2V88A

Crystal structure of rag2-phd finger in complex with h3r2me2sk4me2 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 14
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v88A01
2V85A 2V83A 2V87A 2V89A 2JWOA 2V88A 2V86A
chains in the Genus database with same CATH superfamily
3MSWA 2V85A 4LFAE 2ODRC 3BBGA 4WPYA 2DSYA 4BS9A 1WHQA 2LBSB 2L33A 1BBGA 5IXMB 2HGHA 4O24A 4NZVA 2M7QA 4JI4E 4BHBA 1DI2A 2UXBE 3EQ1A 5KL7A 4BC9A 1SFEA 1WRJA 5T6JA 1YPNA 2BBGA 3F6HA 2EMZA 5BR8E 1IBKE 1T39A 2EORA 2MDRA 2YT4A 2VE7C 3HTXA 4DV7E 2YU5A 2LUQA 1YYOA 2EPOA 1I94E 1A1KA 2ENAA 1JK2A 2EMHA 2EM6A 2FV4B 3BF2A 2YRKA 1X47A 3DF6A 2J7JA 4LF5E 1X48A 2LVHA 4JI6E 1J26A 3JU0A 4WSGA 2I13A 1RQ0A 1WJPA 1A1IA 1A1FA 2L3CA 5LMNE 2GPIA 1G2DC 4DUYE 2N3HA 5A6BA 1IQSA 4R2QA 4Q35B 1X6FA 2EOHA 2EPLX 2L8TA 4X9JA 2YWQA 2ENCA 2L92A 2BB8A 1YUIA 2JPAA 4X64E 4JI8E 4B3ME 1PKPA 4GKJE 2KOUA 3AUZA 2EPUA 2VRDA 1ZR9A 2LMZA 2EPRA 2HJJA 4M9VC 1ZBQA 2EPMX 5CFFE 2JVAA 2FGGA 2YTFA 2ZM6E 2EMXA 1T4LB 2K7IA 2N8XA 2B3TB 4LTYA 1GTKA 2R76A 1WHNA 1X49A 2EOFA 2JOXA 5LLQA 2EQ1A 2WZOA 4KZSA 2EMIA 3ECRA 1BBOA 4R2RA 2EQ0A 2YSOA 3K6QA 1JK1A 5A6JA 1IMUA 1QNTA 2EP3A 2V86A 1PJQA 4R03A 1WXRA 4Q28A 1XMQE 3BIDA 2EOXA 2EN6A 3MHSC 1IBME 1UBDC 2YTDA 1AH5A 1UHZA 1L4SA 2EE8A 3KWRA 2UUBE 1T4NA 2LJUA 5AC5A 2DB2A 1EH7A 2RSIA 2VF1A 2EMGA 4R2PA 4MLQA 1QU6A 2EL5A 5A6AA 4LFBE 4GZNC 2D9HA 3ZOQB 2DIXA 5KL3A 3HPZA 3IWCA 2EMBA 3EPKA 1PDAA 3HQ1A 2EZ6A 4DMIA 2L2MA 2DMYA 2HHHE 2EM0A 3THNA 2K4VA 5DNYA 4IJDA 2CT1A 2M4IA 4LF6E 1ZAAC 1XNQE 2EN3A 1N34E 2CSHA 1G2FC 4DR7E 2Q8UA 2V88A 1P47A 2EOOA 2EPCA 2NABA 2UUAE 2JXPA 2EM9A 4YY3E 4DKKA 4J8ZA 1RC7A 2EPKX 2YPNA 1YYKA 2NUGA 2NUEA 4O4KA 3VK6A 3VHTB 2LT7A 2EPZA 2YRMA 2KONA 2G7HA 3T1HE 4LF8E 2JOBA 3MHHC 4F9AB 1NEIA 2WCC3 3RMPA 4JI0E 2YTNA 2R1FA 2I9IA 2MKDA 3J7Yp 4NHRA 1KJKA 2LV2A 2VQFE 4WSPA 3H09A 2L2NA 3P1XA 1UN6B 2RS7A 2ENHA 4M0VA 1N32E 3HXLA 1IQOA 3EPLA 3VYXA 5A6BD 2EN7A 4B3RE 2LUPB 5KL5A 3LMLA 1SR9A 2EPPA 2EJ4A 4B3TE 2B7TA 1N36E 4HTGA 2RTXA 3ADJA 4R2DA 2ELZA 1FJGE 1HNZE 4DV6E 5LMUE 2EPXA 1DQ3A 3TQMA 3ADIA 1BB8A 2RSMA 4TUIA 2UUCE 5A2QC 3J7AG 2JYAA 1HNXE 4X8WA 2ADRA 2RQLA 4NXNE 4LU9A 4BCAA 2V87A 2M9AA 2YTEA 4OOGC 3JTZA 3DJWA 1ZU1A 4RHBB 2YTOA 1MGTA 2JP9A 2EPAA 2PRTA 5AE1A 1X6HA 4ZYEA 4NXME 4WXCA 4RH8A 1DGCA 4DV1E 1HR0E 2FTXB 3THOB 5FLXC 2HC5A 2EOSA 4ZYGA 4R2EA 2DRPA 2KHXA 4DR6E 3C6KA 2EOEA 4LFCE 2YTPA 3C4BA 4BHCA 1PJTA 2EM4A 4P78A 4WX9A 2EM2A 2MDGA 2LE2A 4F9BB 1EH6A 3FIGA 4MLVA 3AV0A 1IBLE 2MC5A 3JAMC 2EWLA 1X5WA 4DV0E 2RS6A 4DUZE 3J80C 4DR3E 2EN4A 1XMOE 2ELYA 4X66E 4P7DA 4F54A 2CTDA 1EH8A 1Z1BA 5KL4A 1T4OA 4R2SA 2JR1A 2JY9A 4FK5C 2NUFA 4TUGA 1PJSA 2JWOA 2EM3A 4YHHE 1YUJA 4R2AA 2IHR1 4JYAE 2UU9E 4KWYA 2EN8A 1YYWA 5IWAE 2EN2A 5AC4A 1T38A 1TN9A 4M2ZA 2EOZA 1N33E 2E1MA 1J5EE 1A1JA 2YTGA 3OTOE 4F6NA 4DR5E 2YTJA 3F6GA 3C6MA 4WFTA 2EN1A 4DR4E 2H36X 4OX9E 2L2KB 2F8BA 2EQ3A 2LTSA 4K0KE 1LLMC 1B69A 1AAYA 5KL6A 5AE3A 2LO3A 2M1SA 1STUA 4L5NC 4LF7E 2DGCA 4M30A 4GEQB 4N4RB 4DV2E 3M99B 3C4TA 1YZ9A 1TF3A 2L6MA 2YZTA 2EMFA 2LJHA 4O43A 3UK3C 2DLKA 5AE2A 4X62E 2EOYA 4IS1C 4L8NA 2EMKA 2B9DA 2E72A 2YSPA 1YSAC 2ODRD 5TSEA 4BC7A 4F9CB 2EMYA 2V8QB 1HNWE 5A69A 2UXCE 4KHPE 2DMIA 1UILA 5IT9C 2EL4A 2YTIA 2GLIA 3J81C 1ZBTA 1XNRE 2EMWA 3KZZA 2DLQA 2NA2A 3BGHA 4O5GA 2MKNA 2UXDE 3L00A 3EPHA 4ZYDA 3QG5C 2EL6A 1EKZA 5AASA 2EMLA 5IV8B 2MC6A 2WBUA 2EMCA 1GQEA 4WXDA 3IWDA 4GKKE 2CPNA 2WBSA 4DV4E 4R8OA 4DV3E 4HEIA 4DR1E 3VYYA 2EOIA 1RMDA 1N3GA 4JI3E 1YFHA 2EOJA 1X6EA 1A1HA 4JV5E 4F6MA 4I8OA 4AQYE 2N3GA 5LL6R 2EOMA 4R2CA 3ADLA 4DV5E 2V83A 3LLHA 2E5LE 1KYQA 2EM7A 2V89A 2VQEE 1GZ6A 2B7VA 2EM5A 1O0WA 4LF4E 2GHFA 1NCSA 2YRHA 3HPSA 5F3WA 1A1LA 1F2IG 1MEYC 2YTQA 1A1GA 2A25A 2EOQA 2YU8A 1TF6A 5A6KA 2LRSA 2L3JA 3OMLA 4DR2E 4X65E 3ADGA 2RPCA 4BBYA 2EMAA 4JI1E 2WBTA 4JI7E 4BMJA 4ZYHA 3IWBA 4B3SE 5ADZA 2LCEA 4WYQB 1X3CA 5KL2A 4F2JC 4JI5E 4LF9E 2EPNA 3EPJA 2LTRA 2F4VE 1FKAE 4JI2E 2EM8A 3KZYA 3T1YE
chains in the Genus database with same CATH topology
3MSWA 1HNZE 4DR4E 2V85A 2H36X 4Q28A 4R03A 1WXRA 2L2KB 5LMUE 2F8BA 1DQ3A 2LTSA 2ODRC 4WPYA 1XMQE 2DSYA 4K0KE 3ADIA 4BS9A 5AE3A 1WHQA 1IBME 2M1SA 1STUA 2RSMA 4L5NC 4TUIA 1UHZA 2UUCE 4M30A 5A2QC 4GEQB 4LF7E 3J7AG 4DV2E 3KWRA 2L33A 2LBSB 1T4NA 3C4TA 2UUBE 1HNXE 1YZ9A 2L6MA 2M7QA 2YZTA 4JI4E 2LJHA 2DB2A 1DI2A 2UXBE 4X8WA 2VF1A 5AE2A 4X62E 1QU6A 4BC9A 4L8NA 4LFBE 2B9DA 5T6JA 2ODRD 3F6HA 3ZOQB 5BR8E 4LU9A 4BCAA 1IBKE 2V87A 2DIXA 4NXNE 3HPZA 4BC7A 4F9CB 4DV6E 2MDRA 2YT4A 3IWCA 2VE7C 4OOGC 2V8QB 1HNWE 3HTXA 4DV7E 3JTZA 4KHPE 3DJWA 3HQ1A 2EZ6A 2UXCE 4DMIA 1UILA 2LUQA 1YYOA 2L2MA 2DMYA 5IT9C 2HHHE 1I94E 3J81C 2K4VA 1ZBTA 1XNRE 5AE1A 2FV4B 5DNYA 4NXME 1X47A 3DF6A 2M4IA 2NA2A 4LF6E 4LF5E 2UXDE 4DV1E 1X48A 1N34E 1HR0E 4JI6E 1XNQE 1J26A 3JU0A 1EKZA 5AASA 2FTXB 4DR7E 2V88A 1RQ0A 5FLXC 4LFAE 2MC6A 1GQEA 2KHXA 2L3CA 5LMNE 4DR6E 3IWDA 4LFCE 2UUAE 4DUYE 2N3HA 4GKKE 3C4BA 4YY3E 4DKKA 2CPNA 4J8ZA 4DV4E 4R8OA 1RC7A 4DV3E 4P78A 4DR1E 1YYKA 2NUGA 3VYYA 2L8TA 2NUEA 2LE2A 4F9BB 3VK6A 2L92A 3FIGA 4JV5E 4X64E 4JI8E 4B3ME 4I8OA 4AQYE 1PKPA 2N3GA 4GKJE 5LL6R 2KOUA 3AUZA 3AV0A 1IBLE 2KONA 2MC5A 2LMZA 2G7HA 3JAMC 3T1HE 2EWLA 4DV0E 1FJGE 3ADLA 4DV5E 2V83A 3LLHA 2RS6A 4DUZE 2E5LE 4OX9E 2V89A 2VQEE 4LF8E 1GZ6A 3J80C 4DR3E 2JOBA 3F6GA 1ZBQA 1XMOE 4F9AB 2B7VA 5CFFE 1O0WA 2JVAA 3RMPA 4JI0E 4LF4E 4X66E 3HPSA 2FGGA 3J7Yp 5F3WA 4P7DA 4F54A 2ZM6E 4WSPA 3H09A 2VQFE 2L2NA 3P1XA 2RS7A 1T4OA 1T4LB 2JR1A 4M0VA 1N32E 3HXLA 2JY9A 2NUFA 2B3TB 4LTYA 4TUGA 3VYXA 2LRSA 2L3JA 3OMLA 4DR2E 4B3RE 2JWOA 1WHNA 1X49A 4X65E 3ADGA 4YHHE 2JOXA 2IHR1 2LUPB 4JYAE 4BBYA 3LMLA 2UU9E 1SR9A 2WZOA 4JI1E 4JI7E 4BMJA 1YYWA 4KZSA 3IWBA 5IWAE 4B3TE 2B7TA 4B3SE 4M2ZA 1N33E 5ADZA 2E1MA 1J5EE 3K6QA 4WYQB 1N36E 4LF9E 3OTOE 4JI5E 2RTXA 2LTRA 3ADJA 2F4VE 1FKAE 4JI2E 4JI3E 4DR5E 2V86A 3T1YE 4WFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V85 A;  2V83 A;  2V87 A;  2V89 A;  2JWO A;  2V88 A;  2V86 A; 
#chains in the Genus database with same CATH topology
 3MSW A;  2V85 A;  4LFA E;  2ODR C;  3BBG A;  4WPY A;  2DSY A;  4BS9 A;  1WHQ A;  2LBS B;  2L33 A;  1BBG A;  5IXM B;  2HGH A;  4O24 A;  4NZV A;  2M7Q A;  4JI4 E;  4BHB A;  1DI2 A;  2UXB E;  3EQ1 A;  5KL7 A;  4BC9 A;  1SFE A;  1WRJ A;  5T6J A;  1YPN A;  2BBG A;  3F6H A;  2EMZ A;  5BR8 E;  1IBK E;  1T39 A;  2EOR A;  2MDR A;  2YT4 A;  2VE7 C;  3HTX A;  4DV7 E;  2YU5 A;  2LUQ A;  1YYO A;  2EPO A;  1I94 E;  1A1K A;  2ENA A;  1JK2 A;  2EMH A;  2EM6 A;  2FV4 B;  3BF2 A;  2YRK A;  1X47 A;  3DF6 A;  2J7J A;  4LF5 E;  1X48 A;  2LVH A;  4JI6 E;  1J26 A;  3JU0 A;  4WSG A;  2I13 A;  1RQ0 A;  1WJP A;  1A1I A;  1A1F A;  2L3C A;  5LMN E;  2GPI A;  1G2D C;  4DUY E;  2N3H A;  5A6B A;  1IQS A;  4R2Q A;  4Q35 B;  1X6F A;  2EOH A;  2EPL X;  2L8T A;  4X9J A;  2YWQ A;  2ENC A;  2L92 A;  2BB8 A;  1YUI A;  2JPA A;  4X64 E;  4JI8 E;  4B3M E;  1PKP A;  4GKJ E;  2KOU A;  3AUZ A;  2EPU A;  2VRD A;  1ZR9 A;  2LMZ A;  2EPR A;  2HJJ A;  4M9V C;  1ZBQ A;  2EPM X;  5CFF E;  2JVA A;  2FGG A;  2YTF A;  2ZM6 E;  2EMX A;  1T4L B;  2K7I A;  2N8X A;  2B3T B;  4LTY A;  1GTK A;  2R76 A;  1WHN A;  1X49 A;  2EOF A;  2JOX A;  5LLQ A;  2EQ1 A;  2WZO A;  4KZS A;  2EMI A;  3ECR A;  1BBO A;  4R2R A;  2EQ0 A;  2YSO A;  3K6Q A;  1JK1 A;  5A6J A;  1IMU A;  1QNT A;  2EP3 A;  2V86 A;  1PJQ A;  4R03 A;  1WXR A;  4Q28 A;  1XMQ E;  3BID A;  2EOX A;  2EN6 A;  3MHS C;  1IBM E;  1UBD C;  2YTD A;  1AH5 A;  1UHZ A;  1L4S A;  2EE8 A;  3KWR A;  2UUB E;  1T4N A;  2LJU A;  5AC5 A;  2DB2 A;  1EH7 A;  2RSI A;  2VF1 A;  2EMG A;  4R2P A;  4MLQ A;  1QU6 A;  2EL5 A;  5A6A A;  4LFB E;  4GZN C;  2D9H A;  3ZOQ B;  2DIX A;  5KL3 A;  3HPZ A;  3IWC A;  2EMB A;  3EPK A;  1PDA A;  3HQ1 A;  2EZ6 A;  4DMI A;  2L2M A;  2DMY A;  2HHH E;  2EM0 A;  3THN A;  2K4V A;  5DNY A;  4IJD A;  2CT1 A;  2M4I A;  4LF6 E;  1ZAA C;  1XNQ E;  2EN3 A;  1N34 E;  2CSH A;  1G2F C;  4DR7 E;  2Q8U A;  2V88 A;  1P47 A;  2EOO A;  2EPC A;  2NAB A;  2UUA E;  2JXP A;  2EM9 A;  4YY3 E;  4DKK A;  4J8Z A;  1RC7 A;  2EPK X;  2YPN A;  1YYK A;  2NUG A;  2NUE A;  4O4K A;  3VK6 A;  3VHT B;  2LT7 A;  2EPZ A;  2YRM A;  2KON A;  2G7H A;  3T1H E;  4LF8 E;  2JOB A;  3MHH C;  4F9A B;  1NEI A;  2WCC 3;  3RMP A;  4JI0 E;  2YTN A;  2R1F A;  2I9I A;  2MKD A;  3J7Y p;  4NHR A;  1KJK A;  2LV2 A;  2VQF E;  4WSP A;  3H09 A;  2L2N A;  3P1X A;  1UN6 B;  2RS7 A;  2ENH A;  4M0V A;  1N32 E;  3HXL A;  1IQO A;  3EPL A;  3VYX A;  5A6B D;  2EN7 A;  4B3R E;  2LUP B;  5KL5 A;  3LML A;  1SR9 A;  2EPP A;  2EJ4 A;  4B3T E;  2B7T A;  1N36 E;  4HTG A;  2RTX A;  3ADJ A;  4R2D A;  2ELZ A;  1FJG E;  1HNZ E;  4DV6 E;  5LMU E;  2EPX A;  1DQ3 A;  3TQM A;  3ADI A;  1BB8 A;  2RSM A;  4TUI A;  2UUC E;  5A2Q C;  3J7A G;  2JYA A;  1HNX E;  4X8W A;  2ADR A;  2RQL A;  4NXN E;  4LU9 A;  4BCA A;  2V87 A;  2M9A A;  2YTE A;  4OOG C;  3JTZ A;  3DJW A;  1ZU1 A;  4RHB B;  2YTO A;  1MGT A;  2JP9 A;  2EPA A;  2PRT A;  5AE1 A;  1X6H A;  4ZYE A;  4NXM E;  4WXC A;  4RH8 A;  1DGC A;  4DV1 E;  1HR0 E;  2FTX B;  3THO B;  5FLX C;  2HC5 A;  2EOS A;  4ZYG A;  4R2E A;  2DRP A;  2KHX A;  4DR6 E;  3C6K A;  2EOE A;  4LFC E;  2YTP A;  3C4B A;  4BHC A;  1PJT A;  2EM4 A;  4P78 A;  4WX9 A;  2EM2 A;  2MDG A;  2LE2 A;  4F9B B;  1EH6 A;  3FIG A;  4MLV A;  3AV0 A;  1IBL E;  2MC5 A;  3JAM C;  2EWL A;  1X5W A;  4DV0 E;  2RS6 A;  4DUZ E;  3J80 C;  4DR3 E;  2EN4 A;  1XMO E;  2ELY A;  4X66 E;  4P7D A;  4F54 A;  2CTD A;  1EH8 A;  1Z1B A;  5KL4 A;  1T4O A;  4R2S A;  2JR1 A;  2JY9 A;  4FK5 C;  2NUF A;  4TUG A;  1PJS A;  2JWO A;  2EM3 A;  4YHH E;  1YUJ A;  4R2A A;  2IHR 1;  4JYA E;  2UU9 E;  4KWY A;  2EN8 A;  1YYW A;  5IWA E;  2EN2 A;  5AC4 A;  1T38 A;  1TN9 A;  4M2Z A;  2EOZ A;  1N33 E;  2E1M A;  1J5E E;  1A1J A;  2YTG A;  3OTO E;  4F6N A;  4DR5 E;  2YTJ A;  3F6G A;  3C6M A;  4WFT A;  2EN1 A;  4DR4 E;  2H36 X;  4OX9 E;  2L2K B;  2F8B A;  2EQ3 A;  2LTS A;  4K0K E;  1LLM C;  1B69 A;  1AAY A;  5KL6 A;  5AE3 A;  2LO3 A;  2M1S A;  1STU A;  4L5N C;  4LF7 E;  2DGC A;  4M30 A;  4GEQ B;  4N4R B;  4DV2 E;  3M99 B;  3C4T A;  1YZ9 A;  1TF3 A;  2L6M A;  2YZT A;  2EMF A;  2LJH A;  4O43 A;  3UK3 C;  2DLK A;  5AE2 A;  4X62 E;  2EOY A;  4IS1 C;  4L8N A;  2EMK A;  2B9D A;  2E72 A;  2YSP A;  1YSA C;  2ODR D;  5TSE A;  4BC7 A;  4F9C B;  2EMY A;  2V8Q B;  1HNW E;  5A69 A;  2UXC E;  4KHP E;  2DMI A;  1UIL A;  5IT9 C;  2EL4 A;  2YTI A;  2GLI A;  3J81 C;  1ZBT A;  1XNR E;  2EMW A;  3KZZ A;  2DLQ A;  2NA2 A;  3BGH A;  4O5G A;  2MKN A;  2UXD E;  3L00 A;  3EPH A;  4ZYD A;  3QG5 C;  2EL6 A;  1EKZ A;  5AAS A;  2EML A;  5IV8 B;  2MC6 A;  2WBU A;  2EMC A;  1GQE A;  4WXD A;  3IWD A;  4GKK E;  2CPN A;  2WBS A;  4DV4 E;  4R8O A;  4DV3 E;  4HEI A;  4DR1 E;  3VYY A;  2EOI A;  1RMD A;  1N3G A;  4JI3 E;  1YFH A;  2EOJ A;  1X6E A;  1A1H A;  4JV5 E;  4F6M A;  4I8O A;  4AQY E;  2N3G A;  5LL6 R;  2EOM A;  4R2C A;  3ADL A;  4DV5 E;  2V83 A;  3LLH A;  2E5L E;  1KYQ A;  2EM7 A;  2V89 A;  2VQE E;  1GZ6 A;  2B7V A;  2EM5 A;  1O0W A;  4LF4 E;  2GHF A;  1NCS A;  2YRH A;  3HPS A;  5F3W A;  1A1L A;  1F2I G;  1MEY C;  2YTQ A;  1A1G A;  2A25 A;  2EOQ A;  2YU8 A;  1TF6 A;  5A6K A;  2LRS A;  2L3J A;  3OML A;  4DR2 E;  4X65 E;  3ADG A;  2RPC A;  4BBY A;  2EMA A;  4JI1 E;  2WBT A;  4JI7 E;  4BMJ A;  4ZYH A;  3IWB A;  4B3S E;  5ADZ A;  2LCE A;  4WYQ B;  1X3C A;  5KL2 A;  4F2J C;  4JI5 E;  4LF9 E;  2EPN A;  3EPJ A;  2LTR A;  2F4V E;  1FKA E;  4JI2 E;  2EM8 A;  3KZY A;  3T1Y E; 
#chains in the Genus database with same CATH homology
 3MSW A;  1HNZ E;  4DR4 E;  2V85 A;  2H36 X;  4Q28 A;  4R03 A;  1WXR A;  2L2K B;  5LMU E;  2F8B A;  1DQ3 A;  2LTS A;  2ODR C;  4WPY A;  1XMQ E;  2DSY A;  4K0K E;  3ADI A;  4BS9 A;  5AE3 A;  1WHQ A;  1IBM E;  2M1S A;  1STU A;  2RSM A;  4L5N C;  4TUI A;  1UHZ A;  2UUC E;  4M30 A;  5A2Q C;  4GEQ B;  4LF7 E;  3J7A G;  4DV2 E;  3KWR A;  2L33 A;  2LBS B;  1T4N A;  3C4T A;  2UUB E;  1HNX E;  1YZ9 A;  2L6M A;  2M7Q A;  2YZT A;  4JI4 E;  2LJH A;  2DB2 A;  1DI2 A;  2UXB E;  4X8W A;  2VF1 A;  5AE2 A;  4X62 E;  1QU6 A;  4BC9 A;  4L8N A;  4LFB E;  2B9D A;  5T6J A;  2ODR D;  3F6H A;  3ZOQ B;  5BR8 E;  4LU9 A;  4BCA A;  1IBK E;  2V87 A;  2DIX A;  4NXN E;  3HPZ A;  4BC7 A;  4F9C B;  4DV6 E;  2MDR A;  2YT4 A;  3IWC A;  2VE7 C;  4OOG C;  2V8Q B;  1HNW E;  3HTX A;  4DV7 E;  3JTZ A;  4KHP E;  3DJW A;  3HQ1 A;  2EZ6 A;  2UXC E;  4DMI A;  1UIL A;  2LUQ A;  1YYO A;  2L2M A;  2DMY A;  5IT9 C;  2HHH E;  1I94 E;  3J81 C;  2K4V A;  1ZBT A;  1XNR E;  5AE1 A;  2FV4 B;  5DNY A;  4NXM E;  1X47 A;  3DF6 A;  2M4I A;  2NA2 A;  4LF6 E;  4LF5 E;  2UXD E;  4DV1 E;  1X48 A;  1N34 E;  1HR0 E;  4JI6 E;  1XNQ E;  1J26 A;  3JU0 A;  1EKZ A;  5AAS A;  2FTX B;  4DR7 E;  2V88 A;  1RQ0 A;  5FLX C;  4LFA E;  2MC6 A;  1GQE A;  2KHX A;  2L3C A;  5LMN E;  4DR6 E;  3IWD A;  4LFC E;  2UUA E;  4DUY E;  2N3H A;  4GKK E;  3C4B A;  4YY3 E;  4DKK A;  2CPN A;  4J8Z A;  4DV4 E;  4R8O A;  1RC7 A;  4DV3 E;  4P78 A;  4DR1 E;  1YYK A;  2NUG A;  3VYY A;  2L8T A;  2NUE A;  2LE2 A;  4F9B B;  3VK6 A;  2L92 A;  3FIG A;  4JV5 E;  4X64 E;  4JI8 E;  4B3M E;  4I8O A;  4AQY E;  1PKP A;  2N3G A;  4GKJ E;  5LL6 R;  2KOU A;  3AUZ A;  3AV0 A;  1IBL E;  2KON A;  2MC5 A;  2LMZ A;  2G7H A;  3JAM C;  3T1H E;  2EWL A;  4DV0 E;  1FJG E;  3ADL A;  4DV5 E;  2V83 A;  3LLH A;  2RS6 A;  4DUZ E;  2E5L E;  4OX9 E;  2V89 A;  2VQE E;  4LF8 E;  1GZ6 A;  3J80 C;  4DR3 E;  2JOB A;  3F6G A;  1ZBQ A;  1XMO E;  4F9A B;  2B7V A;  5CFF E;  1O0W A;  2JVA A;  3RMP A;  4JI0 E;  4LF4 E;  4X66 E;  3HPS A;  2FGG A;  3J7Y p;  5F3W A;  4P7D A;  4F54 A;  2ZM6 E;  4WSP A;  3H09 A;  2VQF E;  2L2N A;  3P1X A;  2RS7 A;  1T4O A;  1T4L B;  2JR1 A;  4M0V A;  1N32 E;  3HXL A;  2JY9 A;  2NUF A;  2B3T B;  4LTY A;  4TUG A;  3VYX A;  2LRS A;  2L3J A;  3OML A;  4DR2 E;  4B3R E;  2JWO A;  1WHN A;  1X49 A;  4X65 E;  3ADG A;  4YHH E;  2JOX A;  2IHR 1;  2LUP B;  4JYA E;  4BBY A;  3LML A;  2UU9 E;  1SR9 A;  2WZO A;  4JI1 E;  4JI7 E;  4BMJ A;  1YYW A;  4KZS A;  3IWB A;  5IWA E;  4B3T E;  2B7T A;  4B3S E;  4M2Z A;  1N33 E;  5ADZ A;  2E1M A;  1J5E E;  3K6Q A;  4WYQ B;  1N36 E;  4LF9 E;  3OTO E;  4JI5 E;  2RTX A;  2LTR A;  3ADJ A;  2F4V E;  1FKA E;  4JI2 E;  4JI3 E;  4DR5 E;  2V86 A;  3T1Y E;  4WFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...