2V88A

Crystal structure of rag2-phd finger in complex with h3r2me2sk4me2 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
b'SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 14
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v88A01
2V86A 2V88A 2V87A 2V89A 2JWOA 2V83A 2V85A
chains in the Genus database with same CATH superfamily
2EM0A 2LJUA 4O5GA 4R2PA 4B3ME 2YRKA 2BBGA 2K4VA 1ZR9A 4N4RB 2V86A 1YPNA 3ZOQB 3EPLA 4NXME 2CSHA 1KJKA 4ZYGA 4BHBA 1JK1A 4OX9E 4IS1C 1BBGA 3IWCA 2EMIA 1G2FC 1XNRE 2LUQA 5BR8E 3DJWA 2ODRC 2RS6A 2LTRA 1RC7A 2JVAA 5AE1A 3L00A 2DB2A 4ZYHA 4X9JA 1EH7A 1BB8A 4MLQA 4WFTA 3THOB 1TN9A 4R03A 1I94E 1JK2A 4LTYA 4F9CB 3IWDA 2ENHA 2EM8A 4GZNC 4DMIA 2V8QB 2EOEA 3EPKA 5KL3A 1ZAAC 4BHCA 2LMZA 1NCSA 2EWLA 2YTJA 2M9AA 4JI7E 2VQFE 2EPNA 2UUBE 1A1HA 3F6HA 2EMXA 2JP9A 2WBUA 2V89A 4F2JC 2EM7A 2EZ6A 1IMUA 4WSPA 2EL6A 2EMLA 5F3WA 2EPOA 4WSGA 2JOXA 3JTZA 3ECRA 2Q8UA 3LMLA 3KZYA 4HEIA 2ADRA 4MLVA 1PJQA 2E72A 4JI5E 4DKKA 2LO3A 1IBKE 2J7JA 2WBSA 1WJPA 2JYAA 5A69A 1J26A 2JR1A 1A1FA 2L6MA 2EOIA 1TF6A 2FTXB 1IQOA 2YWQA 2UXCE 3J7AG 2L92A 1PKPA 1WHNA 4DR6E 4J8ZA 5KL4A 5CFFE 4WPYA 4LF5E 1MEYC 4DV5E 2L8TA 4R2DA 2E1MA 1J5EE 3OTOE 2HHHE 3BBGA 2M4IA 4L5NC 3C6KA 2HC5A 2NA2A 2NUFA 4DR3E 4TUIA 2MKNA 1STUA 1YYOA 2EMYA 1GTKA 2ELYA 2YU5A 3AV0A 4R8OA 1YYWA 2RSIA 1HR0E 1FJGE 3KZZA 5A6JA 2EL5A 1T4LB 3EPHA 4R2QA 2FGGA 5ADZA 4R2AA 3ADIA 3C4TA 1KYQA 3FIGA 5KL5A 1N3GA 2LE2A 3QG5C 1N33E 2EN7A 5IV8B 4RH8A 2EPPA 4LF6E 4I8OA 2LRSA 5A2QC 4WX9A 2N8XA 4DUYE 2MDGA 2M1SA 1YFHA 3HQ1A 3C6MA 5FLXC 2EN4A 2YZTA 2EQ3A 2EP3A 3LLHA 5KL7A 2EPAA 2JOBA 1UILA 4Q28A 2LV2A 4BBYA 4M0VA 2HGHA 2UUAE 2YU8A 3HXLA 4R2CA 4GEQB 1X6FA 5A6BD 4DV6E 1BBOA 2EM3A 2NABA 4O4KA 2EMFA 2EL4A 2YTOA 1P47A 1N34E 2UXDE 4LF9E 1N36E 1A1LA 2EPLX 2YTDA 4F9AB 2FV4B 2EOOA 3F6GA 4LFAE 2PRTA 1ZBQA 4ZYEA 4BS9A 3J7Yp 5LL6R 5IT9C 4DR2E 3MSWA 4R2RA 3ADGA 3UK3C 4KHPE 4B3RE 3MHSC 1FKAE 2EORA 2DMYA 4F6NA 2RSMA 2L33A 3IWBA 4DV7E 2KHXA 2YT4A 2EMGA 2V83A 2EN3A 1HNWE 3HPSA 3BGHA 1UHZA 3VHTB 5DNYA 1YUJA 2EMKA 1PDAA 2RPCA 1IQSA 2DMIA 4M30A 2YRHA 2EPUA 1EKZA 1WXRA 4DV3E 2EOYA 1LLMC 1WRJA 1IBME 5AASA 5KL2A 2EM2A 3P1XA 4R2EA 4O43A 1NEIA 4X8WA 2L2KB 4IJDA 2YTFA 1X6HA 2DRPA 2I13A 2BB8A 1AH5A 1MGTA 2N3GA 4JI8E 4ZYDA 2F4VE 4LFCE 4P7DA 2EPCA 2EMHA 3THNA 2RS7A 1GZ6A 1HNZE 2KOUA 5AC5A 2EN8A 3ADJA 2L3CA 2JXPA 2MC6A 3BIDA 1XNQE 2CTDA 2YTQA 4F6MA 2WCC3 2NUGA 2L3JA 2EPXA 2EMWA 1YSAC 3HPZA 1Z1BA 2EPRA 1YYKA 1IBLE 4L8NA 1T38A 4AQYE 2EN2A 1HNXE 2D9HA 3EQ1A 2NUEA 2MKDA 2F8BA 2YTEA 2YPNA 5A6BA 2UUCE 5T6JA 2CT1A 3HTXA 4X66E 4DR4E 4X62E 1TF3A 4WXDA 1X49A 5IXMB 2LBSB 4DUZE 2B7VA 3H09A 2EN1A 2ENAA 4DV4E 4DR1E 2E5LE 2EOXA 4DR7E 2L2NA 4Q35B 4NHRA 2UU9E 3DF6A 1YUIA 2JY9A 4M9VC 4GKKE 4F9BB 4X65E 2YSOA 2EOMA 2ZM6E 2N3HA 2YTNA 3ADLA 2I9IA 2DLKA 2ODRD 1L4SA 1EH6A 1N32E 1DI2A 4NZVA 1A1GA 2EOQA 2G7HA 2EOHA 4JI6E 2VQEE 2GLIA 1X3CA 3C4BA 3K6QA 4BCAA 4BC7A 2YTIA 2LTSA 2EOZA 5KL6A 2EPMX 2LJHA 3TQMA 4JI3E 1A1IA 3VK6A 3MHHC 4JI1E 4KWYA 1PJSA 1ZU1A 2EE8A 2EPKX 4F54A 2DSYA 3EPJA 2EOJA 3BF2A 4B3TE 4WXCA 5A6AA 4JI0E 2LVHA 1WHQA 5LMNE 2EOFA 3AUZA 1X5WA 4LF7E 1UBDC 2LT7A 2L2MA 2DIXA 4BC9A 2EQ0A 2H36X 2YTPA 2JPAA 4B3SE 4K0KE 1T4OA 2EMZA 2EM9A 5TSEA 4R2SA 2WZOA 3JAMC 2VF1A 4RHBB 2EMBA 5AC4A 3KWRA 1XMOE 2B7TA 4X64E 2V85A 2CPNA 4LFBE 2EMCA 2HJJA 4DR5E 2GHFA 2JWOA 1SR9A 1DGCA 1X47A 2DLQA 2WBTA 3OMLA 4JI2E 4LU9A 2YRMA 1GQEA 2EN6A 4HTGA 2M7QA 4GKJE 2RQLA 2MDRA 4NXNE 2YSPA 2GPIA 1A1KA 4YHHE 5LLQA 2EM5A 3T1YE 2KONA 4O24A 1EH8A 2EMAA 4M2ZA 1A1JA 2EM4A 2DGCA 4YY3E 2EJ4A 3RMPA 5AE2A 3VYXA 2V88A 5LMUE 1O0WA 5A6KA 2B9DA 1ZBTA 4BMJA 1RQ0A 1T4NA 2RTXA 1QU6A 1X48A 1SFEA 3T1HE 4P78A 1T39A 4FK5C 2YTGA 4WYQB 2VE7C 2A25A 1QNTA 1YZ9A 2K7IA 4TUGA 2V87A 2MC5A 1F2IG 2EOSA 2LUPB 1B69A 2VRDA 4LF4E 2UXBE 1G2DC 3JU0A 4KZSA 2ENCA 2B3TB 2ELZA 1XMQE 5IWAE 1DQ3A 1X6EA 4DV1E 5AE3A 2R76A 4OOGC 4DV2E 3VYYA 2EQ1A 3M99B 4JI4E 4JYAE 2R1FA 4LF8E 1PJTA 3J81C 1RMDA 2EM6A 4JV5E 2EPZA 2LCEA 2IHR1 4DV0E 1AAYA 3J80C 1UN6B
chains in the Genus database with same CATH topology
1IBME 5AASA 3AV0A 4R8OA 4B3ME 2L2MA 1YYWA 2DIXA 3P1XA 4BC9A 2K4VA 2H36X 4X8WA 4B3SE 2L2KB 4K0KE 1T4OA 2V86A 3ZOQB 4KHPE 1HR0E 4NXME 1FJGE 2WZOA 3JAMC 4OX9E 2VF1A 3IWCA 1T4LB 1XNRE 2LUQA 2FGGA 2N3GA 5ADZA 4JI8E 3DJWA 2ODRC 3KWRA 2B7TA 2RS6A 3C4TA 3FIGA 5BR8E 2LTRA 2CPNA 2V85A 4X64E 2JVAA 5AE1A 1RC7A 2F4VE 2LE2A 4LFBE 1N33E 4DR5E 2DB2A 2JWOA 1SR9A 1X47A 4LF6E 4LFCE 4I8OA 2LRSA 4P7DA 5A2QC 3OMLA 3ADIA 4WFTA 2RS7A 4DUYE 1GZ6A 4JI2E 2M1SA 4LU9A 1HNZE 2KOUA 1GQEA 3HQ1A 4R03A 2M7QA 1I94E 4GKJE 3ADJA 5FLXC 4LTYA 4F9CB 2L3CA 3IWDA 2YZTA 2MDRA 4NXNE 2MC6A 3LLHA 4DV3E 1XNQE 4YHHE 4DMIA 2JOBA 2V8QB 1UILA 4Q28A 3T1YE 2KONA 2NUGA 2L3JA 4BBYA 4M0VA 4M2ZA 3HPZA 4YY3E 2UUAE 2LMZA 5AE2A 3HXLA 2V88A 3RMPA 2EWLA 4GEQB 1YYOA 1IBLE 1YYKA 5LMUE 3VYXA 1O0WA 4L8NA 2B9DA 1ZBTA 4JI7E 4AQYE 2VQFE 2UUBE 4BMJA 1RQ0A 4DV6E 1HNXE 2NUEA 3F6HA 1T4NA 2F8BA 2RTXA 1QU6A 1X48A 2V89A 3T1HE 2EZ6A 4P78A 4WSPA 2UUCE 4WYQB 5T6JA 2VE7C 5F3WA 3HTXA 4X66E 4DR4E 1N34E 4X62E 1X49A 2UXDE 2LBSB 1N36E 4LF9E 2JOXA 3JTZA 2B7VA 3H09A 4DUZE 4DV4E 4DR1E 2E5LE 1YZ9A 4DR7E 2L2NA 3LMLA 4F9AB 4TUGA 2UU9E 2FV4B 2V87A 3DF6A 3F6GA 4LFAE 2JY9A 4GKKE 4F9BB 2MC5A 4JI5E 4DKKA 4X65E 1ZBQA 2ZM6E 1IBKE 2N3HA 4BS9A 2LUPB 3ADLA 4LF4E 1J26A 2ODRD 2JR1A 2UXBE 3J7Yp 1N32E 5LL6R 3JU0A 4KZSA 1DI2A 5IT9C 2B3TB 4DR2E 2L6MA 3MSWA 2G7HA 2FTXB 1XMQE 4JI6E 5IWAE 1DQ3A 2VQEE 3ADGA 2UXCE 3C4BA 3K6QA 4BCAA 4DV1E 3J7AG 4BC7A 2L92A 4B3RE 1PKPA 1WHNA 5AE3A 1FKAE 2LTSA 4DR6E 4J8ZA 4OOGC 4DV2E 3VYYA 2LJHA 2DMYA 2RSMA 2L33A 3IWBA 4JI3E 4JI4E 5CFFE 3VK6A 2KHXA 4DV7E 1XMOE 4JYAE 4WPYA 4LF5E 4LF8E 4JI1E 2YT4A 2V83A 3J81C 4DV5E 2L8TA 2E1MA 1HNWE 1J5EE 4JV5E 4F54A 3HPSA 3OTOE 2HHHE 2DSYA 1UHZA 2M4IA 2IHR1 5DNYA 4B3TE 4DV0E 4L5NC 4JI0E 2NUFA 2NA2A 4M30A 1WHQA 5LMNE 4TUIA 4DR3E 1EKZA 1STUA 3AUZA 1WXRA 3J80C 4LF7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V86 A;  2V88 A;  2V87 A;  2V89 A;  2JWO A;  2V83 A;  2V85 A; 
#chains in the Genus database with same CATH topology
 2EM0 A;  2LJU A;  4O5G A;  4R2P A;  4B3M E;  2YRK A;  2BBG A;  2K4V A;  1ZR9 A;  4N4R B;  2V86 A;  1YPN A;  3ZOQ B;  3EPL A;  4NXM E;  2CSH A;  1KJK A;  4ZYG A;  4BHB A;  1JK1 A;  4OX9 E;  4IS1 C;  1BBG A;  3IWC A;  2EMI A;  1G2F C;  1XNR E;  2LUQ A;  5BR8 E;  3DJW A;  2ODR C;  2RS6 A;  2LTR A;  1RC7 A;  2JVA A;  5AE1 A;  3L00 A;  2DB2 A;  4ZYH A;  4X9J A;  1EH7 A;  1BB8 A;  4MLQ A;  4WFT A;  3THO B;  1TN9 A;  4R03 A;  1I94 E;  1JK2 A;  4LTY A;  4F9C B;  3IWD A;  2ENH A;  2EM8 A;  4GZN C;  4DMI A;  2V8Q B;  2EOE A;  3EPK A;  5KL3 A;  1ZAA C;  4BHC A;  2LMZ A;  1NCS A;  2EWL A;  2YTJ A;  2M9A A;  4JI7 E;  2VQF E;  2EPN A;  2UUB E;  1A1H A;  3F6H A;  2EMX A;  2JP9 A;  2WBU A;  2V89 A;  4F2J C;  2EM7 A;  2EZ6 A;  1IMU A;  4WSP A;  2EL6 A;  2EML A;  5F3W A;  2EPO A;  4WSG A;  2JOX A;  3JTZ A;  3ECR A;  2Q8U A;  3LML A;  3KZY A;  4HEI A;  2ADR A;  4MLV A;  1PJQ A;  2E72 A;  4JI5 E;  4DKK A;  2LO3 A;  1IBK E;  2J7J A;  2WBS A;  1WJP A;  2JYA A;  5A69 A;  1J26 A;  2JR1 A;  1A1F A;  2L6M A;  2EOI A;  1TF6 A;  2FTX B;  1IQO A;  2YWQ A;  2UXC E;  3J7A G;  2L92 A;  1PKP A;  1WHN A;  4DR6 E;  4J8Z A;  5KL4 A;  5CFF E;  4WPY A;  4LF5 E;  1MEY C;  4DV5 E;  2L8T A;  4R2D A;  2E1M A;  1J5E E;  3OTO E;  2HHH E;  3BBG A;  2M4I A;  4L5N C;  3C6K A;  2HC5 A;  2NA2 A;  2NUF A;  4DR3 E;  4TUI A;  2MKN A;  1STU A;  1YYO A;  2EMY A;  1GTK A;  2ELY A;  2YU5 A;  3AV0 A;  4R8O A;  1YYW A;  2RSI A;  1HR0 E;  1FJG E;  3KZZ A;  5A6J A;  2EL5 A;  1T4L B;  3EPH A;  4R2Q A;  2FGG A;  5ADZ A;  4R2A A;  3ADI A;  3C4T A;  1KYQ A;  3FIG A;  5KL5 A;  1N3G A;  2LE2 A;  3QG5 C;  1N33 E;  2EN7 A;  5IV8 B;  4RH8 A;  2EPP A;  4LF6 E;  4I8O A;  2LRS A;  5A2Q C;  4WX9 A;  2N8X A;  4DUY E;  2MDG A;  2M1S A;  1YFH A;  3HQ1 A;  3C6M A;  5FLX C;  2EN4 A;  2YZT A;  2EQ3 A;  2EP3 A;  3LLH A;  5KL7 A;  2EPA A;  2JOB A;  1UIL A;  4Q28 A;  2LV2 A;  4BBY A;  4M0V A;  2HGH A;  2UUA E;  2YU8 A;  3HXL A;  4R2C A;  4GEQ B;  1X6F A;  5A6B D;  4DV6 E;  1BBO A;  2EM3 A;  2NAB A;  4O4K A;  2EMF A;  2EL4 A;  2YTO A;  1P47 A;  1N34 E;  2UXD E;  4LF9 E;  1N36 E;  1A1L A;  2EPL X;  2YTD A;  4F9A B;  2FV4 B;  2EOO A;  3F6G A;  4LFA E;  2PRT A;  1ZBQ A;  4ZYE A;  4BS9 A;  3J7Y p;  5LL6 R;  5IT9 C;  4DR2 E;  3MSW A;  4R2R A;  3ADG A;  3UK3 C;  4KHP E;  4B3R E;  3MHS C;  1FKA E;  2EOR A;  2DMY A;  4F6N A;  2RSM A;  2L33 A;  3IWB A;  4DV7 E;  2KHX A;  2YT4 A;  2EMG A;  2V83 A;  2EN3 A;  1HNW E;  3HPS A;  3BGH A;  1UHZ A;  3VHT B;  5DNY A;  1YUJ A;  2EMK A;  1PDA A;  2RPC A;  1IQS A;  2DMI A;  4M30 A;  2YRH A;  2EPU A;  1EKZ A;  1WXR A;  4DV3 E;  2EOY A;  1LLM C;  1WRJ A;  1IBM E;  5AAS A;  5KL2 A;  2EM2 A;  3P1X A;  4R2E A;  4O43 A;  1NEI A;  4X8W A;  2L2K B;  4IJD A;  2YTF A;  1X6H A;  2DRP A;  2I13 A;  2BB8 A;  1AH5 A;  1MGT A;  2N3G A;  4JI8 E;  4ZYD A;  2F4V E;  4LFC E;  4P7D A;  2EPC A;  2EMH A;  3THN A;  2RS7 A;  1GZ6 A;  1HNZ E;  2KOU A;  5AC5 A;  2EN8 A;  3ADJ A;  2L3C A;  2JXP A;  2MC6 A;  3BID A;  1XNQ E;  2CTD A;  2YTQ A;  4F6M A;  2WCC 3;  2NUG A;  2L3J A;  2EPX A;  2EMW A;  1YSA C;  3HPZ A;  1Z1B A;  2EPR A;  1YYK A;  1IBL E;  4L8N A;  1T38 A;  4AQY E;  2EN2 A;  1HNX E;  2D9H A;  3EQ1 A;  2NUE A;  2MKD A;  2F8B A;  2YTE A;  2YPN A;  5A6B A;  2UUC E;  5T6J A;  2CT1 A;  3HTX A;  4X66 E;  4DR4 E;  4X62 E;  1TF3 A;  4WXD A;  1X49 A;  5IXM B;  2LBS B;  4DUZ E;  2B7V A;  3H09 A;  2EN1 A;  2ENA A;  4DV4 E;  4DR1 E;  2E5L E;  2EOX A;  4DR7 E;  2L2N A;  4Q35 B;  4NHR A;  2UU9 E;  3DF6 A;  1YUI A;  2JY9 A;  4M9V C;  4GKK E;  4F9B B;  4X65 E;  2YSO A;  2EOM A;  2ZM6 E;  2N3H A;  2YTN A;  3ADL A;  2I9I A;  2DLK A;  2ODR D;  1L4S A;  1EH6 A;  1N32 E;  1DI2 A;  4NZV A;  1A1G A;  2EOQ A;  2G7H A;  2EOH A;  4JI6 E;  2VQE E;  2GLI A;  1X3C A;  3C4B A;  3K6Q A;  4BCA A;  4BC7 A;  2YTI A;  2LTS A;  2EOZ A;  5KL6 A;  2EPM X;  2LJH A;  3TQM A;  4JI3 E;  1A1I A;  3VK6 A;  3MHH C;  4JI1 E;  4KWY A;  1PJS A;  1ZU1 A;  2EE8 A;  2EPK X;  4F54 A;  2DSY A;  3EPJ A;  2EOJ A;  3BF2 A;  4B3T E;  4WXC A;  5A6A A;  4JI0 E;  2LVH A;  1WHQ A;  5LMN E;  2EOF A;  3AUZ A;  1X5W A;  4LF7 E;  1UBD C;  2LT7 A;  2L2M A;  2DIX A;  4BC9 A;  2EQ0 A;  2H36 X;  2YTP A;  2JPA A;  4B3S E;  4K0K E;  1T4O A;  2EMZ A;  2EM9 A;  5TSE A;  4R2S A;  2WZO A;  3JAM C;  2VF1 A;  4RHB B;  2EMB A;  5AC4 A;  3KWR A;  1XMO E;  2B7T A;  4X64 E;  2V85 A;  2CPN A;  4LFB E;  2EMC A;  2HJJ A;  4DR5 E;  2GHF A;  2JWO A;  1SR9 A;  1DGC A;  1X47 A;  2DLQ A;  2WBT A;  3OML A;  4JI2 E;  4LU9 A;  2YRM A;  1GQE A;  2EN6 A;  4HTG A;  2M7Q A;  4GKJ E;  2RQL A;  2MDR A;  4NXN E;  2YSP A;  2GPI A;  1A1K A;  4YHH E;  5LLQ A;  2EM5 A;  3T1Y E;  2KON A;  4O24 A;  1EH8 A;  2EMA A;  4M2Z A;  1A1J A;  2EM4 A;  2DGC A;  4YY3 E;  2EJ4 A;  3RMP A;  5AE2 A;  3VYX A;  2V88 A;  5LMU E;  1O0W A;  5A6K A;  2B9D A;  1ZBT A;  4BMJ A;  1RQ0 A;  1T4N A;  2RTX A;  1QU6 A;  1X48 A;  1SFE A;  3T1H E;  4P78 A;  1T39 A;  4FK5 C;  2YTG A;  4WYQ B;  2VE7 C;  2A25 A;  1QNT A;  1YZ9 A;  2K7I A;  4TUG A;  2V87 A;  2MC5 A;  1F2I G;  2EOS A;  2LUP B;  1B69 A;  2VRD A;  4LF4 E;  2UXB E;  1G2D C;  3JU0 A;  4KZS A;  2ENC A;  2B3T B;  2ELZ A;  1XMQ E;  5IWA E;  1DQ3 A;  1X6E A;  4DV1 E;  5AE3 A;  2R76 A;  4OOG C;  4DV2 E;  3VYY A;  2EQ1 A;  3M99 B;  4JI4 E;  4JYA E;  2R1F A;  4LF8 E;  1PJT A;  3J81 C;  1RMD A;  2EM6 A;  4JV5 E;  2EPZ A;  2LCE A;  2IHR 1;  4DV0 E;  1AAY A;  3J80 C;  1UN6 B; 
#chains in the Genus database with same CATH homology
 1IBM E;  5AAS A;  3AV0 A;  4R8O A;  4B3M E;  2L2M A;  1YYW A;  2DIX A;  3P1X A;  4BC9 A;  2K4V A;  2H36 X;  4X8W A;  4B3S E;  2L2K B;  4K0K E;  1T4O A;  2V86 A;  3ZOQ B;  4KHP E;  1HR0 E;  4NXM E;  1FJG E;  2WZO A;  3JAM C;  4OX9 E;  2VF1 A;  3IWC A;  1T4L B;  1XNR E;  2LUQ A;  2FGG A;  2N3G A;  5ADZ A;  4JI8 E;  3DJW A;  2ODR C;  3KWR A;  2B7T A;  2RS6 A;  3C4T A;  3FIG A;  5BR8 E;  2LTR A;  2CPN A;  2V85 A;  4X64 E;  2JVA A;  5AE1 A;  1RC7 A;  2F4V E;  2LE2 A;  4LFB E;  1N33 E;  4DR5 E;  2DB2 A;  2JWO A;  1SR9 A;  1X47 A;  4LF6 E;  4LFC E;  4I8O A;  2LRS A;  4P7D A;  5A2Q C;  3OML A;  3ADI A;  4WFT A;  2RS7 A;  4DUY E;  1GZ6 A;  4JI2 E;  2M1S A;  4LU9 A;  1HNZ E;  2KOU A;  1GQE A;  3HQ1 A;  4R03 A;  2M7Q A;  1I94 E;  4GKJ E;  3ADJ A;  5FLX C;  4LTY A;  4F9C B;  2L3C A;  3IWD A;  2YZT A;  2MDR A;  4NXN E;  2MC6 A;  3LLH A;  4DV3 E;  1XNQ E;  4YHH E;  4DMI A;  2JOB A;  2V8Q B;  1UIL A;  4Q28 A;  3T1Y E;  2KON A;  2NUG A;  2L3J A;  4BBY A;  4M0V A;  4M2Z A;  3HPZ A;  4YY3 E;  2UUA E;  2LMZ A;  5AE2 A;  3HXL A;  2V88 A;  3RMP A;  2EWL A;  4GEQ B;  1YYO A;  1IBL E;  1YYK A;  5LMU E;  3VYX A;  1O0W A;  4L8N A;  2B9D A;  1ZBT A;  4JI7 E;  4AQY E;  2VQF E;  2UUB E;  4BMJ A;  1RQ0 A;  4DV6 E;  1HNX E;  2NUE A;  3F6H A;  1T4N A;  2F8B A;  2RTX A;  1QU6 A;  1X48 A;  2V89 A;  3T1H E;  2EZ6 A;  4P78 A;  4WSP A;  2UUC E;  4WYQ B;  5T6J A;  2VE7 C;  5F3W A;  3HTX A;  4X66 E;  4DR4 E;  1N34 E;  4X62 E;  1X49 A;  2UXD E;  2LBS B;  1N36 E;  4LF9 E;  2JOX A;  3JTZ A;  2B7V A;  3H09 A;  4DUZ E;  4DV4 E;  4DR1 E;  2E5L E;  1YZ9 A;  4DR7 E;  2L2N A;  3LML A;  4F9A B;  4TUG A;  2UU9 E;  2FV4 B;  2V87 A;  3DF6 A;  3F6G A;  4LFA E;  2JY9 A;  4GKK E;  4F9B B;  2MC5 A;  4JI5 E;  4DKK A;  4X65 E;  1ZBQ A;  2ZM6 E;  1IBK E;  2N3H A;  4BS9 A;  2LUP B;  3ADL A;  4LF4 E;  1J26 A;  2ODR D;  2JR1 A;  2UXB E;  3J7Y p;  1N32 E;  5LL6 R;  3JU0 A;  4KZS A;  1DI2 A;  5IT9 C;  2B3T B;  4DR2 E;  2L6M A;  3MSW A;  2G7H A;  2FTX B;  1XMQ E;  4JI6 E;  5IWA E;  1DQ3 A;  2VQE E;  3ADG A;  2UXC E;  3C4B A;  3K6Q A;  4BCA A;  4DV1 E;  3J7A G;  4BC7 A;  2L92 A;  4B3R E;  1PKP A;  1WHN A;  5AE3 A;  1FKA E;  2LTS A;  4DR6 E;  4J8Z A;  4OOG C;  4DV2 E;  3VYY A;  2LJH A;  2DMY A;  2RSM A;  2L33 A;  3IWB A;  4JI3 E;  4JI4 E;  5CFF E;  3VK6 A;  2KHX A;  4DV7 E;  1XMO E;  4JYA E;  4WPY A;  4LF5 E;  4LF8 E;  4JI1 E;  2YT4 A;  2V83 A;  3J81 C;  4DV5 E;  2L8T A;  2E1M A;  1HNW E;  1J5E E;  4JV5 E;  4F54 A;  3HPS A;  3OTO E;  2HHH E;  2DSY A;  1UHZ A;  2M4I A;  2IHR 1;  5DNY A;  4B3T E;  4DV0 E;  4L5N C;  4JI0 E;  2NUF A;  2NA2 A;  4M30 A;  1WHQ A;  5LMN E;  4TUI A;  4DR3 E;  1EKZ A;  1STU A;  3AUZ A;  1WXR A;  3J80 C;  4LF7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...