1X5WA

Solution structure of the c2h2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GSSGSSGHPEKCSECSYSCSSKAALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKKFHGDMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 64, isoforms 1
publication title Solution structure of the C2H2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13909 zf-H2C2_5 C2H2-type zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x5wA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x5wA01
2CT1A 2EMLA 2EQ3A 2DLQA 1JK2A 2DGCA 2YRHA 2YTNA 1YUJA 2HGHA 1A1LA 2CTDA 4FK5C 2LT7A 2EPPA 1X6FA 2BB8A 2WCC3 1LLMC 1ZU1A 2EN6A 2M9AA 2EMIA 1Z1BA 3EPLA 1G2DC 5KL3A 2EOJA 2LVHA 2J7JA 4R2DA 4GZNC 2EPXA 2YSPA 3EPHA 4R2AA 2EE8A 2EM9A 2ELZA 1WJPA 1X5WA 2RPCA 4IJDA 2EOZA 2EOXA 2ADRA 2GLIA 3EPJA 2WBTA 1UN6B 4R2SA 2EQ1A 2EORA 1KJKA 2EOHA 1TN9A 2CSHA 2EOSA 2I13A 2EMBA 1JK1A 1BB8A 1TF6A 2EM5A 2EMYA 1A1GA 2EQ0A 1TF3A 2NABA 1RMDA 4R2CA 2WBSA 1A1HA 2JPAA 2EPCA 1AAYA 1A1FA 5KL7A 2JP9A 2EOMA 1YUIA 2YTJA 1A1KA 2YTFA 2EN2A 2EN4A 2EOQA 2YTPA 2YTQA 2EM0A 2EM3A 2YU8A 1A1IA 2LCEA 4R2EA 2EM7A 4R2QA 2EL4A 2EMXA 2ENAA 2LV2A 2EOOA 2YTEA 5KL5A 4IS1C 5KL2A 2EM8A 2E72A 1G2FC 2EMWA 1NCSA 2EN3A 2EPAA 2EMCA 4WSGA 2YRMA 3MHHC 2EN7A 4R2RA 2D9HA 4M9VC 1X6EA 1X3CA 2DRPA 2YTIA 2YTGA 1P47A 2R1FA 2PRTA 2MDGA 2YRKA 2EMZA 1A1JA 1X6HA 2EP3A 2VRDA 2DMIA 2EOYA 2ENHA 1ZAAC 4F2JC 2EL6A 5KL6A 2EOEA 2DLKA 2YTOA 2EL5A 2EOIA 4F6NA 2RSIA 2EMKA 2LO3A 1DGCA 2EJ4A 1BBOA 2EOFA 2EMGA 2MKNA 2ELYA 2YU5A 2A25A 2GHFA 3VHTB 4F6MA 2EM6A 1B69A 1YSAC 4R2PA 3M99B 5KL4A 3MHSC 2EN8A 1UBDC 1ZR9A 2EM2A 2EMFA 2EPUA 2EMAA 2EMHA 4X9JA 2EM4A 3UK3C 2MKDA 2YSOA 2EN1A 3EPKA 2EPRA 2YTDA 2ENCA 1MEYC 2WBUA 2EPZA 1F2IG
chains in the Genus database with same CATH superfamily
2CT1A 2EPMX 1J5EE 2LT7A 2N3GA 2NA2A 4DV5E 1PJQA 2G7HA 2LUQA 4OX9E 1QU6A 2JWOA 4LF6E 2EN6A 1NEIA 5AC5A 2HHHE 3AV0A 3J7Yp 2EE8A 3VK6A 2DB2A 3C6MA 2RPCA 4BHBA 2L2MA 2WBTA 1UN6B 4R2SA 2GPIA 4NHRA 2EORA 2LBSB 1PDAA 2N8XA 2EMBA 2ODRC 2V86A 1I94E 2EM5A 2EMYA 1DQ3A 1A1GA 4JI1E 2EQ0A 2FV4B 4JI7E 2NABA 4YHHE 1X49A 1N34E 4LF9E 2JPAA 4BHCA 4HTGA 2YTJA 5LLQA 2EN4A 2YTPA 2EM0A 2YU8A 1N3GA 3C4TA 2ENAA 2N3HA 3JAMC 2L6MA 3ADGA 4GKJE 1NCSA 1PJTA 1WHNA 5IT9C 2EN7A 3HPSA 2D9HA 3BBGA 2UUCE 2M7QA 3IWBA 2RQLA 1YZ9A 4P78A 2L33A 2MDGA 2EMZA 3RMPA 1HNWE 5A6KA 1RC7A 1X6HA 3OMLA 5LL6R 2KHXA 4BS9A 1ZAAC 3THNA 2Q8UA 2DMYA 2LE2A 5FLXC 1X47A 2M4IA 2LO3A 1DGCA 4DV7E 1MGTA 3HQ1A 2EMGA 4O5GA 2YU5A 2A25A 4F6MA 1T4OA 5KL4A 3MHSC 5F3WA 1UBDC 3H09A 4NXNE 4DV4E 4R03A 2EMAA 2EMHA 4O24A 3F6GA 2EM4A 4WXCA 1T38A 1UHZA 2YSOA 3ADIA 2EN1A 3EPKA 2MDRA 4DV1E 3ADLA 2EMLA 4NXME 2DLQA 4X66E 2FTXB 4J8ZA 2YTNA 1YUJA 2JXPA 2HGHA 2CTDA 4DKKA 1SR9A 4K0KE 2V88A 2BB8A 2LTRA 4L8NA 1ZU1A 2B7TA 4KWYA 5DNYA 1XNQE 2RTXA 2M9AA 4JYAE 1HNZE 1Z1BA 1UILA 2V83A 5KL3A 4DR7E 2LVHA 1L4SA 4X8WA 2YSPA 3EQ1A 2NUEA 2EM9A 4BC7A 2YT4A 1X5WA 4BBYA 2KONA 2EOZA 2ADRA 1IBKE 4JI4E 4JI3E 2HJJA 3EPJA 3IWCA 2LMZA 5IXMB 2JY9A 3ADJA 1BBGA 2EOSA 4JI5E 2IHR1 4ZYEA 2DSYA 1SFEA 1JK1A 4WX9A 1EH6A 3J7AG 3K6QA 4M30A 4LFBE 4B3RE 2DIXA 4WXDA 2YWQA 4LF4E 2YTFA 1IQOA 1A1IA 2EM7A 1YPNA 1IQSA 2EM8A 2EMWA 1YYKA 4DV2E 1YYWA 4R2RA 4KZSA 5A69A 1X3CA 4P7DA 4WSPA 2F4VE 5LMNE 4L5NC 3BGHA 2PRTA 4GKKE 2RS7A 1XMQE 2VRDA 2DMIA 3BF2A 5AE3A 4RHBB 2EL6A 5AC4A 5KL6A 2DLKA 2JR1A 1PJSA 4F6NA 2E1MA 2EJ4A 1YYOA 4LFAE 2MKNA 2F8BA 2L3CA 4DR2E 2EPLX 2ODRD 2L92A 2I9IA 4LFCE 2L2NA 1X48A 3DJWA 3KWRA 2L8TA 5A6BD 3UK3C 1ZBQA 2MKDA 3QG5C 4WYQB 2EPRA 2YTDA 2WBUA 2JYAA 4M2ZA 2YRHA 2V85A 4FK5C 4X65E 4TUIA 1X6FA 4DR1E 2WCC3 2BBGA 1G2DC 4R2DA 1STUA 2EPXA 4JI8E 3EPHA 4X62E 4R2AA 2ELZA 2LTSA 2R76A 2MC6A 2KOUA 2RS6A 2UU9E 2GLIA 3J81C 1GZ6A 1T4NA 5ADZA 4DR5E 1KJKA 2EOHA 1GTKA 4KHPE 1TN9A 3L00A 3ECRA 4I8OA 3IWDA 1J26A 3LMLA 2VQEE 2LRSA 5AE1A 2L2KB 2WBSA 1AH5A 2EPCA 1AAYA 2JP9A 2EOMA 2MC5A 5AE2A 1YUIA 4MLQA 2E5LE 4HEIA 4DV3E 4O4KA 2LCEA 4R2QA 2EL4A 3MSWA 4WFTA 2YPNA 2CPNA 2EOOA 2YTEA 4RH8A 2M1SA 5KL5A 2FGGA 2E72A 1G2FC 4O43A 4WSGA 4MLVA 4DR4E 3MHHC 4M0VA 4N4RB 5A6JA 1X6EA 4R8OA 2ZM6E 3VYYA 4JI2E 2YTIA 2YTGA 2VQFE 1N33E 4ZYGA 1P47A 4DUZE 2R1FA 4LTYA 1EH7A 2K7IA 4DR3E 1N36E 2EP3A 3HXLA 4NZVA 3KZZA 4LF8E 2K4VA 5A6AA 4F2JC 4JI6E 2H36X 2EOEA 3LLHA 2YTOA 3KZYA 4WPYA 2EOIA 1IMUA 2EMKA 1BBOA 2GHFA 3VHTB 1B69A 3M99B 1XNRE 5TSEA 2EMFA 3TQMA 2EPOA 2EPUA 4X9JA 1ZBTA 2RSMA 2WZOA 1KYQA 2ENCA 1MEYC 2VF1A 4B3TE 4TUGA 2EPZA 4B3ME 1QNTA 1F2IG 4BMJA 1GQEA 3J80C 2EQ3A 5A2QC 1XMOE 1WHQA 1WRJA 3T1YE 1FKAE 4DR6E 2V8QB 1JK2A 2DGCA 5IWAE 1A1LA 5IV8B 2EPPA 4LF5E 2EZ6A 1LLMC 1WXRA 2EPKX 3JTZA 3DF6A 3ZOQB 4F9BB 2EMIA 3EPLA 1IBLE 1IBME 3VYXA 2V89A 2EOJA 1HNXE 2J7JA 4GZNC 3C6KA 2JOBA 1WJPA 3AUZA 4Q28A 4DV6E 4IJDA 4LF7E 4DV0E 2EOXA 4B3SE 2UXCE 2EQ1A 4ZYHA 1DI2A 4AQYE 2LUPB 2CSHA 2NUGA 5AASA 2LJUA 2I13A 1BB8A 1TF6A 1T39A 4BC9A 2EPNA 1TF3A 4X64E 1RMDA 4R2CA 1A1HA 4ZYDA 5CFFE 1A1FA 5KL7A 2B9DA 3JU0A 4BCAA 4F9AB 1A1KA 2L3JA 2EN2A 4F9CB 2EOQA 2EWLA 2YTQA 2EM3A 1PKPA 4GEQB 1HR0E 4R2EA 2HC5A 4JI0E 2EMXA 2LV2A 4IS1C 5KL2A 1FJGE 2EN3A 2EPAA 2EMCA 3HTXA 2YRMA 1N32E 5LMUE 3F6HA 3P1XA 2UXDE 3BIDA 4M9VC 2DRPA 1EH8A 5T6JA 2JOXA 1RQ0A 5A6BA 3FIGA 2V87A 2YRKA 4JV5E 2YZTA 1A1JA 4DMIA 2VE7C 2B7VA 1YFHA 2NUFA 2EOYA 2ENHA 4LU9A 3HPZA 3C4BA 3THOB 2LJHA 1O0WA 2EL5A 2RSIA 2EOFA 2ELYA 4Q35B 2JVAA 3T1HE 2EM6A 1YSAC 2UUBE 4R2PA 2EN8A 1T4LB 1ZR9A 4OOGC 4YY3E 2EM2A 5BR8E 1EKZA 2UUAE 4F54A 2B3TB 3OTOE 4DUYE 2UXBE
chains in the Genus database with same CATH topology
2CT1A 2EMLA 2EQ3A 2DLQA 1JK2A 2DGCA 2YRHA 2YTNA 1YUJA 2HGHA 1A1LA 2CTDA 4FK5C 2LT7A 2EPPA 1X6FA 2BB8A 2WCC3 1LLMC 1ZU1A 2EN6A 2M9AA 2EMIA 1Z1BA 3EPLA 1G2DC 5KL3A 2EOJA 2LVHA 2J7JA 4R2DA 4GZNC 2EPXA 2YSPA 3EPHA 4R2AA 2EE8A 2EM9A 2ELZA 1WJPA 1X5WA 2RPCA 4IJDA 2EOZA 2EOXA 2ADRA 2GLIA 3EPJA 2WBTA 1UN6B 4R2SA 2EQ1A 2EORA 1KJKA 2EOHA 1TN9A 2CSHA 2EOSA 2I13A 2EMBA 1JK1A 1BB8A 1TF6A 2EM5A 2EMYA 1A1GA 2EQ0A 1TF3A 2NABA 1RMDA 4R2CA 2WBSA 1A1HA 2JPAA 2EPCA 1AAYA 1A1FA 5KL7A 2JP9A 2EOMA 1YUIA 2YTJA 1A1KA 2YTFA 2EN2A 2EN4A 2EOQA 2YTPA 2YTQA 2EM0A 2EM3A 2YU8A 1A1IA 2LCEA 4R2EA 2EM7A 4R2QA 2EL4A 2EMXA 2ENAA 2LV2A 2EOOA 2YTEA 5KL5A 4IS1C 5KL2A 2EM8A 2E72A 1G2FC 2EMWA 1NCSA 2EN3A 2EPAA 2EMCA 4WSGA 2YRMA 3MHHC 2EN7A 4R2RA 2D9HA 4M9VC 1X6EA 1X3CA 2DRPA 2YTIA 2YTGA 1P47A 2R1FA 2PRTA 2MDGA 2YRKA 2EMZA 1A1JA 1X6HA 2EP3A 2VRDA 2DMIA 2EOYA 2ENHA 1ZAAC 4F2JC 2EL6A 5KL6A 2EOEA 2DLKA 2YTOA 2EL5A 2EOIA 4F6NA 2RSIA 2EMKA 2LO3A 1DGCA 2EJ4A 1BBOA 2EOFA 2EMGA 2MKNA 2ELYA 2YU5A 2A25A 2GHFA 3VHTB 4F6MA 2EM6A 1B69A 1YSAC 4R2PA 3M99B 5KL4A 3MHSC 2EN8A 1UBDC 1ZR9A 2EM2A 2EMFA 2EPUA 2EMAA 2EMHA 4X9JA 2EM4A 3UK3C 2MKDA 2YSOA 2EN1A 3EPKA 2EPRA 2YTDA 2ENCA 1MEYC 2WBUA 2EPZA 1F2IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT1 A;  2EML A;  2EQ3 A;  2DLQ A;  1JK2 A;  2DGC A;  2YRH A;  2YTN A;  1YUJ A;  2HGH A;  1A1L A;  2CTD A;  4FK5 C;  2LT7 A;  2EPP A;  1X6F A;  2BB8 A;  2WCC 3;  1LLM C;  1ZU1 A;  2EN6 A;  2M9A A;  2EMI A;  1Z1B A;  3EPL A;  1G2D C;  5KL3 A;  2EOJ A;  2LVH A;  2J7J A;  4R2D A;  4GZN C;  2EPX A;  2YSP A;  3EPH A;  4R2A A;  2EE8 A;  2EM9 A;  2ELZ A;  1WJP A;  1X5W A;  2RPC A;  4IJD A;  2EOZ A;  2EOX A;  2ADR A;  2GLI A;  3EPJ A;  2WBT A;  1UN6 B;  4R2S A;  2EQ1 A;  2EOR A;  1KJK A;  2EOH A;  1TN9 A;  2CSH A;  2EOS A;  2I13 A;  2EMB A;  1JK1 A;  1BB8 A;  1TF6 A;  2EM5 A;  2EMY A;  1A1G A;  2EQ0 A;  1TF3 A;  2NAB A;  1RMD A;  4R2C A;  2WBS A;  1A1H A;  2JPA A;  2EPC A;  1AAY A;  1A1F A;  5KL7 A;  2JP9 A;  2EOM A;  1YUI A;  2YTJ A;  1A1K A;  2YTF A;  2EN2 A;  2EN4 A;  2EOQ A;  2YTP A;  2YTQ A;  2EM0 A;  2EM3 A;  2YU8 A;  1A1I A;  2LCE A;  4R2E A;  2EM7 A;  4R2Q A;  2EL4 A;  2EMX A;  2ENA A;  2LV2 A;  2EOO A;  2YTE A;  5KL5 A;  4IS1 C;  5KL2 A;  2EM8 A;  2E72 A;  1G2F C;  2EMW A;  1NCS A;  2EN3 A;  2EPA A;  2EMC A;  4WSG A;  2YRM A;  3MHH C;  2EN7 A;  4R2R A;  2D9H A;  4M9V C;  1X6E A;  1X3C A;  2DRP A;  2YTI A;  2YTG A;  1P47 A;  2R1F A;  2PRT A;  2MDG A;  2YRK A;  2EMZ A;  1A1J A;  1X6H A;  2EP3 A;  2VRD A;  2DMI A;  2EOY A;  2ENH A;  1ZAA C;  4F2J C;  2EL6 A;  5KL6 A;  2EOE A;  2DLK A;  2YTO A;  2EL5 A;  2EOI A;  4F6N A;  2RSI A;  2EMK A;  2LO3 A;  1DGC A;  2EJ4 A;  1BBO A;  2EOF A;  2EMG A;  2MKN A;  2ELY A;  2YU5 A;  2A25 A;  2GHF A;  3VHT B;  4F6M A;  2EM6 A;  1B69 A;  1YSA C;  4R2P A;  3M99 B;  5KL4 A;  3MHS C;  2EN8 A;  1UBD C;  1ZR9 A;  2EM2 A;  2EMF A;  2EPU A;  2EMA A;  2EMH A;  4X9J A;  2EM4 A;  3UK3 C;  2MKD A;  2YSO A;  2EN1 A;  3EPK A;  2EPR A;  2YTD A;  2ENC A;  1MEY C;  2WBU A;  2EPZ A;  1F2I G; 
#chains in the Genus database with same CATH topology
 2CT1 A;  2EPM X;  1J5E E;  2LT7 A;  2N3G A;  2NA2 A;  4DV5 E;  1PJQ A;  2G7H A;  2LUQ A;  4OX9 E;  1QU6 A;  2JWO A;  4LF6 E;  2EN6 A;  1NEI A;  5AC5 A;  2HHH E;  3AV0 A;  3J7Y p;  2EE8 A;  3VK6 A;  2DB2 A;  3C6M A;  2RPC A;  4BHB A;  2L2M A;  2WBT A;  1UN6 B;  4R2S A;  2GPI A;  4NHR A;  2EOR A;  2LBS B;  1PDA A;  2N8X A;  2EMB A;  2ODR C;  2V86 A;  1I94 E;  2EM5 A;  2EMY A;  1DQ3 A;  1A1G A;  4JI1 E;  2EQ0 A;  2FV4 B;  4JI7 E;  2NAB A;  4YHH E;  1X49 A;  1N34 E;  4LF9 E;  2JPA A;  4BHC A;  4HTG A;  2YTJ A;  5LLQ A;  2EN4 A;  2YTP A;  2EM0 A;  2YU8 A;  1N3G A;  3C4T A;  2ENA A;  2N3H A;  3JAM C;  2L6M A;  3ADG A;  4GKJ E;  1NCS A;  1PJT A;  1WHN A;  5IT9 C;  2EN7 A;  3HPS A;  2D9H A;  3BBG A;  2UUC E;  2M7Q A;  3IWB A;  2RQL A;  1YZ9 A;  4P78 A;  2L33 A;  2MDG A;  2EMZ A;  3RMP A;  1HNW E;  5A6K A;  1RC7 A;  1X6H A;  3OML A;  5LL6 R;  2KHX A;  4BS9 A;  1ZAA C;  3THN A;  2Q8U A;  2DMY A;  2LE2 A;  5FLX C;  1X47 A;  2M4I A;  2LO3 A;  1DGC A;  4DV7 E;  1MGT A;  3HQ1 A;  2EMG A;  4O5G A;  2YU5 A;  2A25 A;  4F6M A;  1T4O A;  5KL4 A;  3MHS C;  5F3W A;  1UBD C;  3H09 A;  4NXN E;  4DV4 E;  4R03 A;  2EMA A;  2EMH A;  4O24 A;  3F6G A;  2EM4 A;  4WXC A;  1T38 A;  1UHZ A;  2YSO A;  3ADI A;  2EN1 A;  3EPK A;  2MDR A;  4DV1 E;  3ADL A;  2EML A;  4NXM E;  2DLQ A;  4X66 E;  2FTX B;  4J8Z A;  2YTN A;  1YUJ A;  2JXP A;  2HGH A;  2CTD A;  4DKK A;  1SR9 A;  4K0K E;  2V88 A;  2BB8 A;  2LTR A;  4L8N A;  1ZU1 A;  2B7T A;  4KWY A;  5DNY A;  1XNQ E;  2RTX A;  2M9A A;  4JYA E;  1HNZ E;  1Z1B A;  1UIL A;  2V83 A;  5KL3 A;  4DR7 E;  2LVH A;  1L4S A;  4X8W A;  2YSP A;  3EQ1 A;  2NUE A;  2EM9 A;  4BC7 A;  2YT4 A;  1X5W A;  4BBY A;  2KON A;  2EOZ A;  2ADR A;  1IBK E;  4JI4 E;  4JI3 E;  2HJJ A;  3EPJ A;  3IWC A;  2LMZ A;  5IXM B;  2JY9 A;  3ADJ A;  1BBG A;  2EOS A;  4JI5 E;  2IHR 1;  4ZYE A;  2DSY A;  1SFE A;  1JK1 A;  4WX9 A;  1EH6 A;  3J7A G;  3K6Q A;  4M30 A;  4LFB E;  4B3R E;  2DIX A;  4WXD A;  2YWQ A;  4LF4 E;  2YTF A;  1IQO A;  1A1I A;  2EM7 A;  1YPN A;  1IQS A;  2EM8 A;  2EMW A;  1YYK A;  4DV2 E;  1YYW A;  4R2R A;  4KZS A;  5A69 A;  1X3C A;  4P7D A;  4WSP A;  2F4V E;  5LMN E;  4L5N C;  3BGH A;  2PRT A;  4GKK E;  2RS7 A;  1XMQ E;  2VRD A;  2DMI A;  3BF2 A;  5AE3 A;  4RHB B;  2EL6 A;  5AC4 A;  5KL6 A;  2DLK A;  2JR1 A;  1PJS A;  4F6N A;  2E1M A;  2EJ4 A;  1YYO A;  4LFA E;  2MKN A;  2F8B A;  2L3C A;  4DR2 E;  2EPL X;  2ODR D;  2L92 A;  2I9I A;  4LFC E;  2L2N A;  1X48 A;  3DJW A;  3KWR A;  2L8T A;  5A6B D;  3UK3 C;  1ZBQ A;  2MKD A;  3QG5 C;  4WYQ B;  2EPR A;  2YTD A;  2WBU A;  2JYA A;  4M2Z A;  2YRH A;  2V85 A;  4FK5 C;  4X65 E;  4TUI A;  1X6F A;  4DR1 E;  2WCC 3;  2BBG A;  1G2D C;  4R2D A;  1STU A;  2EPX A;  4JI8 E;  3EPH A;  4X62 E;  4R2A A;  2ELZ A;  2LTS A;  2R76 A;  2MC6 A;  2KOU A;  2RS6 A;  2UU9 E;  2GLI A;  3J81 C;  1GZ6 A;  1T4N A;  5ADZ A;  4DR5 E;  1KJK A;  2EOH A;  1GTK A;  4KHP E;  1TN9 A;  3L00 A;  3ECR A;  4I8O A;  3IWD A;  1J26 A;  3LML A;  2VQE E;  2LRS A;  5AE1 A;  2L2K B;  2WBS A;  1AH5 A;  2EPC A;  1AAY A;  2JP9 A;  2EOM A;  2MC5 A;  5AE2 A;  1YUI A;  4MLQ A;  2E5L E;  4HEI A;  4DV3 E;  4O4K A;  2LCE A;  4R2Q A;  2EL4 A;  3MSW A;  4WFT A;  2YPN A;  2CPN A;  2EOO A;  2YTE A;  4RH8 A;  2M1S A;  5KL5 A;  2FGG A;  2E72 A;  1G2F C;  4O43 A;  4WSG A;  4MLV A;  4DR4 E;  3MHH C;  4M0V A;  4N4R B;  5A6J A;  1X6E A;  4R8O A;  2ZM6 E;  3VYY A;  4JI2 E;  2YTI A;  2YTG A;  2VQF E;  1N33 E;  4ZYG A;  1P47 A;  4DUZ E;  2R1F A;  4LTY A;  1EH7 A;  2K7I A;  4DR3 E;  1N36 E;  2EP3 A;  3HXL A;  4NZV A;  3KZZ A;  4LF8 E;  2K4V A;  5A6A A;  4F2J C;  4JI6 E;  2H36 X;  2EOE A;  3LLH A;  2YTO A;  3KZY A;  4WPY A;  2EOI A;  1IMU A;  2EMK A;  1BBO A;  2GHF A;  3VHT B;  1B69 A;  3M99 B;  1XNR E;  5TSE A;  2EMF A;  3TQM A;  2EPO A;  2EPU A;  4X9J A;  1ZBT A;  2RSM A;  2WZO A;  1KYQ A;  2ENC A;  1MEY C;  2VF1 A;  4B3T E;  4TUG A;  2EPZ A;  4B3M E;  1QNT A;  1F2I G;  4BMJ A;  1GQE A;  3J80 C;  2EQ3 A;  5A2Q C;  1XMO E;  1WHQ A;  1WRJ A;  3T1Y E;  1FKA E;  4DR6 E;  2V8Q B;  1JK2 A;  2DGC A;  5IWA E;  1A1L A;  5IV8 B;  2EPP A;  4LF5 E;  2EZ6 A;  1LLM C;  1WXR A;  2EPK X;  3JTZ A;  3DF6 A;  3ZOQ B;  4F9B B;  2EMI A;  3EPL A;  1IBL E;  1IBM E;  3VYX A;  2V89 A;  2EOJ A;  1HNX E;  2J7J A;  4GZN C;  3C6K A;  2JOB A;  1WJP A;  3AUZ A;  4Q28 A;  4DV6 E;  4IJD A;  4LF7 E;  4DV0 E;  2EOX A;  4B3S E;  2UXC E;  2EQ1 A;  4ZYH A;  1DI2 A;  4AQY E;  2LUP B;  2CSH A;  2NUG A;  5AAS A;  2LJU A;  2I13 A;  1BB8 A;  1TF6 A;  1T39 A;  4BC9 A;  2EPN A;  1TF3 A;  4X64 E;  1RMD A;  4R2C A;  1A1H A;  4ZYD A;  5CFF E;  1A1F A;  5KL7 A;  2B9D A;  3JU0 A;  4BCA A;  4F9A B;  1A1K A;  2L3J A;  2EN2 A;  4F9C B;  2EOQ A;  2EWL A;  2YTQ A;  2EM3 A;  1PKP A;  4GEQ B;  1HR0 E;  4R2E A;  2HC5 A;  4JI0 E;  2EMX A;  2LV2 A;  4IS1 C;  5KL2 A;  1FJG E;  2EN3 A;  2EPA A;  2EMC A;  3HTX A;  2YRM A;  1N32 E;  5LMU E;  3F6H A;  3P1X A;  2UXD E;  3BID A;  4M9V C;  2DRP A;  1EH8 A;  5T6J A;  2JOX A;  1RQ0 A;  5A6B A;  3FIG A;  2V87 A;  2YRK A;  4JV5 E;  2YZT A;  1A1J A;  4DMI A;  2VE7 C;  2B7V A;  1YFH A;  2NUF A;  2EOY A;  2ENH A;  4LU9 A;  3HPZ A;  3C4B A;  3THO B;  2LJH A;  1O0W A;  2EL5 A;  2RSI A;  2EOF A;  2ELY A;  4Q35 B;  2JVA A;  3T1H E;  2EM6 A;  1YSA C;  2UUB E;  4R2P A;  2EN8 A;  1T4L B;  1ZR9 A;  4OOG C;  4YY3 E;  2EM2 A;  5BR8 E;  1EKZ A;  2UUA E;  4F54 A;  2B3T B;  3OTO E;  4DUY E;  2UXB E; 
#chains in the Genus database with same CATH homology
 2CT1 A;  2EML A;  2EQ3 A;  2DLQ A;  1JK2 A;  2DGC A;  2YRH A;  2YTN A;  1YUJ A;  2HGH A;  1A1L A;  2CTD A;  4FK5 C;  2LT7 A;  2EPP A;  1X6F A;  2BB8 A;  2WCC 3;  1LLM C;  1ZU1 A;  2EN6 A;  2M9A A;  2EMI A;  1Z1B A;  3EPL A;  1G2D C;  5KL3 A;  2EOJ A;  2LVH A;  2J7J A;  4R2D A;  4GZN C;  2EPX A;  2YSP A;  3EPH A;  4R2A A;  2EE8 A;  2EM9 A;  2ELZ A;  1WJP A;  1X5W A;  2RPC A;  4IJD A;  2EOZ A;  2EOX A;  2ADR A;  2GLI A;  3EPJ A;  2WBT A;  1UN6 B;  4R2S A;  2EQ1 A;  2EOR A;  1KJK A;  2EOH A;  1TN9 A;  2CSH A;  2EOS A;  2I13 A;  2EMB A;  1JK1 A;  1BB8 A;  1TF6 A;  2EM5 A;  2EMY A;  1A1G A;  2EQ0 A;  1TF3 A;  2NAB A;  1RMD A;  4R2C A;  2WBS A;  1A1H A;  2JPA A;  2EPC A;  1AAY A;  1A1F A;  5KL7 A;  2JP9 A;  2EOM A;  1YUI A;  2YTJ A;  1A1K A;  2YTF A;  2EN2 A;  2EN4 A;  2EOQ A;  2YTP A;  2YTQ A;  2EM0 A;  2EM3 A;  2YU8 A;  1A1I A;  2LCE A;  4R2E A;  2EM7 A;  4R2Q A;  2EL4 A;  2EMX A;  2ENA A;  2LV2 A;  2EOO A;  2YTE A;  5KL5 A;  4IS1 C;  5KL2 A;  2EM8 A;  2E72 A;  1G2F C;  2EMW A;  1NCS A;  2EN3 A;  2EPA A;  2EMC A;  4WSG A;  2YRM A;  3MHH C;  2EN7 A;  4R2R A;  2D9H A;  4M9V C;  1X6E A;  1X3C A;  2DRP A;  2YTI A;  2YTG A;  1P47 A;  2R1F A;  2PRT A;  2MDG A;  2YRK A;  2EMZ A;  1A1J A;  1X6H A;  2EP3 A;  2VRD A;  2DMI A;  2EOY A;  2ENH A;  1ZAA C;  4F2J C;  2EL6 A;  5KL6 A;  2EOE A;  2DLK A;  2YTO A;  2EL5 A;  2EOI A;  4F6N A;  2RSI A;  2EMK A;  2LO3 A;  1DGC A;  2EJ4 A;  1BBO A;  2EOF A;  2EMG A;  2MKN A;  2ELY A;  2YU5 A;  2A25 A;  2GHF A;  3VHT B;  4F6M A;  2EM6 A;  1B69 A;  1YSA C;  4R2P A;  3M99 B;  5KL4 A;  3MHS C;  2EN8 A;  1UBD C;  1ZR9 A;  2EM2 A;  2EMF A;  2EPU A;  2EMA A;  2EMH A;  4X9J A;  2EM4 A;  3UK3 C;  2MKD A;  2YSO A;  2EN1 A;  3EPK A;  2EPR A;  2YTD A;  2ENC A;  1MEY C;  2WBU A;  2EPZ A;  1F2I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...