1X5WA

Solution structure of the c2h2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GSSGSSGHPEKCSECSYSCSSKAALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKKFHGDMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 64, isoforms 1
publication title Solution structure of the C2H2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
rcsb
source organism Homo sapiens
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13909 zf-H2C2_5 C2H2-type zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x5wA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x5wA01
2CSHA 2DGCA 2YTNA 2YTQA 5KL5A 2EM9A 2GLIA 1A1HA 2EMKA 2YTFA 2EMCA 2CT1A 2LV2A 2EOFA 2EL5A 1A1IA 2DLKA 2YTJA 4FK5C 1Z1BA 2EOIA 4IS1C 2YU5A 2EOSA 1B69A 2EPCA 1X3CA 3EPHA 2EE8A 4R2RA 2EMFA 2M9AA 2ENAA 4R2EA 1A1LA 2WBSA 1A1KA 2EOQA 2LVHA 1F2IG 1JK1A 5KL7A 4F2JC 3M99B 2EOJA 2EN8A 2EOMA 2CTDA 2EOEA 2EMZA 2YTEA 2PRTA 1TF3A 4WSGA 4R2CA 3VHTB 1A1GA 1WJPA 1LLMC 1X6EA 2MDGA 1AAYA 2EMXA 1X6HA 2EQ0A 2YU8A 3MHHC 2YRMA 2EQ3A 4F6MA 1DGCA 1NCSA 4R2AA 2MKNA 2EMAA 4X9JA 2ELYA 2BB8A 5KL6A 2YRHA 2MKDA 2EPAA 2E72A 2NABA 2A25A 2EMGA 1YSAC 2YRKA 2LCEA 2EMBA 4R2DA 2WBUA 4F6NA 1G2FC 4GZNC 2EJ4A 1YUJA 2EN7A 2YSPA 2EPPA 1A1FA 2EPXA 2EORA 2EN4A 2EN6A 2WCC3 1TN9A 2ADRA 1JK2A 1MEYC 2EN3A 2EP3A 3UK3C 1P47A 2DRPA 2EN2A 2EL4A 2EQ1A 2DLQA 1X6FA 5KL4A 2YTDA 2ELZA 2EOHA 2VRDA 1BBOA 3EPJA 2RSIA 1UBDC 2YTPA 2EOYA 2LO3A 2EM3A 2EOOA 1ZR9A 2ENHA 2EPZA 2LT7A 1A1JA 2JP9A 2JPAA 2EMHA 2YTGA 2ENCA 2EOZA 2I13A 2EOXA 1ZAAC 2EM6A 2GHFA 2RPCA 2EMIA 2YTIA 2YTOA 1KJKA 2EM4A 4R2PA 2EN1A 4M9VC 5KL3A 3EPLA 2EM5A 2EMWA 2EM0A 1YUIA 2EPRA 4R2QA 5KL2A 4IJDA 2EM8A 2R1FA 1RMDA 2D9HA 2DMIA 2EL6A 2EMLA 2YSOA 2EM2A 4R2SA 3MHSC 1G2DC 1UN6B 2EPUA 1X5WA 1TF6A 2EM7A 3EPKA 1BB8A 2EMYA 2HGHA 2WBTA 2J7JA 1ZU1A
chains in the Genus database with same CATH superfamily
3J80C 5KL5A 5IWAE 4DV6E 2EMCA 1STUA 2CT1A 2EL5A 1T38A 1A1IA 5BR8E 3ADLA 3VK6A 2UUCE 5AE1A 1HNXE 2EOSA 1B69A 2EPLX 3EPHA 2EE8A 2V87A 2NUEA 2ZM6E 2M9AA 2ENAA 1SR9A 1A1LA 2G7HA 2LVHA 3DJWA 5KL7A 4LF9E 2PRTA 2LJHA 4JI6E 2L33A 1LLMC 2EQ0A 4LFCE 3MHHC 5AASA 4LFAE 1NCSA 2VF1A 3BIDA 2M4IA 4J8ZA 2N3HA 4JI8E 1N36E 1FKAE 3LMLA 2BB8A 2MKDA 1X48A 2A25A 5AC5A 3C6MA 2LUQA 2KONA 2EMBA 4GZNC 3J7AG 2LTSA 4DKKA 1TN9A 4ZYEA 2RS7A 2V85A 2B7TA 2V86A 2RSMA 1IQSA 2EL4A 4LTYA 4M0VA 1YYOA 1J5EE 5KL4A 4JI4E 4BCAA 4RHBB 2MDRA 2VRDA 3DF6A 5A6BD 1UBDC 4LF8E 1ZR9A 2ENHA 2JP9A 4DV2E 3C4BA 2I13A 2NA2A 4LF5E 2EPMX 4BHCA 1PKPA 2EM6A 2YTOA 2EN1A 4M9VC 2EM5A 4YHHE 1T39A 1BBGA 1PJTA 1WXRA 2DIXA 4IJDA 2B9DA 2EL6A 2EMLA 3RMPA 5A6AA 3VYYA 3FIGA 4X66E 2EMYA 3JU0A 2DB2A 1ZU1A 2LE2A 4WSPA 1A1HA 2LV2A 2I9IA 1IMUA 1EH7A 4I8OA 4FK5C 1GTKA 2E1MA 2EWLA 4M2ZA 4OOGC 4IS1C 2N8XA 4O5GA 2V8QB 5AC4A 2RQLA 2JVAA 2HC5A 5ADZA 4DV0E 2UXCE 1A1KA 3KWRA 2WZOA 3QG5C 1JK1A 2K7IA 2EOJA 2VE7C 4KHPE 5A6JA 2CTDA 1XNQE 3BF2A 3MSWA 2YTEA 2RTXA 1X49A 1GZ6A 5A6BA 2JWOA 1A1GA 2LUPB 2L3CA 1KYQA 1WJPA 5A6KA 4TUIA 1X6EA 2MDGA 4DR3E 4BS9A 2YRMA 4O4KA 4L5NC 4B3ME 2ELYA 2RS6A 1IBME 4DUYE 4F9BB 4O43A 2E5LE 1WHNA 2L6MA 2NABA 1YSAC 2YPNA 1O0WA 2R76A 3BGHA 4JV5E 1HNWE 2UXBE 2LCEA 4GKKE 4P7DA 5AE3A 2CPNA 4R2DA 1RC7A 1G2FC 4JI7E 2EJ4A 5IT9C 2EN7A 2JXPA 1PJQA 2EORA 2EN4A 2ADRA 5LLQA 1MGTA 3L00A 2EN3A 1MEYC 1YYWA 2B7VA 2EP3A 2MC6A 4WX9A 1DI2A 4GKJE 2M7QA 3BBGA 1BBOA 5IXMB 2EOYA 2EM3A 4BMJA 5A2QC 3IWDA 4AQYE 2YTGA 3IWBA 4Q35B 2UUBE 5LL6R 2EMIA 2EM4A 4R2PA 5KL3A 4LU9A 5IV8B 2LJUA 2EPRA 2EPKX 5KL2A 5FLXC 2EM8A 2VQEE 4F9CB 5TSEA 3MHSC 4R2SA 1UN6B 4LFBE 2EPUA 1X5WA 1TF6A 1RQ0A 3EPKA 3JTZA 4X62E 2WBTA 2V83A 2J7JA 2YU5A 2MKNA 3F6HA 2DGCA 2YTNA 3HXLA 2YTQA 2EM9A 1ZBTA 4K0KE 2EMKA 2YTFA 4DMIA 3K6QA 4R8OA 2EOIA 2UU9E 4R03A 3F6GA 2EPCA 1X3CA 4DV5E 4DR1E 4R2RA 2EMFA 4R2EA 2EPOA 3THOB 1XMOE 1F2IG 2GPIA 4JI0E 3M99B 2EN8A 2EOMA 2V89A 1WHQA 2FV4B 1N32E 1EH6A 2EMZA 2K4VA 1N33E 1TF3A 4WSGA 4BHBA 4N4RB 4WXCA 1YPNA 1AAYA 2HHHE 3IWCA 2YU8A 1YZ9A 2JY9A 1QNTA 2EQ3A 4F6MA 4F54A 2L3JA 4BC9A 4TUGA 1SFEA 4HTGA 5KL6A 3ADIA 2E72A 4O24A 2UUAE 1N3GA 3ADGA 4NZVA 2WBUA 4F6NA 3LLHA 4GEQB 1XMQE 1PDAA 1IBLE 2YSPA 2EPPA 2BBGA 1T4OA 2EN6A 4F9AB 2WCC3 4WFTA 1P47A 2V88A 2EN2A 4WYQB 2KHXA 4LF6E 2DLQA 5AE2A 4DR4E 1X47A 2YTDA 2ELZA 4DR5E 5LMUE 3EPJA 2RSIA 3TQMA 2YTPA 2EOOA 1T4LB 2M1SA 2LT7A 4B3SE 2HJJA 2JPAA 1IQOA 4KWYA 3ZOQB 4JI1E 2RPCA 4JYAE 2FTXB 1KJKA 3HPSA 4DV1E 3EPLA 4DV7E 3AV0A 2EMWA 1YUIA 4R2QA 1UHZA 2YT4A 1G2DC 2LRSA 2KOUA 4ZYHA 4NHRA 3AUZA 2HGHA 2IHR1 1ZBQA 2L2NA 2CSHA 5F3WA 3ECRA 3OMLA 2MC5A 1HR0E 4YY3E 2GLIA 2F4VE 2FGGA 4BC7A 4WPYA 2NUGA 2EOFA 2DLKA 2YTJA 4B3RE 1Z1BA 1QU6A 2YWQA 4MLVA 1UILA 5CFFE 2L92A 2ODRC 2Q8UA 4MLQA 3C6KA 3HPZA 1AH5A 4L8NA 3KZYA 2WBSA 2EOQA 4ZYGA 1I94E 4JI3E 4F2JC 2NUFA 4OX9E 4DR2E 2EOEA 2JOXA 3KZZA 4R2CA 4WXDA 2DMYA 3VHTB 2YZTA 4DV3E 3H09A 1WRJA 4LF7E 2EMXA 1X6HA 1DQ3A 1J26A 1DGCA 1YYKA 4R2AA 2L2MA 2EMAA 4NXNE 3J7Yp 4X9JA 3T1HE 3VYXA 2N3GA 2YRHA 4JI2E 2EPAA 2EMGA 1IBKE 4X64E 4NXME 2YRKA 4RH8A 4BBYA 2EPNA 4Q28A 5A69A 1YUJA 1N34E 4LF4E 2L2KB 4DUZE 2LBSB 2EPXA 4X65E 3T1YE 1A1FA 4DR7E 2H36X 2EZ6A 1JK2A 3HTXA 2B3TB 3UK3C 4DV4E 2DRPA 4X8WA 2EQ1A 4B3TE 1X6FA 2EOHA 4JI5E 3C4TA 2DSYA 2LO3A 3THNA 3OTOE 2UXDE 2L8TA 1YFHA 1NEIA 2EPZA 1A1JA 5LMNE 4ZYDA 1GQEA 2EMHA 2LTRA 2ENCA 2EOZA 3HQ1A 4P78A 2EOXA 4HEIA 1ZAAC 2GHFA 2YTIA 1EKZA 2LMZA 3EQ1A 4DR6E 4KZSA 5DNYA 3JAMC 2EM0A 1PJSA 3P1XA 3J81C 2ODRD 1FJGE 1XNRE 2VQFE 2R1FA 1RMDA 2D9HA 2DMIA 2YSOA 2EM2A 1T4NA 1HNZE 2JYAA 5T6JA 1EH8A 2EM7A 2JOBA 3ADJA 2F8BA 1BB8A 1L4SA 4M30A 2JR1A
chains in the Genus database with same CATH topology
2CSHA 2DGCA 2YTNA 2YTQA 5KL5A 2EM9A 2GLIA 1A1HA 2EMKA 2YTFA 2EMCA 2CT1A 2LV2A 2EOFA 2EL5A 1A1IA 2DLKA 2YTJA 4FK5C 1Z1BA 2EOIA 4IS1C 2YU5A 2EOSA 1B69A 2EPCA 1X3CA 3EPHA 2EE8A 4R2RA 2EMFA 2M9AA 2ENAA 4R2EA 1A1LA 2WBSA 1A1KA 2EOQA 2LVHA 1F2IG 1JK1A 5KL7A 4F2JC 3M99B 2EOJA 2EN8A 2EOMA 2CTDA 2EOEA 2EMZA 2YTEA 2PRTA 1TF3A 4WSGA 4R2CA 3VHTB 1A1GA 1WJPA 1LLMC 1X6EA 2MDGA 1AAYA 2EMXA 1X6HA 2EQ0A 2YU8A 3MHHC 2YRMA 2EQ3A 4F6MA 1DGCA 1NCSA 4R2AA 2MKNA 2EMAA 4X9JA 2ELYA 2BB8A 5KL6A 2YRHA 2MKDA 2EPAA 2E72A 2NABA 2A25A 2EMGA 1YSAC 2YRKA 2LCEA 2EMBA 4R2DA 2WBUA 4F6NA 1G2FC 4GZNC 2EJ4A 1YUJA 2EN7A 2YSPA 2EPPA 1A1FA 2EPXA 2EORA 2EN4A 2EN6A 2WCC3 1TN9A 2ADRA 1JK2A 1MEYC 2EN3A 2EP3A 3UK3C 1P47A 2DRPA 2EN2A 2EL4A 2EQ1A 2DLQA 1X6FA 5KL4A 2YTDA 2ELZA 2EOHA 2VRDA 1BBOA 3EPJA 2RSIA 1UBDC 2YTPA 2EOYA 2LO3A 2EM3A 2EOOA 1ZR9A 2ENHA 2EPZA 2LT7A 1A1JA 2JP9A 2JPAA 2EMHA 2YTGA 2ENCA 2EOZA 2I13A 2EOXA 1ZAAC 2EM6A 2GHFA 2RPCA 2EMIA 2YTIA 2YTOA 1KJKA 2EM4A 4R2PA 2EN1A 4M9VC 5KL3A 3EPLA 2EM5A 2EMWA 2EM0A 1YUIA 2EPRA 4R2QA 5KL2A 4IJDA 2EM8A 2R1FA 1RMDA 2D9HA 2DMIA 2EL6A 2EMLA 2YSOA 2EM2A 4R2SA 3MHSC 1G2DC 1UN6B 2EPUA 1X5WA 1TF6A 2EM7A 3EPKA 1BB8A 2EMYA 2HGHA 2WBTA 2J7JA 1ZU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSH A;  2DGC A;  2YTN A;  2YTQ A;  5KL5 A;  2EM9 A;  2GLI A;  1A1H A;  2EMK A;  2YTF A;  2EMC A;  2CT1 A;  2LV2 A;  2EOF A;  2EL5 A;  1A1I A;  2DLK A;  2YTJ A;  4FK5 C;  1Z1B A;  2EOI A;  4IS1 C;  2YU5 A;  2EOS A;  1B69 A;  2EPC A;  1X3C A;  3EPH A;  2EE8 A;  4R2R A;  2EMF A;  2M9A A;  2ENA A;  4R2E A;  1A1L A;  2WBS A;  1A1K A;  2EOQ A;  2LVH A;  1F2I G;  1JK1 A;  5KL7 A;  4F2J C;  3M99 B;  2EOJ A;  2EN8 A;  2EOM A;  2CTD A;  2EOE A;  2EMZ A;  2YTE A;  2PRT A;  1TF3 A;  4WSG A;  4R2C A;  3VHT B;  1A1G A;  1WJP A;  1LLM C;  1X6E A;  2MDG A;  1AAY A;  2EMX A;  1X6H A;  2EQ0 A;  2YU8 A;  3MHH C;  2YRM A;  2EQ3 A;  4F6M A;  1DGC A;  1NCS A;  4R2A A;  2MKN A;  2EMA A;  4X9J A;  2ELY A;  2BB8 A;  5KL6 A;  2YRH A;  2MKD A;  2EPA A;  2E72 A;  2NAB A;  2A25 A;  2EMG A;  1YSA C;  2YRK A;  2LCE A;  2EMB A;  4R2D A;  2WBU A;  4F6N A;  1G2F C;  4GZN C;  2EJ4 A;  1YUJ A;  2EN7 A;  2YSP A;  2EPP A;  1A1F A;  2EPX A;  2EOR A;  2EN4 A;  2EN6 A;  2WCC 3;  1TN9 A;  2ADR A;  1JK2 A;  1MEY C;  2EN3 A;  2EP3 A;  3UK3 C;  1P47 A;  2DRP A;  2EN2 A;  2EL4 A;  2EQ1 A;  2DLQ A;  1X6F A;  5KL4 A;  2YTD A;  2ELZ A;  2EOH A;  2VRD A;  1BBO A;  3EPJ A;  2RSI A;  1UBD C;  2YTP A;  2EOY A;  2LO3 A;  2EM3 A;  2EOO A;  1ZR9 A;  2ENH A;  2EPZ A;  2LT7 A;  1A1J A;  2JP9 A;  2JPA A;  2EMH A;  2YTG A;  2ENC A;  2EOZ A;  2I13 A;  2EOX A;  1ZAA C;  2EM6 A;  2GHF A;  2RPC A;  2EMI A;  2YTI A;  2YTO A;  1KJK A;  2EM4 A;  4R2P A;  2EN1 A;  4M9V C;  5KL3 A;  3EPL A;  2EM5 A;  2EMW A;  2EM0 A;  1YUI A;  2EPR A;  4R2Q A;  5KL2 A;  4IJD A;  2EM8 A;  2R1F A;  1RMD A;  2D9H A;  2DMI A;  2EL6 A;  2EML A;  2YSO A;  2EM2 A;  4R2S A;  3MHS C;  1G2D C;  1UN6 B;  2EPU A;  1X5W A;  1TF6 A;  2EM7 A;  3EPK A;  1BB8 A;  2EMY A;  2HGH A;  2WBT A;  2J7J A;  1ZU1 A; 
#chains in the Genus database with same CATH topology
 3J80 C;  5KL5 A;  5IWA E;  4DV6 E;  2EMC A;  1STU A;  2CT1 A;  2EL5 A;  1T38 A;  1A1I A;  5BR8 E;  3ADL A;  3VK6 A;  2UUC E;  5AE1 A;  1HNX E;  2EOS A;  1B69 A;  2EPL X;  3EPH A;  2EE8 A;  2V87 A;  2NUE A;  2ZM6 E;  2M9A A;  2ENA A;  1SR9 A;  1A1L A;  2G7H A;  2LVH A;  3DJW A;  5KL7 A;  4LF9 E;  2PRT A;  2LJH A;  4JI6 E;  2L33 A;  1LLM C;  2EQ0 A;  4LFC E;  3MHH C;  5AAS A;  4LFA E;  1NCS A;  2VF1 A;  3BID A;  2M4I A;  4J8Z A;  2N3H A;  4JI8 E;  1N36 E;  1FKA E;  3LML A;  2BB8 A;  2MKD A;  1X48 A;  2A25 A;  5AC5 A;  3C6M A;  2LUQ A;  2KON A;  2EMB A;  4GZN C;  3J7A G;  2LTS A;  4DKK A;  1TN9 A;  4ZYE A;  2RS7 A;  2V85 A;  2B7T A;  2V86 A;  2RSM A;  1IQS A;  2EL4 A;  4LTY A;  4M0V A;  1YYO A;  1J5E E;  5KL4 A;  4JI4 E;  4BCA A;  4RHB B;  2MDR A;  2VRD A;  3DF6 A;  5A6B D;  1UBD C;  4LF8 E;  1ZR9 A;  2ENH A;  2JP9 A;  4DV2 E;  3C4B A;  2I13 A;  2NA2 A;  4LF5 E;  2EPM X;  4BHC A;  1PKP A;  2EM6 A;  2YTO A;  2EN1 A;  4M9V C;  2EM5 A;  4YHH E;  1T39 A;  1BBG A;  1PJT A;  1WXR A;  2DIX A;  4IJD A;  2B9D A;  2EL6 A;  2EML A;  3RMP A;  5A6A A;  3VYY A;  3FIG A;  4X66 E;  2EMY A;  3JU0 A;  2DB2 A;  1ZU1 A;  2LE2 A;  4WSP A;  1A1H A;  2LV2 A;  2I9I A;  1IMU A;  1EH7 A;  4I8O A;  4FK5 C;  1GTK A;  2E1M A;  2EWL A;  4M2Z A;  4OOG C;  4IS1 C;  2N8X A;  4O5G A;  2V8Q B;  5AC4 A;  2RQL A;  2JVA A;  2HC5 A;  5ADZ A;  4DV0 E;  2UXC E;  1A1K A;  3KWR A;  2WZO A;  3QG5 C;  1JK1 A;  2K7I A;  2EOJ A;  2VE7 C;  4KHP E;  5A6J A;  2CTD A;  1XNQ E;  3BF2 A;  3MSW A;  2YTE A;  2RTX A;  1X49 A;  1GZ6 A;  5A6B A;  2JWO A;  1A1G A;  2LUP B;  2L3C A;  1KYQ A;  1WJP A;  5A6K A;  4TUI A;  1X6E A;  2MDG A;  4DR3 E;  4BS9 A;  2YRM A;  4O4K A;  4L5N C;  4B3M E;  2ELY A;  2RS6 A;  1IBM E;  4DUY E;  4F9B B;  4O43 A;  2E5L E;  1WHN A;  2L6M A;  2NAB A;  1YSA C;  2YPN A;  1O0W A;  2R76 A;  3BGH A;  4JV5 E;  1HNW E;  2UXB E;  2LCE A;  4GKK E;  4P7D A;  5AE3 A;  2CPN A;  4R2D A;  1RC7 A;  1G2F C;  4JI7 E;  2EJ4 A;  5IT9 C;  2EN7 A;  2JXP A;  1PJQ A;  2EOR A;  2EN4 A;  2ADR A;  5LLQ A;  1MGT A;  3L00 A;  2EN3 A;  1MEY C;  1YYW A;  2B7V A;  2EP3 A;  2MC6 A;  4WX9 A;  1DI2 A;  4GKJ E;  2M7Q A;  3BBG A;  1BBO A;  5IXM B;  2EOY A;  2EM3 A;  4BMJ A;  5A2Q C;  3IWD A;  4AQY E;  2YTG A;  3IWB A;  4Q35 B;  2UUB E;  5LL6 R;  2EMI A;  2EM4 A;  4R2P A;  5KL3 A;  4LU9 A;  5IV8 B;  2LJU A;  2EPR A;  2EPK X;  5KL2 A;  5FLX C;  2EM8 A;  2VQE E;  4F9C B;  5TSE A;  3MHS C;  4R2S A;  1UN6 B;  4LFB E;  2EPU A;  1X5W A;  1TF6 A;  1RQ0 A;  3EPK A;  3JTZ A;  4X62 E;  2WBT A;  2V83 A;  2J7J A;  2YU5 A;  2MKN A;  3F6H A;  2DGC A;  2YTN A;  3HXL A;  2YTQ A;  2EM9 A;  1ZBT A;  4K0K E;  2EMK A;  2YTF A;  4DMI A;  3K6Q A;  4R8O A;  2EOI A;  2UU9 E;  4R03 A;  3F6G A;  2EPC A;  1X3C A;  4DV5 E;  4DR1 E;  4R2R A;  2EMF A;  4R2E A;  2EPO A;  3THO B;  1XMO E;  1F2I G;  2GPI A;  4JI0 E;  3M99 B;  2EN8 A;  2EOM A;  2V89 A;  1WHQ A;  2FV4 B;  1N32 E;  1EH6 A;  2EMZ A;  2K4V A;  1N33 E;  1TF3 A;  4WSG A;  4BHB A;  4N4R B;  4WXC A;  1YPN A;  1AAY A;  2HHH E;  3IWC A;  2YU8 A;  1YZ9 A;  2JY9 A;  1QNT A;  2EQ3 A;  4F6M A;  4F54 A;  2L3J A;  4BC9 A;  4TUG A;  1SFE A;  4HTG A;  5KL6 A;  3ADI A;  2E72 A;  4O24 A;  2UUA E;  1N3G A;  3ADG A;  4NZV A;  2WBU A;  4F6N A;  3LLH A;  4GEQ B;  1XMQ E;  1PDA A;  1IBL E;  2YSP A;  2EPP A;  2BBG A;  1T4O A;  2EN6 A;  4F9A B;  2WCC 3;  4WFT A;  1P47 A;  2V88 A;  2EN2 A;  4WYQ B;  2KHX A;  4LF6 E;  2DLQ A;  5AE2 A;  4DR4 E;  1X47 A;  2YTD A;  2ELZ A;  4DR5 E;  5LMU E;  3EPJ A;  2RSI A;  3TQM A;  2YTP A;  2EOO A;  1T4L B;  2M1S A;  2LT7 A;  4B3S E;  2HJJ A;  2JPA A;  1IQO A;  4KWY A;  3ZOQ B;  4JI1 E;  2RPC A;  4JYA E;  2FTX B;  1KJK A;  3HPS A;  4DV1 E;  3EPL A;  4DV7 E;  3AV0 A;  2EMW A;  1YUI A;  4R2Q A;  1UHZ A;  2YT4 A;  1G2D C;  2LRS A;  2KOU A;  4ZYH A;  4NHR A;  3AUZ A;  2HGH A;  2IHR 1;  1ZBQ A;  2L2N A;  2CSH A;  5F3W A;  3ECR A;  3OML A;  2MC5 A;  1HR0 E;  4YY3 E;  2GLI A;  2F4V E;  2FGG A;  4BC7 A;  4WPY A;  2NUG A;  2EOF A;  2DLK A;  2YTJ A;  4B3R E;  1Z1B A;  1QU6 A;  2YWQ A;  4MLV A;  1UIL A;  5CFF E;  2L92 A;  2ODR C;  2Q8U A;  4MLQ A;  3C6K A;  3HPZ A;  1AH5 A;  4L8N A;  3KZY A;  2WBS A;  2EOQ A;  4ZYG A;  1I94 E;  4JI3 E;  4F2J C;  2NUF A;  4OX9 E;  4DR2 E;  2EOE A;  2JOX A;  3KZZ A;  4R2C A;  4WXD A;  2DMY A;  3VHT B;  2YZT A;  4DV3 E;  3H09 A;  1WRJ A;  4LF7 E;  2EMX A;  1X6H A;  1DQ3 A;  1J26 A;  1DGC A;  1YYK A;  4R2A A;  2L2M A;  2EMA A;  4NXN E;  3J7Y p;  4X9J A;  3T1H E;  3VYX A;  2N3G A;  2YRH A;  4JI2 E;  2EPA A;  2EMG A;  1IBK E;  4X64 E;  4NXM E;  2YRK A;  4RH8 A;  4BBY A;  2EPN A;  4Q28 A;  5A69 A;  1YUJ A;  1N34 E;  4LF4 E;  2L2K B;  4DUZ E;  2LBS B;  2EPX A;  4X65 E;  3T1Y E;  1A1F A;  4DR7 E;  2H36 X;  2EZ6 A;  1JK2 A;  3HTX A;  2B3T B;  3UK3 C;  4DV4 E;  2DRP A;  4X8W A;  2EQ1 A;  4B3T E;  1X6F A;  2EOH A;  4JI5 E;  3C4T A;  2DSY A;  2LO3 A;  3THN A;  3OTO E;  2UXD E;  2L8T A;  1YFH A;  1NEI A;  2EPZ A;  1A1J A;  5LMN E;  4ZYD A;  1GQE A;  2EMH A;  2LTR A;  2ENC A;  2EOZ A;  3HQ1 A;  4P78 A;  2EOX A;  4HEI A;  1ZAA C;  2GHF A;  2YTI A;  1EKZ A;  2LMZ A;  3EQ1 A;  4DR6 E;  4KZS A;  5DNY A;  3JAM C;  2EM0 A;  1PJS A;  3P1X A;  3J81 C;  2ODR D;  1FJG E;  1XNR E;  2VQF E;  2R1F A;  1RMD A;  2D9H A;  2DMI A;  2YSO A;  2EM2 A;  1T4N A;  1HNZ E;  2JYA A;  5T6J A;  1EH8 A;  2EM7 A;  2JOB A;  3ADJ A;  2F8B A;  1BB8 A;  1L4S A;  4M30 A;  2JR1 A; 
#chains in the Genus database with same CATH homology
 2CSH A;  2DGC A;  2YTN A;  2YTQ A;  5KL5 A;  2EM9 A;  2GLI A;  1A1H A;  2EMK A;  2YTF A;  2EMC A;  2CT1 A;  2LV2 A;  2EOF A;  2EL5 A;  1A1I A;  2DLK A;  2YTJ A;  4FK5 C;  1Z1B A;  2EOI A;  4IS1 C;  2YU5 A;  2EOS A;  1B69 A;  2EPC A;  1X3C A;  3EPH A;  2EE8 A;  4R2R A;  2EMF A;  2M9A A;  2ENA A;  4R2E A;  1A1L A;  2WBS A;  1A1K A;  2EOQ A;  2LVH A;  1F2I G;  1JK1 A;  5KL7 A;  4F2J C;  3M99 B;  2EOJ A;  2EN8 A;  2EOM A;  2CTD A;  2EOE A;  2EMZ A;  2YTE A;  2PRT A;  1TF3 A;  4WSG A;  4R2C A;  3VHT B;  1A1G A;  1WJP A;  1LLM C;  1X6E A;  2MDG A;  1AAY A;  2EMX A;  1X6H A;  2EQ0 A;  2YU8 A;  3MHH C;  2YRM A;  2EQ3 A;  4F6M A;  1DGC A;  1NCS A;  4R2A A;  2MKN A;  2EMA A;  4X9J A;  2ELY A;  2BB8 A;  5KL6 A;  2YRH A;  2MKD A;  2EPA A;  2E72 A;  2NAB A;  2A25 A;  2EMG A;  1YSA C;  2YRK A;  2LCE A;  2EMB A;  4R2D A;  2WBU A;  4F6N A;  1G2F C;  4GZN C;  2EJ4 A;  1YUJ A;  2EN7 A;  2YSP A;  2EPP A;  1A1F A;  2EPX A;  2EOR A;  2EN4 A;  2EN6 A;  2WCC 3;  1TN9 A;  2ADR A;  1JK2 A;  1MEY C;  2EN3 A;  2EP3 A;  3UK3 C;  1P47 A;  2DRP A;  2EN2 A;  2EL4 A;  2EQ1 A;  2DLQ A;  1X6F A;  5KL4 A;  2YTD A;  2ELZ A;  2EOH A;  2VRD A;  1BBO A;  3EPJ A;  2RSI A;  1UBD C;  2YTP A;  2EOY A;  2LO3 A;  2EM3 A;  2EOO A;  1ZR9 A;  2ENH A;  2EPZ A;  2LT7 A;  1A1J A;  2JP9 A;  2JPA A;  2EMH A;  2YTG A;  2ENC A;  2EOZ A;  2I13 A;  2EOX A;  1ZAA C;  2EM6 A;  2GHF A;  2RPC A;  2EMI A;  2YTI A;  2YTO A;  1KJK A;  2EM4 A;  4R2P A;  2EN1 A;  4M9V C;  5KL3 A;  3EPL A;  2EM5 A;  2EMW A;  2EM0 A;  1YUI A;  2EPR A;  4R2Q A;  5KL2 A;  4IJD A;  2EM8 A;  2R1F A;  1RMD A;  2D9H A;  2DMI A;  2EL6 A;  2EML A;  2YSO A;  2EM2 A;  4R2S A;  3MHS C;  1G2D C;  1UN6 B;  2EPU A;  1X5W A;  1TF6 A;  2EM7 A;  3EPK A;  1BB8 A;  2EMY A;  2HGH A;  2WBT A;  2J7J A;  1ZU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...