1X5WA

Solution structure of the c2h2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GSSGSSGHPEKCSECSYSCSSKAALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKKFHGDMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 64, isoforms 1
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13909 zf-H2C2_5 C2H2-type zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x5wA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x5wA01
5KL4A 2ELYA 1UN6B 2EPAA 2EMXA 2EM9A 2EQ1A 2EPPA 2PRTA 2EQ0A 1G2DC 1A1JA 2CTDA 2EORA 2EOOA 4R2PA 2YTEA 1WJPA 4R2SA 2EL4A 2EOZA 4X9JA 2J7JA 2EMIA 2EN7A 2YTGA 1UBDC 4F6MA 2EMWA 2EM4A 1JK2A 2ENAA 1YSAC 2LVHA 2R1FA 4R2EA 2GLIA 1A1KA 4R2RA 2LO3A 4IJDA 5KL2A 2YRMA 2NABA 2DGCA 3EPKA 2YU5A 2EMKA 2ENCA 2DLKA 2EMFA 2JP9A 4FK5C 3EPJA 1X3CA 4R2AA 1RMDA 5KL5A 2EN4A 2MKNA 2WBSA 2YRHA 1DGCA 2LT7A 1BBOA 2EOSA 1X6HA 3EPHA 2LV2A 2GHFA 4R2QA 2EMCA 1Z1BA 2EOXA 2YTJA 1X6EA 2WBUA 2EE8A 2MDGA 1TF3A 5KL3A 3UK3C 4IS1C 2RSIA 2EN1A 2I13A 1ZU1A 5KL6A 2EMYA 2EM6A 2EN2A 4M9VC 2EM2A 2EM7A 2M9AA 2ADRA 2YTIA 2EOHA 2YU8A 2EOFA 1ZR9A 2EOQA 2WCC3 3VHTB 3EPLA 4GZNC 2WBTA 2EM8A 1X6FA 2EQ3A 2YTNA 2EMLA 2EL5A 2DLQA 2ELZA 1G2FC 2D9HA 2YTQA 1JK1A 1AAYA 2EN8A 1B69A 2EOYA 2EPRA 2JPAA 2EM3A 4R2DA 1P47A 2LCEA 1A1HA 2EMHA 2EPUA 2EMAA 2YSOA 2YTPA 1YUIA 2YSPA 2EM5A 2HGHA 2EOJA 4R2CA 1A1LA 1YUJA 1ZAAC 2EPXA 2EM0A 2EN6A 2EP3A 2CT1A 3M99B 2YTDA 1LLMC 1F2IG 2BB8A 2YTFA 2EOEA 3MHSC 2YTOA 2EMZA 2EN3A 1TF6A 2EPCA 4F6NA 2E72A 4WSGA 1A1IA 1NCSA 1X5WA 2EL6A 1A1GA 1BB8A 2DMIA 5KL7A 2EMBA 2DRPA 2EOIA 1KJKA 2EJ4A 1MEYC 2CSHA 2RPCA 1A1FA 2EOMA 2MKDA 2ENHA 2EPZA 4F2JC 2YRKA 1TN9A 2EMGA 2VRDA 2A25A 3MHHC
chains in the Genus database with same CATH superfamily
5KL4A 2LBSB 2I9IA 2MC6A 2EPAA 3C4TA 2DB2A 4KWYA 2UXCE 4NHRA 2EQ0A 2CTDA 2EORA 3J80C 2EOOA 1NEIA 2EL4A 2M4IA 2J7JA 1RQ0A 2B9DA 1HNXE 2EMWA 1HNWE 4WXDA 1YSAC 2LVHA 2GLIA 1A1KA 4R2RA 3DJWA 2YU5A 3JU0A 2EMKA 5AE2A 4AQYE 2JP9A 2UUAE 4JI0E 4FK5C 3IWDA 4R2AA 4OOGC 1HNZE 2EN4A 2YWQA 1DGCA 1XNRE 2RS7A 3KZZA 4WYQB 3F6GA 4MLQA 4JI3E 1YYKA 1Z1BA 2YTJA 4KHPE 3KWRA 4M30A 2JYAA 2LE2A 2RSIA 4OX9E 2I13A 1IQSA 4WXCA 3JAMC 1O0WA 5KL6A 1GTKA 2CPNA 3EQ1A 4F9AB 4LF7E 2YTIA 2YU8A 2EOFA 2HC5A 4LF4E 1DI2A 4GZNC 2K7IA 2EM8A 2EQ3A 2B3TB 2YTNA 4ZYGA 2NUEA 4X62E 2EL5A 3ZOQB 2RTXA 4NXNE 2M1SA 2V85A 4JI4E 2EN8A 2EOYA 2EPRA 2EM3A 2E1MA 1EH8A 4Q35B 1DQ3A 4DR4E 4WSPA 4DR2E 1A1HA 2YZTA 1KYQA 2M7QA 2DMYA 4X66E 4DV5E 2EPLX 3HPZA 2EOJA 4R2CA 1A1LA 1YUJA 3ADGA 5A6KA 1ZBQA 2EP3A 1F2IG 3M99B 4ZYHA 2MC5A 2EMZA 2EN3A 2JXPA 4WSGA 2JR1A 4F54A 1BB8A 5KL7A 1KJKA 3H09A 2CSHA 3OTOE 1T4NA 3VYXA 1PJQA 2EMGA 2L8TA 2VRDA 4Q28A 4NXME 1UN6B 2EPKX 2EPPA 2L3CA 2PRTA 4DV7E 3FIGA 3TQMA 1J26A 4R2SA 3ADJA 4X9JA 1L4SA 4DV6E 4M0VA 2EMIA 2EN7A 2YTGA 4BBYA 2K4VA 1UBDC 4LFCE 1GQEA 1XMOE 2LRSA 1T4LB 2EM4A 1JK2A 4R2EA 2LO3A 2HJJA 1IBME 1IMUA 3J7Yp 2V89A 1N33E 4X64E 1N36E 1X3CA 2YT4A 1X49A 4DUYE 1X48A 4DV4E 2UUBE 4O4KA 2EOSA 4R2QA 4LU9A 2JOBA 2WBUA 2EE8A 2LUPB 5KL3A 3UK3C 3AV0A 2FGGA 1FKAE 2EN1A 4JI2E 2N8XA 4GEQB 1ZU1A 2EMYA 2EM2A 2M9AA 2ADRA 1N34E 2F8BA 2L2KB 4HEIA 1ZBTA 3C6KA 2WCC3 3EPLA 4ZYEA 2WBTA 1EKZA 1GZ6A 1X6FA 4YHHE 4BMJA 2JOXA 4KZSA 1N32E 4DR6E 5AE1A 2Q8UA 3VK6A 2V87A 2YTQA 1JK1A 4M2ZA 1B69A 2JPAA 4JI5E 4DV3E 1WHNA 1T38A 1YZ9A 4I8OA 2EMHA 2EPUA 5T6JA 2YSPA 3ADLA 4DR1E 4O24A 2FTXB 2IHR1 2RQLA 3MHSC 1YYWA 5LMNE 2LUQA 2LMZA 3BF2A 1TF6A 4LF6E 2E72A 4LF8E 1X5WA 2EL6A 1A1GA 1XMQE 2EPMX 2L2MA 5LMUE 1PKPA 4R8OA 4LF9E 2L33A 4BC9A 1MEYC 4HTGA 2H36X 2ENHA 5A6JA 2LTSA 4ZYDA 2LJUA 4LFBE 2A25A 4YY3E 2ELYA 2NA2A 5ADZA 2UXDE 5A6BD 1A1JA 4R2PA 1WJPA 3L00A 2VE7C 1IBLE 2DIXA 4L5NC 1STUA 4O5GA 1QU6A 1MGTA 4JI8E 3HQ1A 4F6MA 4JI1E 3EPKA 4WPYA 4DV0E 2ENCA 2DLKA 5DNYA 5TSEA 2EMFA 2MDRA 2VQFE 2EZ6A 4LTYA 3EPJA 4N4RB 4WFTA 1RMDA 1AH5A 1UHZA 5KL5A 2MKNA 5AC4A 3OMLA 2WBSA 4JV5E 1HR0E 4B3SE 3ECRA 3AUZA 2N3HA 2L3JA 2LT7A 3HTXA 1BBOA 2KOUA 1I94E 1IQOA 2N3GA 2LV2A 2GHFA 2EMCA 2YPNA 2EOXA 4IS1C 1WXRA 2EM6A 2EN2A 2GPIA 5A6AA 2LJHA 2UU9E 4LFAE 1T4OA 5A2QC 2EOQA 3VHTB 2EPNA 2EMLA 3MSWA 1SR9A 2DLQA 1YFHA 4DV2E 4B3TE 2RS6A 3F6HA 3T1HE 1AAYA 2B7TA 1PJSA 1XNQE 4RHBB 2UXBE 4P7DA 3VYYA 4DKKA 4NZVA 4R2DA 4R03A 2LCEA 5IV8B 4BCAA 2FV4B 2YSOA 2YTPA 1YUIA 4JI7E 2EM5A 4X8WA 2HGHA 4MLVA 2EPXA 2EM0A 2EN6A 5CFFE 2UUCE 3RMPA 2CT1A 2YTDA 2BB8A 1QNTA 5AE3A 3J81C 3BGHA 4DV1E 3HPSA 1FJGE 4JYAE 2YTOA 1WRJA 2E5LE 2EPCA 4F9BB 4F6NA 3T1YE 2LTRA 1NCSA 1A1IA 3KZYA 4DR3E 2NUGA 2V86A 1EH6A 2JWOA 5F3WA 2EOIA 2ODRD 4JI6E 3DF6A 4BC7A 2RPCA 1A1FA 1EH7A 2EPZA 1TN9A 2G7HA 1RC7A 3QG5C 4TUIA 3BBGA 2EMXA 2EM9A 2EQ1A 2V88A 1G2DC 1WHQA 5IXMB 3LLHA 2YTEA 5AC5A 2EOZA 4BHBA 3C4BA 5A6BA 3THNA 4L8NA 2KONA 1SFEA 3HXLA 4LF5E 2ENAA 1PJTA 2ZM6E 2R1FA 4GKJE 5LLQA 4IJDA 5KL2A 2YRMA 2NABA 2DGCA 3LMLA 1UILA 5IT9C 3THOB 2L6MA 2ODRC 4BS9A 2VQEE 2B7VA 3IWCA 2KHXA 3K6QA 1N3GA 2YRHA 5A69A 4K0KE 5LL6R 1X6HA 4BHCA 2BBGA 3EPHA 2VF1A 1X6EA 2MDGA 1TF3A 3IWBA 2EPOA 2V8QB 4B3RE 1BBGA 2EWLA 4M9VC 2EM7A 1J5EE 3BIDA 2EOHA 1ZR9A 2WZOA 4P78A 3J7AG 2V83A 1YPNA 1X47A 3C6MA 2ELZA 3P1XA 1G2FC 2D9HA 4J8ZA 2L92A 2JY9A 4DR5E 5IWAE 1T39A 1PDAA 1P47A 4DUZE 4WX9A 2NUFA 2EMAA 4B3ME 4DMIA 4F9CB 2DSYA 1ZAAC 1LLMC 2YTFA 2HHHE 2EOEA 2JVAA 2RSMA 4O43A 4GKKE 4TUGA 1YYOA 2DMIA 1IBKE 2F4VE 2EMBA 2DRPA 4RH8A 2R76A 2EJ4A 5BR8E 2EOMA 2MKDA 3ADIA 4F2JC 2YRKA 4DR7E 2L2NA 5AASA 3JTZA 4X65E 5FLXC 3MHHC
chains in the Genus database with same CATH topology
5KL4A 2ELYA 1UN6B 2EPAA 2EMXA 2EM9A 2EQ1A 2EPPA 2PRTA 2EQ0A 1G2DC 1A1JA 2CTDA 2EORA 2EOOA 4R2PA 2YTEA 1WJPA 4R2SA 2EL4A 2EOZA 4X9JA 2J7JA 2EMIA 2EN7A 2YTGA 1UBDC 4F6MA 2EMWA 2EM4A 1JK2A 2ENAA 1YSAC 2LVHA 2R1FA 4R2EA 2GLIA 1A1KA 4R2RA 2LO3A 4IJDA 5KL2A 2YRMA 2NABA 2DGCA 3EPKA 2YU5A 2EMKA 2ENCA 2DLKA 2EMFA 2JP9A 4FK5C 3EPJA 1X3CA 4R2AA 1RMDA 5KL5A 2EN4A 2MKNA 2WBSA 2YRHA 1DGCA 2LT7A 1BBOA 2EOSA 1X6HA 3EPHA 2LV2A 2GHFA 4R2QA 2EMCA 1Z1BA 2EOXA 2YTJA 1X6EA 2WBUA 2EE8A 2MDGA 1TF3A 5KL3A 3UK3C 4IS1C 2RSIA 2EN1A 2I13A 1ZU1A 5KL6A 2EMYA 2EM6A 2EN2A 4M9VC 2EM2A 2EM7A 2M9AA 2ADRA 2YTIA 2EOHA 2YU8A 2EOFA 1ZR9A 2EOQA 2WCC3 3VHTB 3EPLA 4GZNC 2WBTA 2EM8A 1X6FA 2EQ3A 2YTNA 2EMLA 2EL5A 2DLQA 2ELZA 1G2FC 2D9HA 2YTQA 1JK1A 1AAYA 2EN8A 1B69A 2EOYA 2EPRA 2JPAA 2EM3A 4R2DA 1P47A 2LCEA 1A1HA 2EMHA 2EPUA 2EMAA 2YSOA 2YTPA 1YUIA 2YSPA 2EM5A 2HGHA 2EOJA 4R2CA 1A1LA 1YUJA 1ZAAC 2EPXA 2EM0A 2EN6A 2EP3A 2CT1A 3M99B 2YTDA 1LLMC 1F2IG 2BB8A 2YTFA 2EOEA 3MHSC 2YTOA 2EMZA 2EN3A 1TF6A 2EPCA 4F6NA 2E72A 4WSGA 1A1IA 1NCSA 1X5WA 2EL6A 1A1GA 1BB8A 2DMIA 5KL7A 2EMBA 2DRPA 2EOIA 1KJKA 2EJ4A 1MEYC 2CSHA 2RPCA 1A1FA 2EOMA 2MKDA 2ENHA 2EPZA 4F2JC 2YRKA 1TN9A 2EMGA 2VRDA 2A25A 3MHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL4 A;  2ELY A;  1UN6 B;  2EPA A;  2EMX A;  2EM9 A;  2EQ1 A;  2EPP A;  2PRT A;  2EQ0 A;  1G2D C;  1A1J A;  2CTD A;  2EOR A;  2EOO A;  4R2P A;  2YTE A;  1WJP A;  4R2S A;  2EL4 A;  2EOZ A;  4X9J A;  2J7J A;  2EMI A;  2EN7 A;  2YTG A;  1UBD C;  4F6M A;  2EMW A;  2EM4 A;  1JK2 A;  2ENA A;  1YSA C;  2LVH A;  2R1F A;  4R2E A;  2GLI A;  1A1K A;  4R2R A;  2LO3 A;  4IJD A;  5KL2 A;  2YRM A;  2NAB A;  2DGC A;  3EPK A;  2YU5 A;  2EMK A;  2ENC A;  2DLK A;  2EMF A;  2JP9 A;  4FK5 C;  3EPJ A;  1X3C A;  4R2A A;  1RMD A;  5KL5 A;  2EN4 A;  2MKN A;  2WBS A;  2YRH A;  1DGC A;  2LT7 A;  1BBO A;  2EOS A;  1X6H A;  3EPH A;  2LV2 A;  2GHF A;  4R2Q A;  2EMC A;  1Z1B A;  2EOX A;  2YTJ A;  1X6E A;  2WBU A;  2EE8 A;  2MDG A;  1TF3 A;  5KL3 A;  3UK3 C;  4IS1 C;  2RSI A;  2EN1 A;  2I13 A;  1ZU1 A;  5KL6 A;  2EMY A;  2EM6 A;  2EN2 A;  4M9V C;  2EM2 A;  2EM7 A;  2M9A A;  2ADR A;  2YTI A;  2EOH A;  2YU8 A;  2EOF A;  1ZR9 A;  2EOQ A;  2WCC 3;  3VHT B;  3EPL A;  4GZN C;  2WBT A;  2EM8 A;  1X6F A;  2EQ3 A;  2YTN A;  2EML A;  2EL5 A;  2DLQ A;  2ELZ A;  1G2F C;  2D9H A;  2YTQ A;  1JK1 A;  1AAY A;  2EN8 A;  1B69 A;  2EOY A;  2EPR A;  2JPA A;  2EM3 A;  4R2D A;  1P47 A;  2LCE A;  1A1H A;  2EMH A;  2EPU A;  2EMA A;  2YSO A;  2YTP A;  1YUI A;  2YSP A;  2EM5 A;  2HGH A;  2EOJ A;  4R2C A;  1A1L A;  1YUJ A;  1ZAA C;  2EPX A;  2EM0 A;  2EN6 A;  2EP3 A;  2CT1 A;  3M99 B;  2YTD A;  1LLM C;  1F2I G;  2BB8 A;  2YTF A;  2EOE A;  3MHS C;  2YTO A;  2EMZ A;  2EN3 A;  1TF6 A;  2EPC A;  4F6N A;  2E72 A;  4WSG A;  1A1I A;  1NCS A;  1X5W A;  2EL6 A;  1A1G A;  1BB8 A;  2DMI A;  5KL7 A;  2EMB A;  2DRP A;  2EOI A;  1KJK A;  2EJ4 A;  1MEY C;  2CSH A;  2RPC A;  1A1F A;  2EOM A;  2MKD A;  2ENH A;  2EPZ A;  4F2J C;  2YRK A;  1TN9 A;  2EMG A;  2VRD A;  2A25 A;  3MHH C; 
#chains in the Genus database with same CATH topology
 5KL4 A;  2LBS B;  2I9I A;  2MC6 A;  2EPA A;  3C4T A;  2DB2 A;  4KWY A;  2UXC E;  4NHR A;  2EQ0 A;  2CTD A;  2EOR A;  3J80 C;  2EOO A;  1NEI A;  2EL4 A;  2M4I A;  2J7J A;  1RQ0 A;  2B9D A;  1HNX E;  2EMW A;  1HNW E;  4WXD A;  1YSA C;  2LVH A;  2GLI A;  1A1K A;  4R2R A;  3DJW A;  2YU5 A;  3JU0 A;  2EMK A;  5AE2 A;  4AQY E;  2JP9 A;  2UUA E;  4JI0 E;  4FK5 C;  3IWD A;  4R2A A;  4OOG C;  1HNZ E;  2EN4 A;  2YWQ A;  1DGC A;  1XNR E;  2RS7 A;  3KZZ A;  4WYQ B;  3F6G A;  4MLQ A;  4JI3 E;  1YYK A;  1Z1B A;  2YTJ A;  4KHP E;  3KWR A;  4M30 A;  2JYA A;  2LE2 A;  2RSI A;  4OX9 E;  2I13 A;  1IQS A;  4WXC A;  3JAM C;  1O0W A;  5KL6 A;  1GTK A;  2CPN A;  3EQ1 A;  4F9A B;  4LF7 E;  2YTI A;  2YU8 A;  2EOF A;  2HC5 A;  4LF4 E;  1DI2 A;  4GZN C;  2K7I A;  2EM8 A;  2EQ3 A;  2B3T B;  2YTN A;  4ZYG A;  2NUE A;  4X62 E;  2EL5 A;  3ZOQ B;  2RTX A;  4NXN E;  2M1S A;  2V85 A;  4JI4 E;  2EN8 A;  2EOY A;  2EPR A;  2EM3 A;  2E1M A;  1EH8 A;  4Q35 B;  1DQ3 A;  4DR4 E;  4WSP A;  4DR2 E;  1A1H A;  2YZT A;  1KYQ A;  2M7Q A;  2DMY A;  4X66 E;  4DV5 E;  2EPL X;  3HPZ A;  2EOJ A;  4R2C A;  1A1L A;  1YUJ A;  3ADG A;  5A6K A;  1ZBQ A;  2EP3 A;  1F2I G;  3M99 B;  4ZYH A;  2MC5 A;  2EMZ A;  2EN3 A;  2JXP A;  4WSG A;  2JR1 A;  4F54 A;  1BB8 A;  5KL7 A;  1KJK A;  3H09 A;  2CSH A;  3OTO E;  1T4N A;  3VYX A;  1PJQ A;  2EMG A;  2L8T A;  2VRD A;  4Q28 A;  4NXM E;  1UN6 B;  2EPK X;  2EPP A;  2L3C A;  2PRT A;  4DV7 E;  3FIG A;  3TQM A;  1J26 A;  4R2S A;  3ADJ A;  4X9J A;  1L4S A;  4DV6 E;  4M0V A;  2EMI A;  2EN7 A;  2YTG A;  4BBY A;  2K4V A;  1UBD C;  4LFC E;  1GQE A;  1XMO E;  2LRS A;  1T4L B;  2EM4 A;  1JK2 A;  4R2E A;  2LO3 A;  2HJJ A;  1IBM E;  1IMU A;  3J7Y p;  2V89 A;  1N33 E;  4X64 E;  1N36 E;  1X3C A;  2YT4 A;  1X49 A;  4DUY E;  1X48 A;  4DV4 E;  2UUB E;  4O4K A;  2EOS A;  4R2Q A;  4LU9 A;  2JOB A;  2WBU A;  2EE8 A;  2LUP B;  5KL3 A;  3UK3 C;  3AV0 A;  2FGG A;  1FKA E;  2EN1 A;  4JI2 E;  2N8X A;  4GEQ B;  1ZU1 A;  2EMY A;  2EM2 A;  2M9A A;  2ADR A;  1N34 E;  2F8B A;  2L2K B;  4HEI A;  1ZBT A;  3C6K A;  2WCC 3;  3EPL A;  4ZYE A;  2WBT A;  1EKZ A;  1GZ6 A;  1X6F A;  4YHH E;  4BMJ A;  2JOX A;  4KZS A;  1N32 E;  4DR6 E;  5AE1 A;  2Q8U A;  3VK6 A;  2V87 A;  2YTQ A;  1JK1 A;  4M2Z A;  1B69 A;  2JPA A;  4JI5 E;  4DV3 E;  1WHN A;  1T38 A;  1YZ9 A;  4I8O A;  2EMH A;  2EPU A;  5T6J A;  2YSP A;  3ADL A;  4DR1 E;  4O24 A;  2FTX B;  2IHR 1;  2RQL A;  3MHS C;  1YYW A;  5LMN E;  2LUQ A;  2LMZ A;  3BF2 A;  1TF6 A;  4LF6 E;  2E72 A;  4LF8 E;  1X5W A;  2EL6 A;  1A1G A;  1XMQ E;  2EPM X;  2L2M A;  5LMU E;  1PKP A;  4R8O A;  4LF9 E;  2L33 A;  4BC9 A;  1MEY C;  4HTG A;  2H36 X;  2ENH A;  5A6J A;  2LTS A;  4ZYD A;  2LJU A;  4LFB E;  2A25 A;  4YY3 E;  2ELY A;  2NA2 A;  5ADZ A;  2UXD E;  5A6B D;  1A1J A;  4R2P A;  1WJP A;  3L00 A;  2VE7 C;  1IBL E;  2DIX A;  4L5N C;  1STU A;  4O5G A;  1QU6 A;  1MGT A;  4JI8 E;  3HQ1 A;  4F6M A;  4JI1 E;  3EPK A;  4WPY A;  4DV0 E;  2ENC A;  2DLK A;  5DNY A;  5TSE A;  2EMF A;  2MDR A;  2VQF E;  2EZ6 A;  4LTY A;  3EPJ A;  4N4R B;  4WFT A;  1RMD A;  1AH5 A;  1UHZ A;  5KL5 A;  2MKN A;  5AC4 A;  3OML A;  2WBS A;  4JV5 E;  1HR0 E;  4B3S E;  3ECR A;  3AUZ A;  2N3H A;  2L3J A;  2LT7 A;  3HTX A;  1BBO A;  2KOU A;  1I94 E;  1IQO A;  2N3G A;  2LV2 A;  2GHF A;  2EMC A;  2YPN A;  2EOX A;  4IS1 C;  1WXR A;  2EM6 A;  2EN2 A;  2GPI A;  5A6A A;  2LJH A;  2UU9 E;  4LFA E;  1T4O A;  5A2Q C;  2EOQ A;  3VHT B;  2EPN A;  2EML A;  3MSW A;  1SR9 A;  2DLQ A;  1YFH A;  4DV2 E;  4B3T E;  2RS6 A;  3F6H A;  3T1H E;  1AAY A;  2B7T A;  1PJS A;  1XNQ E;  4RHB B;  2UXB E;  4P7D A;  3VYY A;  4DKK A;  4NZV A;  4R2D A;  4R03 A;  2LCE A;  5IV8 B;  4BCA A;  2FV4 B;  2YSO A;  2YTP A;  1YUI A;  4JI7 E;  2EM5 A;  4X8W A;  2HGH A;  4MLV A;  2EPX A;  2EM0 A;  2EN6 A;  5CFF E;  2UUC E;  3RMP A;  2CT1 A;  2YTD A;  2BB8 A;  1QNT A;  5AE3 A;  3J81 C;  3BGH A;  4DV1 E;  3HPS A;  1FJG E;  4JYA E;  2YTO A;  1WRJ A;  2E5L E;  2EPC A;  4F9B B;  4F6N A;  3T1Y E;  2LTR A;  1NCS A;  1A1I A;  3KZY A;  4DR3 E;  2NUG A;  2V86 A;  1EH6 A;  2JWO A;  5F3W A;  2EOI A;  2ODR D;  4JI6 E;  3DF6 A;  4BC7 A;  2RPC A;  1A1F A;  1EH7 A;  2EPZ A;  1TN9 A;  2G7H A;  1RC7 A;  3QG5 C;  4TUI A;  3BBG A;  2EMX A;  2EM9 A;  2EQ1 A;  2V88 A;  1G2D C;  1WHQ A;  5IXM B;  3LLH A;  2YTE A;  5AC5 A;  2EOZ A;  4BHB A;  3C4B A;  5A6B A;  3THN A;  4L8N A;  2KON A;  1SFE A;  3HXL A;  4LF5 E;  2ENA A;  1PJT A;  2ZM6 E;  2R1F A;  4GKJ E;  5LLQ A;  4IJD A;  5KL2 A;  2YRM A;  2NAB A;  2DGC A;  3LML A;  1UIL A;  5IT9 C;  3THO B;  2L6M A;  2ODR C;  4BS9 A;  2VQE E;  2B7V A;  3IWC A;  2KHX A;  3K6Q A;  1N3G A;  2YRH A;  5A69 A;  4K0K E;  5LL6 R;  1X6H A;  4BHC A;  2BBG A;  3EPH A;  2VF1 A;  1X6E A;  2MDG A;  1TF3 A;  3IWB A;  2EPO A;  2V8Q B;  4B3R E;  1BBG A;  2EWL A;  4M9V C;  2EM7 A;  1J5E E;  3BID A;  2EOH A;  1ZR9 A;  2WZO A;  4P78 A;  3J7A G;  2V83 A;  1YPN A;  1X47 A;  3C6M A;  2ELZ A;  3P1X A;  1G2F C;  2D9H A;  4J8Z A;  2L92 A;  2JY9 A;  4DR5 E;  5IWA E;  1T39 A;  1PDA A;  1P47 A;  4DUZ E;  4WX9 A;  2NUF A;  2EMA A;  4B3M E;  4DMI A;  4F9C B;  2DSY A;  1ZAA C;  1LLM C;  2YTF A;  2HHH E;  2EOE A;  2JVA A;  2RSM A;  4O43 A;  4GKK E;  4TUG A;  1YYO A;  2DMI A;  1IBK E;  2F4V E;  2EMB A;  2DRP A;  4RH8 A;  2R76 A;  2EJ4 A;  5BR8 E;  2EOM A;  2MKD A;  3ADI A;  4F2J C;  2YRK A;  4DR7 E;  2L2N A;  5AAS A;  3JTZ A;  4X65 E;  5FLX C;  3MHH C; 
#chains in the Genus database with same CATH homology
 5KL4 A;  2ELY A;  1UN6 B;  2EPA A;  2EMX A;  2EM9 A;  2EQ1 A;  2EPP A;  2PRT A;  2EQ0 A;  1G2D C;  1A1J A;  2CTD A;  2EOR A;  2EOO A;  4R2P A;  2YTE A;  1WJP A;  4R2S A;  2EL4 A;  2EOZ A;  4X9J A;  2J7J A;  2EMI A;  2EN7 A;  2YTG A;  1UBD C;  4F6M A;  2EMW A;  2EM4 A;  1JK2 A;  2ENA A;  1YSA C;  2LVH A;  2R1F A;  4R2E A;  2GLI A;  1A1K A;  4R2R A;  2LO3 A;  4IJD A;  5KL2 A;  2YRM A;  2NAB A;  2DGC A;  3EPK A;  2YU5 A;  2EMK A;  2ENC A;  2DLK A;  2EMF A;  2JP9 A;  4FK5 C;  3EPJ A;  1X3C A;  4R2A A;  1RMD A;  5KL5 A;  2EN4 A;  2MKN A;  2WBS A;  2YRH A;  1DGC A;  2LT7 A;  1BBO A;  2EOS A;  1X6H A;  3EPH A;  2LV2 A;  2GHF A;  4R2Q A;  2EMC A;  1Z1B A;  2EOX A;  2YTJ A;  1X6E A;  2WBU A;  2EE8 A;  2MDG A;  1TF3 A;  5KL3 A;  3UK3 C;  4IS1 C;  2RSI A;  2EN1 A;  2I13 A;  1ZU1 A;  5KL6 A;  2EMY A;  2EM6 A;  2EN2 A;  4M9V C;  2EM2 A;  2EM7 A;  2M9A A;  2ADR A;  2YTI A;  2EOH A;  2YU8 A;  2EOF A;  1ZR9 A;  2EOQ A;  2WCC 3;  3VHT B;  3EPL A;  4GZN C;  2WBT A;  2EM8 A;  1X6F A;  2EQ3 A;  2YTN A;  2EML A;  2EL5 A;  2DLQ A;  2ELZ A;  1G2F C;  2D9H A;  2YTQ A;  1JK1 A;  1AAY A;  2EN8 A;  1B69 A;  2EOY A;  2EPR A;  2JPA A;  2EM3 A;  4R2D A;  1P47 A;  2LCE A;  1A1H A;  2EMH A;  2EPU A;  2EMA A;  2YSO A;  2YTP A;  1YUI A;  2YSP A;  2EM5 A;  2HGH A;  2EOJ A;  4R2C A;  1A1L A;  1YUJ A;  1ZAA C;  2EPX A;  2EM0 A;  2EN6 A;  2EP3 A;  2CT1 A;  3M99 B;  2YTD A;  1LLM C;  1F2I G;  2BB8 A;  2YTF A;  2EOE A;  3MHS C;  2YTO A;  2EMZ A;  2EN3 A;  1TF6 A;  2EPC A;  4F6N A;  2E72 A;  4WSG A;  1A1I A;  1NCS A;  1X5W A;  2EL6 A;  1A1G A;  1BB8 A;  2DMI A;  5KL7 A;  2EMB A;  2DRP A;  2EOI A;  1KJK A;  2EJ4 A;  1MEY C;  2CSH A;  2RPC A;  1A1F A;  2EOM A;  2MKD A;  2ENH A;  2EPZ A;  4F2J C;  2YRK A;  1TN9 A;  2EMG A;  2VRD A;  2A25 A;  3MHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...