2V88A

Crystal structure of rag2-phd finger in complex with h3r2me2sk4me2 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v88A01
2V88A 2V83A 2V87A 2V85A 2V86A 2JWOA 2V89A
chains in the Genus database with same CATH superfamily
2CT1A 4BMJA 5KL5A 2V85A 2EN8A 5AC4A 5A6KA 2EMHA 2EPRA 2L2NA 4JI0E 2B9DA 3VHTB 5LLQA 4R2RA 1G2DC 1T39A 4LF4E 2DRPA 2YTIA 2YRMA 1WHNA 2YRHA 2EOIA 2YT4A 2NA2A 5ADZA 2EM7A 4F2JC 2EQ3A 2MDRA 2CPNA 4GEQB 1YUJA 2E5LE 1EH6A 5BR8E 4R2CA 3C4TA 2YTJA 4AQYE 3KZZA 4N4RB 4DV6E 2EMFA 3DF6A 4GKKE 2ELYA 2EORA 4MLVA 1A1HA 4J8ZA 1PJSA 3LLHA 4DV1E 2UUBE 1YYWA 2M7QA 4O4KA 4WYQB 2NUGA 2L92A 1GTKA 1PJQA 2EM5A 2DLQA 5KL6A 4B3RE 2R76A 2JR1A 1SR9A 1X6FA 5F3WA 5A6BD 5AE3A 2L2KB 4WPYA 2EQ0A 2GHFA 4R2EA 4M9VC 1BBOA 4DV4E 2KONA 2JWOA 1TF6A 4WXCA 3VK6A 3H09A 3JTZA 4NHRA 4O24A 4Q35B 3HPZA 4DR5E 2EN1A 4O5GA 3MHHC 1TF3A 5LL6R 2YSOA 2EPMX 2LUQA 2M1SA 2R1FA 2EN7A 2EMBA 5A2QC 1PDAA 2N3HA 2RPCA 3UK3C 4YHHE 1XNQE 1MEYC 1QNTA 4BHBA 1Z1BA 2HJJA 4F9CB 2HC5A 2WBTA 5IWAE 2EPOA 1LLMC 4LTYA 2EMGA 4F9AB 2UXBE 4NZVA 2B3TB 1IQOA 3BGHA 4WSGA 1BBGA 2V83A 4X64E 4L5NC 5IXMB 3JU0A 3THOB 3VYYA 1T38A 2EM4A 2LRSA 2EM2A 3ZOQB 1IBLE 3AUZA 1XMOE 4ZYGA 2LE2A 2EE8A 4R2QA 2F4VE 2EMZA 4OX9E 1ZR9A 2YTFA 1PJTA 2E1MA 1N3GA 2M9AA 3ADIA 2L6MA 2EQ1A 1N33E 4DV0E 1T4LB 1HNZE 1WHQA 4DR1E 1FJGE 3VYXA 2EN6A 3F6HA 1YYOA 4GKJE 5A69A 1IMUA 2BB8A 2EM9A 4BCAA 4DR3E 4F54A 5IT9C 4K0KE 2KOUA 1A1GA 1A1JA 1HNXE 1YYKA 1RMDA 4JI6E 4X62E 2J7JA 1XMQE 1GZ6A 4BC7A 1ZBQA 4M0VA 2ODRC 2EMAA 1RC7A 3KWRA 2DIXA 2EPLX 2EL4A 2EOMA 3L00A 1WJPA 2YWQA 1BB8A 5FLXC 5DNYA 1X48A 2VF1A 4MLQA 3RMPA 2CSHA 1N32E 2WBUA 3M99B 4LFAE 4R2AA 3MSWA 2EM6A 2EOOA 2V86A 1SFEA 3IWCA 2MKDA 2YTDA 2EMLA 2YTOA 1AAYA 1UILA 2RSMA 4P7DA 4JI8E 4O43A 4BBYA 4DR2E 2YTNA 2EWLA 3HTXA 4R2DA 4F6NA 2JOXA 4JV5E 2D9HA 1WRJA 5AC5A 1TN9A 2FTXB 4KWYA 1KYQA 2UUAE 1F2IG 1X6EA 2V89A 3ADGA 2LJUA 2FV4B 4KHPE 2EL5A 4RH8A 2F8BA 2MC6A 2EOHA 2EOZA 1EH7A 1MGTA 2RS6A 2ENAA 2UUCE 4WSPA 1QU6A 1X3CA 3BF2A 4LF9E 2EMKA 3J7AG 1IBKE 4DUYE 1A1FA 2EOSA 2FGGA 2EMWA 2EOEA 1I94E 2JP9A 1PKPA 3ADLA 3QG5C 2GPIA 2EPPA 2UU9E 4JI2E 1EH8A 1YFHA 3FIGA 2JOBA 2LT7A 3EPHA 2WBSA 4R2PA 4LU9A 4HEIA 2EOFA 1NEIA 4Q28A 2EN4A 2RSIA 1X6HA 2K4VA 2MC5A 4ZYHA 1WXRA 2L3CA 1RQ0A 1T4NA 2L8TA 4NXME 3HQ1A 3ECRA 3T1HE 2DGCA 3DJWA 3F6GA 2LO3A 4JI3E 4B3ME 1A1IA 2YPNA 4DV2E 1FKAE 2EM3A 2RS7A 4LF8E 2EPCA 2MKNA 4LF6E 4B3SE 2ODRD 1ZBTA 3P1XA 1N36E 2DMYA 2LVHA 4DMIA 2WCC3 4HTGA 3BIDA 2YTGA 1P47A 2LJHA 3ADJA 4DV3E 2LTRA 3J81C 3C6KA 2EMIA 4L8NA 3TQMA 1JK2A 5T6JA 2EM0A 4NXNE 2UXCE 2H36X 4M2ZA 1IQSA 2L33A 1YUIA 4WXDA 3OMLA 2E72A 2Q8UA 2I13A 2JPAA 2WZOA 4BHCA 4IS1C 2HGHA 4DR4E 1YZ9A 3KZYA 4JYAE 2G7HA 2EJ4A 4R8OA 1G2FC 5KL4A 3EQ1A 5TSEA 2YZTA 2EPZA 5AE1A 2LCEA 2EL6A 4WX9A 1GQEA 2EOXA 2DB2A 1KJKA 2YTEA 2LV2A 1EKZA 4TUGA 1HNWE 2DSYA 4X66E 2EPAA 2B7TA 1X5WA 2PRTA 3C4BA 1O0WA 5AASA 4ZYDA 5LMNE 3J7Yp 2JVAA 4JI1E 3C6MA 2JY9A 2EMCA 1HR0E 3BBGA 2YTQA 4F6MA 3HXLA 1X47A 1A1KA 1YPNA 5A6BA 4DV7E 2CTDA 2V87A 5KL7A 3MHSC 4X65E 2VRDA 4DR6E 2ZM6E 2EOJA 2L2MA 4FK5C 3LMLA 4P78A 4LF7E 2LUPB 3T1YE 4DR7E 5LMUE 2EN3A 1B69A 4X9JA 4BS9A 3J80C 2KHXA 3OTOE 3K6QA 4F9BB 3EPKA 2UXDE 2YU5A 2EM8A 2MDGA 2BBGA 1A1LA 2EMYA 2EZ6A 2EP3A 2V8QB 1L4SA 2I9IA 5A6JA 2ADRA 3IWDA 4I8OA 2EOQA 3THNA 4LFCE 3AV0A 5KL2A 1N34E 4JI4E 4YY3E 1ZAAC 1X49A 2V88A 2DMIA 5IV8B 4TUIA 4KZSA 2B7VA 2A25A 2HHHE 1NCSA 4GZNC 4WFTA 5KL3A 1AH5A 1XNRE 2DLKA 4ZYEA 2K7IA 2ENHA 2N3GA 4B3TE 2VQEE 4DUZE 1STUA 2JXPA 4X8WA 1T4OA 2ENCA 4LF5E 2LMZA 1UN6B 1DQ3A 2LBSB 2ELZA 2EN2A 2VQFE 4BC9A 3JAMC 2NUFA 4JI7E 2RTXA 3HPSA 4IJDA 4LFBE 2L3JA 1UHZA 2N8XA 5CFFE 4M30A 4DV5E 3IWBA 1DGCA 2YRKA 2NUEA 4RHBB 2JYAA 2YSPA 2GLIA 1YSAC 1J5EE 1DI2A 2EOYA 4OOGC 4R03A 3EPLA 1JK1A 1IBME 5AE2A 3EPJA 2EPUA 4JI5E 2YU8A 2RQLA 4DKKA 1ZU1A 2EPXA 2YTPA 1J26A 2EPKX 2M4IA 4R2SA 2LTSA 2IHR1 2NABA 1UBDC 5A6AA 2EMXA 2EPNA 2VE7C
chains in the Genus database with same CATH topology
5IWAE 4LTYA 4DV7E 2UU9E 2V87A 4F9AB 4BMJA 4JI2E 4X65E 2UXBE 2V85A 2B3TB 4DR6E 2ZM6E 4B3SE 3FIGA 2V83A 4X64E 2JOBA 2L2NA 4L5NC 3VYYA 3JU0A 2L2MA 4JI0E 4JI4E 2B9DA 2LRSA 4LU9A 3LMLA 4P78A 3ZOQB 1IBLE 3AUZA 4LF4E 4LF7E 2LUPB 3T1YE 1XMOE 4Q28A 4DR7E 2LE2A 5LMUE 2F4VE 4OX9E 2K4VA 4BS9A 3J80C 2KHXA 2MC5A 2E1MA 1WXRA 1WHNA 2YT4A 3K6QA 2L6MA 4F9BB 3OTOE 2L3CA 3ADIA 1RQ0A 1N33E 2UXDE 1T4NA 2L8TA 2NA2A 5ADZA 3HQ1A 4DV0E 1T4LB 1HNZE 4NXME 2MDRA 1WHQA 4DR1E 1FJGE 3VYXA 3T1HE 2CPNA 3F6HA 3DJWA 1YYOA 4GEQB 3F6GA 4GKJE 5IT9C 4DR3E 4BCAA 2EZ6A 4F54A 2V8QB 2E5LE 2KOUA 4B3ME 4JI3E 4K0KE 4DV2E 1FKAE 1HNXE 1YYKA 5BR8E 2RS7A 4LF8E 3IWDA 4I8OA 4X62E 4JI6E 4LFCE 4LF6E 3AV0A 1XMQE 1GZ6A 3C4TA 4YY3E 2ODRD 1N34E 4BC7A 1ZBTA 1ZBQA 3P1XA 1X49A 4M0VA 1N36E 2DMYA 2ODRC 2V88A 4DMIA 4AQYE 4TUIA 4KZSA 2B7VA 1RC7A 3KWRA 4DV6E 2DIXA 2HHHE 3DF6A 4GKKE 4WFTA 1XNRE 4J8ZA 5FLXC 5DNYA 2LJHA 3ADJA 3LLHA 2N3GA 4B3TE 1X48A 4DV3E 2VF1A 4DV1E 2VQEE 2UUBE 4DUZE 2M7QA 1STUA 2LTRA 3RMPA 1N32E 3J81C 4X8WA 4WYQB 4LFAE 2L92A 2NUGA 3MSWA 1T4OA 2V86A 3IWCA 4LF5E 4L8NA 5T6JA 2LMZA 1DQ3A 4NXNE 2H36X 2LBSB 1UILA 2UXCE 4M2ZA 4B3RE 2RSMA 2JR1A 4P7DA 2VQFE 2L33A 4JI8E 4BC9A 1SR9A 3JAMC 3OMLA 2NUFA 5F3WA 4BBYA 2WZOA 4JI7E 4DR2E 3HTXA 2EWLA 2RTXA 3HPSA 5AE3A 2L2KB 1YZ9A 4DR4E 2JOXA 4LFBE 4JV5E 2L3JA 1UHZA 4JYAE 2G7HA 4WPYA 2FTXB 5CFFE 4R8OA 2UUAE 4M30A 4DV5E 3IWBA 2KONA 2JWOA 3ADGA 2V89A 4DV4E 1YYWA 2NUEA 2YZTA 5AE1A 2FV4B 3H09A 3VK6A 3JTZA 4KHPE 1GQEA 3HPZA 2DB2A 2F8BA 4DR5E 1J5EE 1DI2A 4OOGC 2MC6A 1EKZA 4R03A 2RS6A 5LL6R 4TUGA 1IBME 1HNWE 2DSYA 2LUQA 2M1SA 2B7TA 5AE2A 4X66E 2UUCE 4WSPA 4JI5E 1QU6A 3C4BA 1O0WA 4DKKA 5AASA 5A2QC 5LMNE 3J7Yp 2JVAA 4JI1E 2N3HA 1J26A 2M4IA 2JY9A 4LF9E 3J7AG 2LTSA 1IBKE 4YHHE 4DUYE 2IHR1 1XNQE 1HR0E 2FGGA 1I94E 3HXLA 3ADLA 1PKPA 1X47A 4F9CB 2VE7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V88 A;  2V83 A;  2V87 A;  2V85 A;  2V86 A;  2JWO A;  2V89 A; 
#chains in the Genus database with same CATH topology
 2CT1 A;  4BMJ A;  5KL5 A;  2V85 A;  2EN8 A;  5AC4 A;  5A6K A;  2EMH A;  2EPR A;  2L2N A;  4JI0 E;  2B9D A;  3VHT B;  5LLQ A;  4R2R A;  1G2D C;  1T39 A;  4LF4 E;  2DRP A;  2YTI A;  2YRM A;  1WHN A;  2YRH A;  2EOI A;  2YT4 A;  2NA2 A;  5ADZ A;  2EM7 A;  4F2J C;  2EQ3 A;  2MDR A;  2CPN A;  4GEQ B;  1YUJ A;  2E5L E;  1EH6 A;  5BR8 E;  4R2C A;  3C4T A;  2YTJ A;  4AQY E;  3KZZ A;  4N4R B;  4DV6 E;  2EMF A;  3DF6 A;  4GKK E;  2ELY A;  2EOR A;  4MLV A;  1A1H A;  4J8Z A;  1PJS A;  3LLH A;  4DV1 E;  2UUB E;  1YYW A;  2M7Q A;  4O4K A;  4WYQ B;  2NUG A;  2L92 A;  1GTK A;  1PJQ A;  2EM5 A;  2DLQ A;  5KL6 A;  4B3R E;  2R76 A;  2JR1 A;  1SR9 A;  1X6F A;  5F3W A;  5A6B D;  5AE3 A;  2L2K B;  4WPY A;  2EQ0 A;  2GHF A;  4R2E A;  4M9V C;  1BBO A;  4DV4 E;  2KON A;  2JWO A;  1TF6 A;  4WXC A;  3VK6 A;  3H09 A;  3JTZ A;  4NHR A;  4O24 A;  4Q35 B;  3HPZ A;  4DR5 E;  2EN1 A;  4O5G A;  3MHH C;  1TF3 A;  5LL6 R;  2YSO A;  2EPM X;  2LUQ A;  2M1S A;  2R1F A;  2EN7 A;  2EMB A;  5A2Q C;  1PDA A;  2N3H A;  2RPC A;  3UK3 C;  4YHH E;  1XNQ E;  1MEY C;  1QNT A;  4BHB A;  1Z1B A;  2HJJ A;  4F9C B;  2HC5 A;  2WBT A;  5IWA E;  2EPO A;  1LLM C;  4LTY A;  2EMG A;  4F9A B;  2UXB E;  4NZV A;  2B3T B;  1IQO A;  3BGH A;  4WSG A;  1BBG A;  2V83 A;  4X64 E;  4L5N C;  5IXM B;  3JU0 A;  3THO B;  3VYY A;  1T38 A;  2EM4 A;  2LRS A;  2EM2 A;  3ZOQ B;  1IBL E;  3AUZ A;  1XMO E;  4ZYG A;  2LE2 A;  2EE8 A;  4R2Q A;  2F4V E;  2EMZ A;  4OX9 E;  1ZR9 A;  2YTF A;  1PJT A;  2E1M A;  1N3G A;  2M9A A;  3ADI A;  2L6M A;  2EQ1 A;  1N33 E;  4DV0 E;  1T4L B;  1HNZ E;  1WHQ A;  4DR1 E;  1FJG E;  3VYX A;  2EN6 A;  3F6H A;  1YYO A;  4GKJ E;  5A69 A;  1IMU A;  2BB8 A;  2EM9 A;  4BCA A;  4DR3 E;  4F54 A;  5IT9 C;  4K0K E;  2KOU A;  1A1G A;  1A1J A;  1HNX E;  1YYK A;  1RMD A;  4JI6 E;  4X62 E;  2J7J A;  1XMQ E;  1GZ6 A;  4BC7 A;  1ZBQ A;  4M0V A;  2ODR C;  2EMA A;  1RC7 A;  3KWR A;  2DIX A;  2EPL X;  2EL4 A;  2EOM A;  3L00 A;  1WJP A;  2YWQ A;  1BB8 A;  5FLX C;  5DNY A;  1X48 A;  2VF1 A;  4MLQ A;  3RMP A;  2CSH A;  1N32 E;  2WBU A;  3M99 B;  4LFA E;  4R2A A;  3MSW A;  2EM6 A;  2EOO A;  2V86 A;  1SFE A;  3IWC A;  2MKD A;  2YTD A;  2EML A;  2YTO A;  1AAY A;  1UIL A;  2RSM A;  4P7D A;  4JI8 E;  4O43 A;  4BBY A;  4DR2 E;  2YTN A;  2EWL A;  3HTX A;  4R2D A;  4F6N A;  2JOX A;  4JV5 E;  2D9H A;  1WRJ A;  5AC5 A;  1TN9 A;  2FTX B;  4KWY A;  1KYQ A;  2UUA E;  1F2I G;  1X6E A;  2V89 A;  3ADG A;  2LJU A;  2FV4 B;  4KHP E;  2EL5 A;  4RH8 A;  2F8B A;  2MC6 A;  2EOH A;  2EOZ A;  1EH7 A;  1MGT A;  2RS6 A;  2ENA A;  2UUC E;  4WSP A;  1QU6 A;  1X3C A;  3BF2 A;  4LF9 E;  2EMK A;  3J7A G;  1IBK E;  4DUY E;  1A1F A;  2EOS A;  2FGG A;  2EMW A;  2EOE A;  1I94 E;  2JP9 A;  1PKP A;  3ADL A;  3QG5 C;  2GPI A;  2EPP A;  2UU9 E;  4JI2 E;  1EH8 A;  1YFH A;  3FIG A;  2JOB A;  2LT7 A;  3EPH A;  2WBS A;  4R2P A;  4LU9 A;  4HEI A;  2EOF A;  1NEI A;  4Q28 A;  2EN4 A;  2RSI A;  1X6H A;  2K4V A;  2MC5 A;  4ZYH A;  1WXR A;  2L3C A;  1RQ0 A;  1T4N A;  2L8T A;  4NXM E;  3HQ1 A;  3ECR A;  3T1H E;  2DGC A;  3DJW A;  3F6G A;  2LO3 A;  4JI3 E;  4B3M E;  1A1I A;  2YPN A;  4DV2 E;  1FKA E;  2EM3 A;  2RS7 A;  4LF8 E;  2EPC A;  2MKN A;  4LF6 E;  4B3S E;  2ODR D;  1ZBT A;  3P1X A;  1N36 E;  2DMY A;  2LVH A;  4DMI A;  2WCC 3;  4HTG A;  3BID A;  2YTG A;  1P47 A;  2LJH A;  3ADJ A;  4DV3 E;  2LTR A;  3J81 C;  3C6K A;  2EMI A;  4L8N A;  3TQM A;  1JK2 A;  5T6J A;  2EM0 A;  4NXN E;  2UXC E;  2H36 X;  4M2Z A;  1IQS A;  2L33 A;  1YUI A;  4WXD A;  3OML A;  2E72 A;  2Q8U A;  2I13 A;  2JPA A;  2WZO A;  4BHC A;  4IS1 C;  2HGH A;  4DR4 E;  1YZ9 A;  3KZY A;  4JYA E;  2G7H A;  2EJ4 A;  4R8O A;  1G2F C;  5KL4 A;  3EQ1 A;  5TSE A;  2YZT A;  2EPZ A;  5AE1 A;  2LCE A;  2EL6 A;  4WX9 A;  1GQE A;  2EOX A;  2DB2 A;  1KJK A;  2YTE A;  2LV2 A;  1EKZ A;  4TUG A;  1HNW E;  2DSY A;  4X66 E;  2EPA A;  2B7T A;  1X5W A;  2PRT A;  3C4B A;  1O0W A;  5AAS A;  4ZYD A;  5LMN E;  3J7Y p;  2JVA A;  4JI1 E;  3C6M A;  2JY9 A;  2EMC A;  1HR0 E;  3BBG A;  2YTQ A;  4F6M A;  3HXL A;  1X47 A;  1A1K A;  1YPN A;  5A6B A;  4DV7 E;  2CTD A;  2V87 A;  5KL7 A;  3MHS C;  4X65 E;  2VRD A;  4DR6 E;  2ZM6 E;  2EOJ A;  2L2M A;  4FK5 C;  3LML A;  4P78 A;  4LF7 E;  2LUP B;  3T1Y E;  4DR7 E;  5LMU E;  2EN3 A;  1B69 A;  4X9J A;  4BS9 A;  3J80 C;  2KHX A;  3OTO E;  3K6Q A;  4F9B B;  3EPK A;  2UXD E;  2YU5 A;  2EM8 A;  2MDG A;  2BBG A;  1A1L A;  2EMY A;  2EZ6 A;  2EP3 A;  2V8Q B;  1L4S A;  2I9I A;  5A6J A;  2ADR A;  3IWD A;  4I8O A;  2EOQ A;  3THN A;  4LFC E;  3AV0 A;  5KL2 A;  1N34 E;  4JI4 E;  4YY3 E;  1ZAA C;  1X49 A;  2V88 A;  2DMI A;  5IV8 B;  4TUI A;  4KZS A;  2B7V A;  2A25 A;  2HHH E;  1NCS A;  4GZN C;  4WFT A;  5KL3 A;  1AH5 A;  1XNR E;  2DLK A;  4ZYE A;  2K7I A;  2ENH A;  2N3G A;  4B3T E;  2VQE E;  4DUZ E;  1STU A;  2JXP A;  4X8W A;  1T4O A;  2ENC A;  4LF5 E;  2LMZ A;  1UN6 B;  1DQ3 A;  2LBS B;  2ELZ A;  2EN2 A;  2VQF E;  4BC9 A;  3JAM C;  2NUF A;  4JI7 E;  2RTX A;  3HPS A;  4IJD A;  4LFB E;  2L3J A;  1UHZ A;  2N8X A;  5CFF E;  4M30 A;  4DV5 E;  3IWB A;  1DGC A;  2YRK A;  2NUE A;  4RHB B;  2JYA A;  2YSP A;  2GLI A;  1YSA C;  1J5E E;  1DI2 A;  2EOY A;  4OOG C;  4R03 A;  3EPL A;  1JK1 A;  1IBM E;  5AE2 A;  3EPJ A;  2EPU A;  4JI5 E;  2YU8 A;  2RQL A;  4DKK A;  1ZU1 A;  2EPX A;  2YTP A;  1J26 A;  2EPK X;  2M4I A;  4R2S A;  2LTS A;  2IHR 1;  2NAB A;  1UBD C;  5A6A A;  2EMX A;  2EPN A;  2VE7 C; 
#chains in the Genus database with same CATH homology
 5IWA E;  4LTY A;  4DV7 E;  2UU9 E;  2V87 A;  4F9A B;  4BMJ A;  4JI2 E;  4X65 E;  2UXB E;  2V85 A;  2B3T B;  4DR6 E;  2ZM6 E;  4B3S E;  3FIG A;  2V83 A;  4X64 E;  2JOB A;  2L2N A;  4L5N C;  3VYY A;  3JU0 A;  2L2M A;  4JI0 E;  4JI4 E;  2B9D A;  2LRS A;  4LU9 A;  3LML A;  4P78 A;  3ZOQ B;  1IBL E;  3AUZ A;  4LF4 E;  4LF7 E;  2LUP B;  3T1Y E;  1XMO E;  4Q28 A;  4DR7 E;  2LE2 A;  5LMU E;  2F4V E;  4OX9 E;  2K4V A;  4BS9 A;  3J80 C;  2KHX A;  2MC5 A;  2E1M A;  1WXR A;  1WHN A;  2YT4 A;  3K6Q A;  2L6M A;  4F9B B;  3OTO E;  2L3C A;  3ADI A;  1RQ0 A;  1N33 E;  2UXD E;  1T4N A;  2L8T A;  2NA2 A;  5ADZ A;  3HQ1 A;  4DV0 E;  1T4L B;  1HNZ E;  4NXM E;  2MDR A;  1WHQ A;  4DR1 E;  1FJG E;  3VYX A;  3T1H E;  2CPN A;  3F6H A;  3DJW A;  1YYO A;  4GEQ B;  3F6G A;  4GKJ E;  5IT9 C;  4DR3 E;  4BCA A;  2EZ6 A;  4F54 A;  2V8Q B;  2E5L E;  2KOU A;  4B3M E;  4JI3 E;  4K0K E;  4DV2 E;  1FKA E;  1HNX E;  1YYK A;  5BR8 E;  2RS7 A;  4LF8 E;  3IWD A;  4I8O A;  4X62 E;  4JI6 E;  4LFC E;  4LF6 E;  3AV0 A;  1XMQ E;  1GZ6 A;  3C4T A;  4YY3 E;  2ODR D;  1N34 E;  4BC7 A;  1ZBT A;  1ZBQ A;  3P1X A;  1X49 A;  4M0V A;  1N36 E;  2DMY A;  2ODR C;  2V88 A;  4DMI A;  4AQY E;  4TUI A;  4KZS A;  2B7V A;  1RC7 A;  3KWR A;  4DV6 E;  2DIX A;  2HHH E;  3DF6 A;  4GKK E;  4WFT A;  1XNR E;  4J8Z A;  5FLX C;  5DNY A;  2LJH A;  3ADJ A;  3LLH A;  2N3G A;  4B3T E;  1X48 A;  4DV3 E;  2VF1 A;  4DV1 E;  2VQE E;  2UUB E;  4DUZ E;  2M7Q A;  1STU A;  2LTR A;  3RMP A;  1N32 E;  3J81 C;  4X8W A;  4WYQ B;  4LFA E;  2L92 A;  2NUG A;  3MSW A;  1T4O A;  2V86 A;  3IWC A;  4LF5 E;  4L8N A;  5T6J A;  2LMZ A;  1DQ3 A;  4NXN E;  2H36 X;  2LBS B;  1UIL A;  2UXC E;  4M2Z A;  4B3R E;  2RSM A;  2JR1 A;  4P7D A;  2VQF E;  2L33 A;  4JI8 E;  4BC9 A;  1SR9 A;  3JAM C;  3OML A;  2NUF A;  5F3W A;  4BBY A;  2WZO A;  4JI7 E;  4DR2 E;  3HTX A;  2EWL A;  2RTX A;  3HPS A;  5AE3 A;  2L2K B;  1YZ9 A;  4DR4 E;  2JOX A;  4LFB E;  4JV5 E;  2L3J A;  1UHZ A;  4JYA E;  2G7H A;  4WPY A;  2FTX B;  5CFF E;  4R8O A;  2UUA E;  4M30 A;  4DV5 E;  3IWB A;  2KON A;  2JWO A;  3ADG A;  2V89 A;  4DV4 E;  1YYW A;  2NUE A;  2YZT A;  5AE1 A;  2FV4 B;  3H09 A;  3VK6 A;  3JTZ A;  4KHP E;  1GQE A;  3HPZ A;  2DB2 A;  2F8B A;  4DR5 E;  1J5E E;  1DI2 A;  4OOG C;  2MC6 A;  1EKZ A;  4R03 A;  2RS6 A;  5LL6 R;  4TUG A;  1IBM E;  1HNW E;  2DSY A;  2LUQ A;  2M1S A;  2B7T A;  5AE2 A;  4X66 E;  2UUC E;  4WSP A;  4JI5 E;  1QU6 A;  3C4B A;  1O0W A;  4DKK A;  5AAS A;  5A2Q C;  5LMN E;  3J7Y p;  2JVA A;  4JI1 E;  2N3H A;  1J26 A;  2M4I A;  2JY9 A;  4LF9 E;  3J7A G;  2LTS A;  1IBK E;  4YHH E;  4DUY E;  2IHR 1;  1XNQ E;  1HR0 E;  2FGG A;  1I94 E;  3HXL A;  3ADL A;  1PKP A;  1X47 A;  4F9C B;  2VE7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...