1X5WA

Solution structure of the c2h2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GSSGSSGHPEKCSECSYSCSSKAALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKKFHGDMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 64, isoforms 1
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13909 zf-H2C2_5 C2H2-type zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x5wA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x5wA01
2YSOA 3MHHC 2EOZA 2ADRA 4IS1C 2EMLA 4R2RA 2GHFA 2DMIA 1A1FA 2I13A 2EMWA 2YTIA 2YRKA 3M99B 1A1HA 2ENHA 2YRMA 2EMGA 2YTOA 2EMXA 2EM0A 1X3CA 2J7JA 2EPUA 2YTPA 5KL6A 1A1IA 2EOQA 1AAYA 1JK2A 1TF3A 2YU8A 2WBUA 1B69A 3VHTB 4R2QA 1RMDA 2EL4A 1ZU1A 2EPAA 2MDGA 2JPAA 4WSGA 4X9JA 1NCSA 2EM9A 2YRHA 4R2DA 2HGHA 1YUJA 2EN8A 2NABA 2ENAA 2EOYA 2CT1A 2EM4A 2A25A 2YTJA 2EOFA 1BBOA 2EMHA 2EPXA 2RPCA 2EMAA 1A1KA 3EPLA 2EN4A 2LVHA 2EN3A 1G2DC 1MEYC 2GLIA 2DRPA 1X6EA 3MHSC 1DGCA 5KL3A 1JK1A 2EN2A 1G2FC 2EMCA 2EN1A 2EOHA 4R2SA 1ZR9A 2YTGA 1F2IG 2YTFA 2EP3A 4IJDA 2EMZA 1LLMC 2YU5A 2DLKA 2EOXA 4GZNC 2EL6A 2EPZA 2EORA 2EMFA 2EPCA 2RSIA 3EPHA 1A1GA 3EPKA 2VRDA 1ZAAC 2ELZA 2M9AA 4R2AA 2EOEA 2EE8A 2BB8A 2WCC3 2EM7A 2DGCA 2E72A 1A1JA 2MKDA 1WJPA 2EN6A 2EN7A 4FK5C 1BB8A 2EOMA 2EM5A 1P47A 2WBTA 5KL7A 2EM6A 2EL5A 2EM3A 2DLQA 2EM2A 2EMIA 5KL4A 2YTQA 5KL5A 2LCEA 4M9VC 2EMYA 2EOOA 1Z1BA 2LT7A 2EM8A 1UN6B 2EQ1A 2PRTA 2EOIA 2R1FA 4F6NA 1TF6A 1TN9A 2YTEA 1X6FA 2MKNA 2WBSA 2JP9A 2LV2A 1YSAC 2EQ3A 2CSHA 4F6MA 2EMBA 1X5WA 2CTDA 2YSPA 2ELYA 2EOJA 2EJ4A 1YUIA 2LO3A 2YTDA 4R2EA 4R2CA 3UK3C 4R2PA 1X6HA 2D9HA 1KJKA 2EOSA 3EPJA 1A1LA 1UBDC 2EPRA 2EQ0A 2ENCA 5KL2A 2EMKA 2YTNA 4F2JC 2EPPA
chains in the Genus database with same CATH superfamily
4JI1E 3VK6A 1XNRE 1X47A 1A1FA 2EPOA 3ADLA 3LMLA 2YT4A 3M99B 5FLXC 4TUGA 4DV7E 2EMGA 2ODRD 2EM0A 2YTPA 5KL6A 3T1YE 4LF6E 2EOQA 1AAYA 4NHRA 3C4BA 5AC4A 4DV4E 1ZBQA 4F9CB 4R2QA 1RMDA 4O5GA 5ADZA 2EPAA 5BR8E 1N36E 3K6QA 2NUEA 2EPMX 5LLQA 1WRJA 1NCSA 2YRHA 2HGHA 2RSMA 2ENAA 4LF7E 1PJSA 5AE1A 4NXNE 2CT1A 2YTJA 2EOFA 4Q28A 4X64E 2YZTA 4BC9A 3J81C 2JXPA 4F9BB 4RHBB 3HQ1A 2UU9E 2RPCA 5IT9C 1A1KA 3EPLA 4LTYA 2EN4A 4ZYGA 4DR5E 2JWOA 2EN3A 1G2DC 2CPNA 1X6EA 1JK1A 2EN1A 2EOHA 1ZR9A 5T6JA 3HPZA 3IWDA 4IJDA 2YU5A 2DLKA 4ZYEA 2WZOA 5F3WA 2EL6A 4DR6E 2MC6A 2LTSA 4JI0E 3THOB 3BBGA 2Q8UA 1ZAAC 4R2AA 2LJHA 4LFAE 3OTOE 2EE8A 1EKZA 2BB8A 2WCC3 2EM7A 1T39A 2MKDA 2EN6A 4GKKE 2HC5A 3KZYA 2EM5A 4DV3E 2UXDE 4X8WA 3IWCA 3C6KA 3P1XA 2JYAA 4F9AB 2EMYA 4R03A 2UXBE 4TUIA 2EOIA 3ADGA 4F6NA 1TF6A 1TN9A 2F8BA 4J8ZA 4X62E 4GKJE 2DIXA 2DSYA 1GTKA 1T4LB 2E1MA 2EMBA 1YUIA 1HNXE 2LJUA 2V86A 2B3TB 1EH8A 3EPJA 4OOGC 2EPRA 3ADIA 2N3HA 2EPPA 3MHHC 2EOZA 4IS1C 2EMLA 5TSEA 2L3CA 1XMOE 2RS7A 2UXCE 2EMWA 2JY9A 1T38A 2ENHA 2E5LE 2YRMA 3ECRA 2J7JA 1A1IA 4KZSA 3F6HA 1I94E 1JK2A 4N4RB 4L8NA 1HNZE 1B69A 4JV5E 1T4OA 2JOBA 2JPAA 2BBGA 5IWAE 1EH6A 1IMUA 2EM9A 4F54A 3VYXA 2DMYA 4JYAE 4JI6E 1J5EE 4O24A 1X48A 2EM4A 3L00A 2A25A 4LF4E 1BBOA 5A6BA 2L6MA 1WXRA 2K7IA 3ADJA 5A6AA 2LVHA 3EQ1A 3BGHA 1MEYC 5AE2A 2L92A 4NZVA 4DR1E 4LFCE 3KWRA 3MHSC 2V89A 4DV2E 4YHHE 1SFEA 4WXDA 1IQOA 2R76A 4BC7A 2JVAA 5LL6R 1N3GA 1FKAE 4NXME 4B3SE 2RSIA 3BF2A 3KZZA 2M7QA 2ELZA 2M9AA 2UUCE 2EOEA 2VF1A 1IBKE 4Q35B 2DGCA 3HPSA 1QU6A 4B3TE 2EOMA 4DV0E 2HHHE 4WYQB 2VQEE 2LRSA 2EL5A 2B7TA 4BHBA 2EM2A 2IHR1 2B9DA 3QG5C 5KL4A 2YTQA 4X66E 4M2ZA 2L2KB 2EQ1A 4BCAA 3C6MA 4P78A 1YYKA 2L2NA 4LF9E 2LV2A 1YSAC 3J80C 5LMNE 1XMQE 4I8OA 2ELYA 4O4KA 2EJ4A 2FGGA 4DKKA 2YWQA 2LO3A 4R2EA 3JAMC 2LTRA 3AV0A 1KJKA 2L8TA 4R2PA 1YFHA 2EOSA 1A1LA 1IQSA 2RS6A 4F2JC 2YSOA 1T4NA 3DJWA 2GHFA 2DMIA 2I13A 2HJJA 2JOXA 2RTXA 1NEIA 2ZM6E 1A1HA 2EZ6A 4DR4E 2YTOA 2EMXA 4MLQA 3C4TA 4DUYE 2V85A 2YU8A 2WBUA 4HEIA 1L4SA 1YZ9A 3RMPA 1KYQA 4WSGA 4JI7E 4WX9A 4X9JA 4L5NC 4WSPA 4R2DA 4WFTA 5AE3A 1WHNA 2EOYA 2EMHA 1N33E 2EWLA 1AH5A 4LU9A 4WPYA 4BS9A 4B3RE 2N3GA 2I9IA 5A69A 4R8OA 2KHXA 4DR2E 1STUA 1IBLE 4DR3E 2GLIA 2DRPA 3JU0A 2KOUA 2FV4B 2LUQA 3J7Yp 2YTGA 1UILA 2EMZA 1LLMC 5AC5A 4GZNC 1N32E 2EMFA 4DV6E 4BHCA 2NA2A 2FTXB 2UUAE 2VRDA 4X65E 1GQEA 1ZBTA 4RH8A 4LFBE 2V8QB 4BBYA 1WJPA 5AASA 4FK5C 4HTGA 1RC7A 2WBTA 5KL7A 2EM6A 2EM3A 2DB2A 2EMIA 1YYOA 5DNYA 3JTZA 5KL5A 4M9VC 2EOOA 1Z1BA 4KHPE 2LT7A 1UN6B 2PRTA 3THNA 4B3ME 2L3JA 2B7VA 2R1FA 2N8XA 2YTEA 1X6FA 2MKNA 2WBSA 2M1SA 2L33A 3FIGA 1X5WA 4DUZE 2CTDA 2YSPA 4DMIA 2EOJA 3VYYA 1HNWE 2YTDA 4WXCA 1EH7A 2D9HA 4M30A 3AUZA 2EQ0A 2ENCA 3J7AG 4LF8E 2EMKA 4MLVA 4GEQB 2ADRA 5IV8B 4R2RA 2RQLA 5A6KA 1FJGE 2YTIA 2YRKA 2MDRA 1X3CA 2UUBE 2EPUA 1TF3A 1HR0E 1J26A 2EPKX 3VHTB 4BMJA 5A6BD 2LE2A 2EL4A 1ZU1A 2MDGA 3T1HE 4K0KE 4O43A 2NUGA 5IXMB 5LMUE 3LLHA 1PJTA 4ZYHA 4JI5E 1YUJA 2EN8A 2V83A 1YYWA 2M4IA 2NABA 1WHQA 4JI2E 1MGTA 2VE7C 2EPXA 2EMAA 2EPLX 4P7DA 1XNQE 1GZ6A 2V88A 2L2MA 3IWBA 3MSWA 1UHZA 4DV1E 1PKPA 1DGCA 1PJQA 5KL3A 2EN2A 1G2FC 2EMCA 1SR9A 4DR7E 4R2SA 2EPNA 1F2IG 2YTFA 4AQYE 2EP3A 2LBSB 1N34E 1YPNA 2EOXA 5CFFE 2EPZA 2EORA 2EPCA 2VQFE 2F4VE 2G7HA 3F6GA 1O0WA 3EPHA 1A1GA 3EPKA 2ODRC 2K4VA 2E72A 1A1JA 4KWYA 3H09A 2EN7A 1QNTA 2V87A 5A6JA 1BB8A 1RQ0A 1P47A 3DF6A 4M0VA 2LMZA 3HXLA 2H36X 2DLQA 1PDAA 2GPIA 3TQMA 2KONA 2LCEA 4JI8E 4YY3E 2EM8A 2LUPB 5A2QC 2JP9A 4JI4E 2MC5A 1DI2A 4OX9E 3HTXA 1DQ3A 2EQ3A 4JI3E 2CSHA 4F6MA 4LF5E 3OMLA 1BBGA 2NUFA 4R2CA 4ZYDA 1X49A 3UK3C 1X6HA 3ZOQB 3BIDA 1UBDC 4DV5E 2YPNA 5KL2A 2YTNA 1IBME 2JR1A
chains in the Genus database with same CATH topology
2YSOA 3MHHC 2EOZA 2ADRA 4IS1C 2EMLA 4R2RA 2GHFA 2DMIA 1A1FA 2I13A 2EMWA 2YTIA 2YRKA 3M99B 1A1HA 2ENHA 2YRMA 2EMGA 2YTOA 2EMXA 2EM0A 1X3CA 2J7JA 2EPUA 2YTPA 5KL6A 1A1IA 2EOQA 1AAYA 1JK2A 1TF3A 2YU8A 2WBUA 1B69A 3VHTB 4R2QA 1RMDA 2EL4A 1ZU1A 2EPAA 2MDGA 2JPAA 4WSGA 4X9JA 1NCSA 2EM9A 2YRHA 4R2DA 2HGHA 1YUJA 2EN8A 2NABA 2ENAA 2EOYA 2CT1A 2EM4A 2A25A 2YTJA 2EOFA 1BBOA 2EMHA 2EPXA 2RPCA 2EMAA 1A1KA 3EPLA 2EN4A 2LVHA 2EN3A 1G2DC 1MEYC 2GLIA 2DRPA 1X6EA 3MHSC 1DGCA 5KL3A 1JK1A 2EN2A 1G2FC 2EMCA 2EN1A 2EOHA 4R2SA 1ZR9A 2YTGA 1F2IG 2YTFA 2EP3A 4IJDA 2EMZA 1LLMC 2YU5A 2DLKA 2EOXA 4GZNC 2EL6A 2EPZA 2EORA 2EMFA 2EPCA 2RSIA 3EPHA 1A1GA 3EPKA 2VRDA 1ZAAC 2ELZA 2M9AA 4R2AA 2EOEA 2EE8A 2BB8A 2WCC3 2EM7A 2DGCA 2E72A 1A1JA 2MKDA 1WJPA 2EN6A 2EN7A 4FK5C 1BB8A 2EOMA 2EM5A 1P47A 2WBTA 5KL7A 2EM6A 2EL5A 2EM3A 2DLQA 2EM2A 2EMIA 5KL4A 2YTQA 5KL5A 2LCEA 4M9VC 2EMYA 2EOOA 1Z1BA 2LT7A 2EM8A 1UN6B 2EQ1A 2PRTA 2EOIA 2R1FA 4F6NA 1TF6A 1TN9A 2YTEA 1X6FA 2MKNA 2WBSA 2JP9A 2LV2A 1YSAC 2EQ3A 2CSHA 4F6MA 2EMBA 1X5WA 2CTDA 2YSPA 2ELYA 2EOJA 2EJ4A 1YUIA 2LO3A 2YTDA 4R2EA 4R2CA 3UK3C 4R2PA 1X6HA 2D9HA 1KJKA 2EOSA 3EPJA 1A1LA 1UBDC 2EPRA 2EQ0A 2ENCA 5KL2A 2EMKA 2YTNA 4F2JC 2EPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSO A;  3MHH C;  2EOZ A;  2ADR A;  4IS1 C;  2EML A;  4R2R A;  2GHF A;  2DMI A;  1A1F A;  2I13 A;  2EMW A;  2YTI A;  2YRK A;  3M99 B;  1A1H A;  2ENH A;  2YRM A;  2EMG A;  2YTO A;  2EMX A;  2EM0 A;  1X3C A;  2J7J A;  2EPU A;  2YTP A;  5KL6 A;  1A1I A;  2EOQ A;  1AAY A;  1JK2 A;  1TF3 A;  2YU8 A;  2WBU A;  1B69 A;  3VHT B;  4R2Q A;  1RMD A;  2EL4 A;  1ZU1 A;  2EPA A;  2MDG A;  2JPA A;  4WSG A;  4X9J A;  1NCS A;  2EM9 A;  2YRH A;  4R2D A;  2HGH A;  1YUJ A;  2EN8 A;  2NAB A;  2ENA A;  2EOY A;  2CT1 A;  2EM4 A;  2A25 A;  2YTJ A;  2EOF A;  1BBO A;  2EMH A;  2EPX A;  2RPC A;  2EMA A;  1A1K A;  3EPL A;  2EN4 A;  2LVH A;  2EN3 A;  1G2D C;  1MEY C;  2GLI A;  2DRP A;  1X6E A;  3MHS C;  1DGC A;  5KL3 A;  1JK1 A;  2EN2 A;  1G2F C;  2EMC A;  2EN1 A;  2EOH A;  4R2S A;  1ZR9 A;  2YTG A;  1F2I G;  2YTF A;  2EP3 A;  4IJD A;  2EMZ A;  1LLM C;  2YU5 A;  2DLK A;  2EOX A;  4GZN C;  2EL6 A;  2EPZ A;  2EOR A;  2EMF A;  2EPC A;  2RSI A;  3EPH A;  1A1G A;  3EPK A;  2VRD A;  1ZAA C;  2ELZ A;  2M9A A;  4R2A A;  2EOE A;  2EE8 A;  2BB8 A;  2WCC 3;  2EM7 A;  2DGC A;  2E72 A;  1A1J A;  2MKD A;  1WJP A;  2EN6 A;  2EN7 A;  4FK5 C;  1BB8 A;  2EOM A;  2EM5 A;  1P47 A;  2WBT A;  5KL7 A;  2EM6 A;  2EL5 A;  2EM3 A;  2DLQ A;  2EM2 A;  2EMI A;  5KL4 A;  2YTQ A;  5KL5 A;  2LCE A;  4M9V C;  2EMY A;  2EOO A;  1Z1B A;  2LT7 A;  2EM8 A;  1UN6 B;  2EQ1 A;  2PRT A;  2EOI A;  2R1F A;  4F6N A;  1TF6 A;  1TN9 A;  2YTE A;  1X6F A;  2MKN A;  2WBS A;  2JP9 A;  2LV2 A;  1YSA C;  2EQ3 A;  2CSH A;  4F6M A;  2EMB A;  1X5W A;  2CTD A;  2YSP A;  2ELY A;  2EOJ A;  2EJ4 A;  1YUI A;  2LO3 A;  2YTD A;  4R2E A;  4R2C A;  3UK3 C;  4R2P A;  1X6H A;  2D9H A;  1KJK A;  2EOS A;  3EPJ A;  1A1L A;  1UBD C;  2EPR A;  2EQ0 A;  2ENC A;  5KL2 A;  2EMK A;  2YTN A;  4F2J C;  2EPP A; 
#chains in the Genus database with same CATH topology
 4JI1 E;  3VK6 A;  1XNR E;  1X47 A;  1A1F A;  2EPO A;  3ADL A;  3LML A;  2YT4 A;  3M99 B;  5FLX C;  4TUG A;  4DV7 E;  2EMG A;  2ODR D;  2EM0 A;  2YTP A;  5KL6 A;  3T1Y E;  4LF6 E;  2EOQ A;  1AAY A;  4NHR A;  3C4B A;  5AC4 A;  4DV4 E;  1ZBQ A;  4F9C B;  4R2Q A;  1RMD A;  4O5G A;  5ADZ A;  2EPA A;  5BR8 E;  1N36 E;  3K6Q A;  2NUE A;  2EPM X;  5LLQ A;  1WRJ A;  1NCS A;  2YRH A;  2HGH A;  2RSM A;  2ENA A;  4LF7 E;  1PJS A;  5AE1 A;  4NXN E;  2CT1 A;  2YTJ A;  2EOF A;  4Q28 A;  4X64 E;  2YZT A;  4BC9 A;  3J81 C;  2JXP A;  4F9B B;  4RHB B;  3HQ1 A;  2UU9 E;  2RPC A;  5IT9 C;  1A1K A;  3EPL A;  4LTY A;  2EN4 A;  4ZYG A;  4DR5 E;  2JWO A;  2EN3 A;  1G2D C;  2CPN A;  1X6E A;  1JK1 A;  2EN1 A;  2EOH A;  1ZR9 A;  5T6J A;  3HPZ A;  3IWD A;  4IJD A;  2YU5 A;  2DLK A;  4ZYE A;  2WZO A;  5F3W A;  2EL6 A;  4DR6 E;  2MC6 A;  2LTS A;  4JI0 E;  3THO B;  3BBG A;  2Q8U A;  1ZAA C;  4R2A A;  2LJH A;  4LFA E;  3OTO E;  2EE8 A;  1EKZ A;  2BB8 A;  2WCC 3;  2EM7 A;  1T39 A;  2MKD A;  2EN6 A;  4GKK E;  2HC5 A;  3KZY A;  2EM5 A;  4DV3 E;  2UXD E;  4X8W A;  3IWC A;  3C6K A;  3P1X A;  2JYA A;  4F9A B;  2EMY A;  4R03 A;  2UXB E;  4TUI A;  2EOI A;  3ADG A;  4F6N A;  1TF6 A;  1TN9 A;  2F8B A;  4J8Z A;  4X62 E;  4GKJ E;  2DIX A;  2DSY A;  1GTK A;  1T4L B;  2E1M A;  2EMB A;  1YUI A;  1HNX E;  2LJU A;  2V86 A;  2B3T B;  1EH8 A;  3EPJ A;  4OOG C;  2EPR A;  3ADI A;  2N3H A;  2EPP A;  3MHH C;  2EOZ A;  4IS1 C;  2EML A;  5TSE A;  2L3C A;  1XMO E;  2RS7 A;  2UXC E;  2EMW A;  2JY9 A;  1T38 A;  2ENH A;  2E5L E;  2YRM A;  3ECR A;  2J7J A;  1A1I A;  4KZS A;  3F6H A;  1I94 E;  1JK2 A;  4N4R B;  4L8N A;  1HNZ E;  1B69 A;  4JV5 E;  1T4O A;  2JOB A;  2JPA A;  2BBG A;  5IWA E;  1EH6 A;  1IMU A;  2EM9 A;  4F54 A;  3VYX A;  2DMY A;  4JYA E;  4JI6 E;  1J5E E;  4O24 A;  1X48 A;  2EM4 A;  3L00 A;  2A25 A;  4LF4 E;  1BBO A;  5A6B A;  2L6M A;  1WXR A;  2K7I A;  3ADJ A;  5A6A A;  2LVH A;  3EQ1 A;  3BGH A;  1MEY C;  5AE2 A;  2L92 A;  4NZV A;  4DR1 E;  4LFC E;  3KWR A;  3MHS C;  2V89 A;  4DV2 E;  4YHH E;  1SFE A;  4WXD A;  1IQO A;  2R76 A;  4BC7 A;  2JVA A;  5LL6 R;  1N3G A;  1FKA E;  4NXM E;  4B3S E;  2RSI A;  3BF2 A;  3KZZ A;  2M7Q A;  2ELZ A;  2M9A A;  2UUC E;  2EOE A;  2VF1 A;  1IBK E;  4Q35 B;  2DGC A;  3HPS A;  1QU6 A;  4B3T E;  2EOM A;  4DV0 E;  2HHH E;  4WYQ B;  2VQE E;  2LRS A;  2EL5 A;  2B7T A;  4BHB A;  2EM2 A;  2IHR 1;  2B9D A;  3QG5 C;  5KL4 A;  2YTQ A;  4X66 E;  4M2Z A;  2L2K B;  2EQ1 A;  4BCA A;  3C6M A;  4P78 A;  1YYK A;  2L2N A;  4LF9 E;  2LV2 A;  1YSA C;  3J80 C;  5LMN E;  1XMQ E;  4I8O A;  2ELY A;  4O4K A;  2EJ4 A;  2FGG A;  4DKK A;  2YWQ A;  2LO3 A;  4R2E A;  3JAM C;  2LTR A;  3AV0 A;  1KJK A;  2L8T A;  4R2P A;  1YFH A;  2EOS A;  1A1L A;  1IQS A;  2RS6 A;  4F2J C;  2YSO A;  1T4N A;  3DJW A;  2GHF A;  2DMI A;  2I13 A;  2HJJ A;  2JOX A;  2RTX A;  1NEI A;  2ZM6 E;  1A1H A;  2EZ6 A;  4DR4 E;  2YTO A;  2EMX A;  4MLQ A;  3C4T A;  4DUY E;  2V85 A;  2YU8 A;  2WBU A;  4HEI A;  1L4S A;  1YZ9 A;  3RMP A;  1KYQ A;  4WSG A;  4JI7 E;  4WX9 A;  4X9J A;  4L5N C;  4WSP A;  4R2D A;  4WFT A;  5AE3 A;  1WHN A;  2EOY A;  2EMH A;  1N33 E;  2EWL A;  1AH5 A;  4LU9 A;  4WPY A;  4BS9 A;  4B3R E;  2N3G A;  2I9I A;  5A69 A;  4R8O A;  2KHX A;  4DR2 E;  1STU A;  1IBL E;  4DR3 E;  2GLI A;  2DRP A;  3JU0 A;  2KOU A;  2FV4 B;  2LUQ A;  3J7Y p;  2YTG A;  1UIL A;  2EMZ A;  1LLM C;  5AC5 A;  4GZN C;  1N32 E;  2EMF A;  4DV6 E;  4BHC A;  2NA2 A;  2FTX B;  2UUA E;  2VRD A;  4X65 E;  1GQE A;  1ZBT A;  4RH8 A;  4LFB E;  2V8Q B;  4BBY A;  1WJP A;  5AAS A;  4FK5 C;  4HTG A;  1RC7 A;  2WBT A;  5KL7 A;  2EM6 A;  2EM3 A;  2DB2 A;  2EMI A;  1YYO A;  5DNY A;  3JTZ A;  5KL5 A;  4M9V C;  2EOO A;  1Z1B A;  4KHP E;  2LT7 A;  1UN6 B;  2PRT A;  3THN A;  4B3M E;  2L3J A;  2B7V A;  2R1F A;  2N8X A;  2YTE A;  1X6F A;  2MKN A;  2WBS A;  2M1S A;  2L33 A;  3FIG A;  1X5W A;  4DUZ E;  2CTD A;  2YSP A;  4DMI A;  2EOJ A;  3VYY A;  1HNW E;  2YTD A;  4WXC A;  1EH7 A;  2D9H A;  4M30 A;  3AUZ A;  2EQ0 A;  2ENC A;  3J7A G;  4LF8 E;  2EMK A;  4MLV A;  4GEQ B;  2ADR A;  5IV8 B;  4R2R A;  2RQL A;  5A6K A;  1FJG E;  2YTI A;  2YRK A;  2MDR A;  1X3C A;  2UUB E;  2EPU A;  1TF3 A;  1HR0 E;  1J26 A;  2EPK X;  3VHT B;  4BMJ A;  5A6B D;  2LE2 A;  2EL4 A;  1ZU1 A;  2MDG A;  3T1H E;  4K0K E;  4O43 A;  2NUG A;  5IXM B;  5LMU E;  3LLH A;  1PJT A;  4ZYH A;  4JI5 E;  1YUJ A;  2EN8 A;  2V83 A;  1YYW A;  2M4I A;  2NAB A;  1WHQ A;  4JI2 E;  1MGT A;  2VE7 C;  2EPX A;  2EMA A;  2EPL X;  4P7D A;  1XNQ E;  1GZ6 A;  2V88 A;  2L2M A;  3IWB A;  3MSW A;  1UHZ A;  4DV1 E;  1PKP A;  1DGC A;  1PJQ A;  5KL3 A;  2EN2 A;  1G2F C;  2EMC A;  1SR9 A;  4DR7 E;  4R2S A;  2EPN A;  1F2I G;  2YTF A;  4AQY E;  2EP3 A;  2LBS B;  1N34 E;  1YPN A;  2EOX A;  5CFF E;  2EPZ A;  2EOR A;  2EPC A;  2VQF E;  2F4V E;  2G7H A;  3F6G A;  1O0W A;  3EPH A;  1A1G A;  3EPK A;  2ODR C;  2K4V A;  2E72 A;  1A1J A;  4KWY A;  3H09 A;  2EN7 A;  1QNT A;  2V87 A;  5A6J A;  1BB8 A;  1RQ0 A;  1P47 A;  3DF6 A;  4M0V A;  2LMZ A;  3HXL A;  2H36 X;  2DLQ A;  1PDA A;  2GPI A;  3TQM A;  2KON A;  2LCE A;  4JI8 E;  4YY3 E;  2EM8 A;  2LUP B;  5A2Q C;  2JP9 A;  4JI4 E;  2MC5 A;  1DI2 A;  4OX9 E;  3HTX A;  1DQ3 A;  2EQ3 A;  4JI3 E;  2CSH A;  4F6M A;  4LF5 E;  3OML A;  1BBG A;  2NUF A;  4R2C A;  4ZYD A;  1X49 A;  3UK3 C;  1X6H A;  3ZOQ B;  3BID A;  1UBD C;  4DV5 E;  2YPN A;  5KL2 A;  2YTN A;  1IBM E;  2JR1 A; 
#chains in the Genus database with same CATH homology
 2YSO A;  3MHH C;  2EOZ A;  2ADR A;  4IS1 C;  2EML A;  4R2R A;  2GHF A;  2DMI A;  1A1F A;  2I13 A;  2EMW A;  2YTI A;  2YRK A;  3M99 B;  1A1H A;  2ENH A;  2YRM A;  2EMG A;  2YTO A;  2EMX A;  2EM0 A;  1X3C A;  2J7J A;  2EPU A;  2YTP A;  5KL6 A;  1A1I A;  2EOQ A;  1AAY A;  1JK2 A;  1TF3 A;  2YU8 A;  2WBU A;  1B69 A;  3VHT B;  4R2Q A;  1RMD A;  2EL4 A;  1ZU1 A;  2EPA A;  2MDG A;  2JPA A;  4WSG A;  4X9J A;  1NCS A;  2EM9 A;  2YRH A;  4R2D A;  2HGH A;  1YUJ A;  2EN8 A;  2NAB A;  2ENA A;  2EOY A;  2CT1 A;  2EM4 A;  2A25 A;  2YTJ A;  2EOF A;  1BBO A;  2EMH A;  2EPX A;  2RPC A;  2EMA A;  1A1K A;  3EPL A;  2EN4 A;  2LVH A;  2EN3 A;  1G2D C;  1MEY C;  2GLI A;  2DRP A;  1X6E A;  3MHS C;  1DGC A;  5KL3 A;  1JK1 A;  2EN2 A;  1G2F C;  2EMC A;  2EN1 A;  2EOH A;  4R2S A;  1ZR9 A;  2YTG A;  1F2I G;  2YTF A;  2EP3 A;  4IJD A;  2EMZ A;  1LLM C;  2YU5 A;  2DLK A;  2EOX A;  4GZN C;  2EL6 A;  2EPZ A;  2EOR A;  2EMF A;  2EPC A;  2RSI A;  3EPH A;  1A1G A;  3EPK A;  2VRD A;  1ZAA C;  2ELZ A;  2M9A A;  4R2A A;  2EOE A;  2EE8 A;  2BB8 A;  2WCC 3;  2EM7 A;  2DGC A;  2E72 A;  1A1J A;  2MKD A;  1WJP A;  2EN6 A;  2EN7 A;  4FK5 C;  1BB8 A;  2EOM A;  2EM5 A;  1P47 A;  2WBT A;  5KL7 A;  2EM6 A;  2EL5 A;  2EM3 A;  2DLQ A;  2EM2 A;  2EMI A;  5KL4 A;  2YTQ A;  5KL5 A;  2LCE A;  4M9V C;  2EMY A;  2EOO A;  1Z1B A;  2LT7 A;  2EM8 A;  1UN6 B;  2EQ1 A;  2PRT A;  2EOI A;  2R1F A;  4F6N A;  1TF6 A;  1TN9 A;  2YTE A;  1X6F A;  2MKN A;  2WBS A;  2JP9 A;  2LV2 A;  1YSA C;  2EQ3 A;  2CSH A;  4F6M A;  2EMB A;  1X5W A;  2CTD A;  2YSP A;  2ELY A;  2EOJ A;  2EJ4 A;  1YUI A;  2LO3 A;  2YTD A;  4R2E A;  4R2C A;  3UK3 C;  4R2P A;  1X6H A;  2D9H A;  1KJK A;  2EOS A;  3EPJ A;  1A1L A;  1UBD C;  2EPR A;  2EQ0 A;  2ENC A;  5KL2 A;  2EMK A;  2YTN A;  4F2J C;  2EPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...