  3VHT B;  3FIG A;  4DUZ E;  4LF9 E;  3OTO E;  2DMI A;  1RC7 A;  1I94 E;  2EM3 A;  2V86 A;  2LV2 A;  2YTD A;  2UUB E;  3IWD A;  4R2D A;  4O43 A;  1A1H A;  4B3M E;  1QU6 A;  2ELZ A;  2V88 A;  3EQ1 A;  2NUE A;  3DF6 A;  5F3W A;  4NZV A;  3BID A;  4K0K E;  5LL6 R;  2ENH A;  1X49 A;  2EN6 A;  2EWL A;  2R1F A;  1NCS A;  2N8X A;  2YWQ A;  2MKD A;  2EM8 A;  1Z1B A;  2EOM A;  1YUJ A;  3QG5 C;  3BGH A;  1J5E E;  4R8O A;  3J7A G;  5IXM B;  4BS9 A;  1DGC A;  1EKZ A;  2V85 A;  2VE7 C;  2LJH A;  3L00 A;  3C4B A;  5TSE A;  4N4R B;  5KL7 A;  2B7V A;  3RMP A;  2YTJ A;  3BBG A;  4F6M A;  1WHN A;  4LFB E;  1ZU1 A;  2LUP B;  1WJP A;  4X8W A;  2RTX A;  4HEI A;  2MKN A;  4JI0 E;  1XNR E;  1KJK A;  5IV8 B;  4DR6 E;  1KYQ A;  2ELY A;  1BBG A;  1YPN A;  4DR5 E;  2WBT A;  4WSP A; 
#chains in the Genus database with same CATH homology
 2EMY A;  2LT7 A;  1G2D C;  2EP3 A;  3UK3 C;  2D9H A;  2EM4 A;  2DLQ A;  2EPX A;  2EPP A;  2EPA A;  2EOS A;  1X3C A;  4R2Q A;  2HGH A;  2EMW A;  4IS1 C;  4F6N A;  1RMD A;  4FK5 C;  2LO3 A;  2ENC A;  2EOF A;  2EN4 A;  2CTD A;  2EOY A;  2EMH A;  2EN3 A;  1ZAA C;  2EJ4 A;  2EOO A;  2MDG A;  2DGC A;  1A1F A;  2LCE A;  1F2I G;  1A1L A;  2EPZ A;  2GHF A;  2YRH A;  2EMI A;  2EM2 A;  1X6F A;  1A1K A;  2VRD A;  2DRP A;  2EM9 A;  2YTE A;  2EQ1 A;  2EOR A;  2RPC A;  2RSI A;  2CSH A;  1UBD C;  2EMZ A;  4R2S A;  1JK2 A;  1JK1 A;  2EOJ A;  1UN6 B;  1MEY C;  2EE8 A;  2NAB A;  2YSP A;  4WSG A;  2EMA A;  2EM5 A;  1X6H A;  2EMB A;  4R2C A;  4R2A A;  1A1G A;  2YTQ A;  4R2P A;  2I13 A;  1TN9 A;  2A25 A;  1P47 A;  1A1J A;  2WCC 3;  3VHT B;  3M99 B;  2DMI A;  4GZN C;  2BB8 A;  2EOI A;  2YTO A;  1BBO A;  2EM3 A;  1A1I A;  2LVH A;  2ADR A;  5KL6 A;  2YU8 A;  2LV2 A;  2YTD A;  3EPJ A;  3MHS C;  2EM7 A;  4R2D A;  2ENA A;  1A1H A;  2ELZ A;  1AAY A;  2YTI A;  2EOE A;  2YTN A;  2EOQ A;  2EN8 A;  2YRM A;  2ENH A;  2EN6 A;  1YUI A;  1TF6 A;  2M9A A;  2R1F A;  2EM0 A;  1NCS A;  2EOX A;  2MKD A;  1B69 A;  2EM8 A;  1Z1B A;  2EOM A;  1YUJ A;  2YU5 A;  3EPL A;  2EMG A;  2EMF A;  2YTF A;  2EN1 A;  2YSO A;  1TF3 A;  2YTP A;  1X5W A;  2J7J A;  2EQ0 A;  2YRK A;  2EMX A;  1DGC A;  1ZR9 A;  2EN7 A;  5KL5 A;  2EML A;  2EL6 A;  5KL4 A;  5KL7 A;  4M9V C;  2YTJ A;  2JPA A;  1YSA C;  1BB8 A;  3EPH A;  4F6M A;  2EPC A;  2EPR A;  2EOH A;  2WBU A;  2YTG A;  2CT1 A;  2E72 A;  1LLM C;  1ZU1 A;  2EL4 A;  1WJP A;  1X6E A;  2EL5 A;  2EOZ A;  2WBS A;  5KL2 A;  2EN2 A;  4X9J A;  2EM6 A;  2MKN A;  2GLI A;  1KJK A;  2PRT A;  4R2R A;  3EPK A;  5KL3 A;  2EMK A;  2EMC A;  4IJD A;  2ELY A;  2DLK A;  2EQ3 A;  1G2F C;  4F2J C;  2JP9 A;  4R2E A;  2WBT A;  3MHH C;  2EPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...