2V88A

Crystal structure of rag2-phd finger in complex with h3r2me2sk4me2 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
total genus 14
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v88A01
2V85A 2V83A 2JWOA 2V89A 2V87A 2V88A 2V86A
chains in the Genus database with same CATH superfamily
4WSPA 4X65E 5TSEA 4LFCE 4WYQB 2NUFA 2WCC3 4L5NC 3MHHC 3IWBA 2JPAA 4O5GA 1T4OA 4R2CA 2ENCA 4ZYDA 1G2FC 4DV2E 4RHBB 2EMGA 4O43A 2B7TA 2EPNA 3VHTB 5KL6A 2NUGA 3ADLA 2L2NA 2EPKX 5AC4A 1PJSA 5AE2A 5IT9C 2LUQA 5KL2A 2EN6A 5AE1A 1XMOE 3C6KA 3JAMC 5LLQA 4M2ZA 4JI7E 1GZ6A 4NXME 1RQ0A 2LJUA 1EH7A 1X48A 4GZNC 4JI5E 1YYKA 4LF4E 3J80C 4KWYA 1UBDC 4DMIA 2RQLA 1T39A 2M7QA 4JI0E 1BBGA 1EH8A 2F4VE 2JXPA 3J7AG 2EPRA 4F9CB 4LF5E 4LFBE 4R2EA 4R2SA 2R76A 2EN8A 4X64E 2EN4A 1PJQA 2EJ4A 2F8BA 3HQ1A 1T4LB 2EM2A 2WBUA 4F2JC 2EM3A 4DR6E 4BCAA 2K7IA 3BF2A 2YSOA 5A69A 2ELZA 2FV4B 2L2MA 5CFFE 5IXMB 2JVAA 4X62E 2V8QB 1EH6A 4RH8A 2L3JA 1N36E 1X49A 4R2RA 4DV3E 3IWCA 4BS9A 3H09A 1J5EE 1YZ9A 2EQ1A 2EM6A 2LO3A 2YTQA 2EL6A 1QU6A 1STUA 4BMJA 4I8OA 2YTGA 1A1KA 2EM4A 2VQEE 5A2QC 3ZOQB 5BR8E 2UUCE 1L4SA 2MKDA 2M9AA 2DRPA 1IQSA 2PRTA 2B3TB 1XMQE 2EMCA 2JR1A 2EM5A 1YUJA 4B3SE 2VE7C 2E72A 1WHQA 4DUYE 1A1IA 1A1HA 1PKPA 2LTRA 2NA2A 4TUGA 2DLKA 2EOZA 3HTXA 3P1XA 4HEIA 2V89A 2EOQA 2LUPB 3LLHA 3FIGA 2EOXA 5A6JA 2EOJA 4LF8E 2B7VA 4ZYHA 5IV8B 2MKNA 2YTIA 4DR7E 4DUZE 1YUIA 2FGGA 4YY3E 2EPZA 2EOSA 2CTDA 2EOIA 4Q35B 1PJTA 2YRHA 2YTNA 3C6MA 3EPKA 1NCSA 1ZU1A 1TF6A 2LRSA 1ZAAC 4BC7A 1A1FA 1AAYA 4F54A 4WSGA 3F6HA 4GKKE 5KL7A 5DNYA 3F6GA 1ZBQA 4F9BB 2ELYA 1N3GA 2EPUA 4DR5E 3EQ1A 2YWQA 2VRDA 4M9VC 2DLQA 1XNRE 2MC5A 2LCEA 1X47A 2L8TA 1WJPA 5A6AA 1JK2A 1IBME 2LTSA 1TF3A 4JYAE 2LE2A 1X5WA 2UXBE 1XNQE 2YTJA 2EOYA 1UN6B 3J81C 4F9AB 2EPXA 2DGCA 4Q28A 1UHZA 3ADIA 4JI8E 2FTXB 2WZOA 4BHCA 3VYYA 3DF6A 2KONA 4DR3E 1GTKA 2EMWA 1YFHA 4IJDA 1G2DC 4JI6E 2EMZA 4LF7E 4X66E 1WRJA 2BBGA 4KZSA 1YYWA 1DI2A 2UXCE 2ENHA 1MEYC 2EPLX 1UILA 3THNA 1J26A 2RSMA 2M4IA 1BB8A 5LL6R 5F3WA 3K6QA 2EMYA 2MDGA 1DGCA 2N3HA 1X3CA 2IHR1 3TQMA 4R2DA 3ECRA 2YTDA 2MC6A 2Q8UA 2L33A 5KL4A 2EM9A 2EOMA 2DB2A 2LBSB 2HJJA 2RSIA 2ENAA 1IBLE 4R03A 4X8WA 4ZYGA 2GHFA 1WHNA 3J7Yp 4DKKA 2DMIA 5KL5A 2EZ6A 2JYAA 1JK1A 1YPNA 4DV0E 2DMYA 4JI3E 4YHHE 3EPJA 2EPMX 3QG5C 4ZYEA 3C4BA 2EN1A 2LT7A 1EKZA 2UUBE 3EPHA 2YTFA 2NUEA 3OMLA 1QNTA 2EL5A 2KHXA 2YTEA 2RS6A 1MGTA 4F6MA 1HNXE 2BB8A 1TN9A 2EMAA 4WXDA 3AUZA 2YTPA 2N8XA 2CT1A 4R2PA 2YSPA 4R8OA 2YPNA 4JI4E 1A1LA 2EN3A 5KL3A 1B69A 3MHSC 4JV5E 5AE3A 2KOUA 4M30A 1FJGE 2ADRA 4MLVA 2MDRA 4K0KE 2CPNA 2D9HA 3IWDA 2VQFE 4WPYA 2ZM6E 4R2QA 4X9JA 1KYQA 2JP9A 3JU0A 2UXDE 3BIDA 2EM7A 2E5LE 4DR4E 3HPSA 2YZTA 4N4RB 4O24A 3EPLA 4B3TE 3ADGA 4WX9A 5A6BD 4B3RE 1NEIA 2HGHA 2V85A 2YRKA 2J7JA 5AASA 4BBYA 4HTGA 3OTOE 2EORA 4DV1E 4LTYA 1LLMC 2EMXA 2V88A 3UK3C 4OOGC 4DR1E 4LFAE 2EN2A 1N33E 2UUAE 2L2KB 4BC9A 4DV6E 2LV2A 3ADJA 2EMBA 4DV5E 1A1GA 2L92A 2YT4A 3JTZA 5ADZA 2I13A 1ZBTA 3KZYA 1SR9A 4DR2E 1DQ3A 2EE8A 4NZVA 1X6HA 3VYXA 4AQYE 2HHHE 2NABA 5LMUE 2EMKA 5FLXC 4DV4E 2V87A 3KWRA 2EQ0A 2EOEA 2ODRC 4R2AA 4TUIA 4LF9E 3M99B 2EMHA 1SFEA 1IMUA 2LJHA 1ZR9A 5IWAE 2EWLA 2EMFA 2EPOA 4GEQB 2L6MA 4KHPE 1AH5A 1FKAE 4BHBA 3BBGA 1N32E 2VF1A 1T4NA 1X6FA 2H36X 2M1SA 2G7HA 1IQOA 2K4VA 2EMLA 4NXNE 2EPCA 2EOOA 2WBTA 3C4TA 4F6NA 4LU9A 1Z1BA 3DJWA 3HPZA 1X6EA 2EPPA 4WFTA 2WBSA 2UU9E 1HNWE 2DSYA 2EMIA 4B3ME 1O0WA 2A25A 3HXLA 2YRMA 3RMPA 2EL4A 1IBKE 2V83A 3AV0A 4P78A 4IS1C 2RPCA 2L3CA 5LMNE 3T1HE 2I9IA 2DIXA 1PDAA 4OX9E 3VK6A 1F2IG 2EN7A 2EM8A 2LVHA 2RS7A 3KZZA 2HC5A 3L00A 3T1YE 4NHRA 2YU5A 4FK5C 2EPAA 2GLIA 5AC5A 1N34E 2R1FA 1I94E 3THOB 2EOFA 2JOXA 4O4KA 4LF6E 1HNZE 1A1JA 3BGHA 5A6KA 2N3GA 1WXRA 2EOHA 1YSAC 4DV7E 1RC7A 4GKJE 4JI1E 1YYOA 2YTOA 2EP3A 1GQEA 1P47A 2RTXA 1RMDA 2B9DA 2JWOA 4MLQA 2ODRD 2GPIA 2JY9A 2EM0A 2V86A 4WXCA 4JI2E 1BBOA 1KJKA 5T6JA 3LMLA 2CSHA 3MSWA 4P7DA 5A6BA 4L8NA 4M0VA 2E1MA 4J8ZA 2JOBA 2YU8A 2EQ3A 1T38A 1HR0E 2LMZA
chains in the Genus database with same CATH topology
2L33A 4WSPA 4LF9E 4DUYE 4X65E 2DB2A 2LBSB 4LFCE 4WYQB 1PKPA 2LTRA 2NA2A 4L5NC 4TUGA 2NUFA 2LJHA 5IWAE 1IBLE 3HTXA 3P1XA 3IWBA 2EWLA 2V89A 4R03A 1T4OA 4X8WA 1WHNA 2LUPB 3LLHA 3FIGA 3J7Yp 4DKKA 4GEQB 2EZ6A 2L6MA 4DV2E 4DV0E 2DMYA 4LF8E 2B7VA 2B7TA 2NUGA 3ADLA 4KHPE 1FKAE 4JI3E 1N32E 2L2NA 2VF1A 1T4NA 4DR7E 2H36X 4DUZE 2M1SA 2FGGA 2G7HA 4YY3E 4YHHE 2K4VA 2UUBE 3C4BA 1EKZA 5AE2A 5IT9C 4NXNE 2LUQA 3C4TA 5AE1A 1XMOE 2NUEA 3OMLA 3JAMC 4M2ZA 4JI7E 4LU9A 2LRSA 2KHXA 1GZ6A 4NXME 1RQ0A 3DJWA 4BC7A 2RS6A 1HNXE 1X48A 4F54A 4JI5E 3AUZA 3HPZA 1YYKA 3F6HA 4GKKE 4LF4E 4WFTA 3J80C 5DNYA 4R8OA 3F6GA 1ZBQA 4DMIA 4F9BB 2UU9E 2M7QA 4JI4E 4JI0E 1HNWE 2F4VE 4DR5E 3J7AG 2DSYA 4JV5E 5AE3A 4B3ME 2KOUA 4M30A 1O0WA 4F9CB 4LF5E 1FJGE 4LFBE 1XNRE 2MDRA 2MC5A 3HQ1A 2F8BA 2CPNA 4X64E 3HXLA 4K0KE 1X47A 2L8TA 3IWDA 3RMPA 1T4LB 2VQFE 1IBKE 4WPYA 2V83A 3AV0A 1IBME 2LTSA 4P78A 2ZM6E 4JYAE 3JU0A 2UXDE 2LE2A 2L3CA 5LMNE 3T1HE 1XNQE 4DR6E 2UXBE 2DIXA 4OX9E 2E5LE 3VK6A 4BCAA 3J81C 4F9AB 3HPSA 2YZTA 4DR4E 4Q28A 4B3TE 2RS7A 3ADGA 2FV4B 3T1YE 4B3RE 2L2MA 1UHZA 2V85A 2JVAA 5CFFE 4X62E 4JI8E 5AASA 2V8QB 3ADIA 4BBYA 2FTXB 3OTOE 1N34E 1I94E 4DV1E 2WZOA 4LTYA 2L3JA 1N36E 2JOXA 3VYYA 3DF6A 4LF6E 1X49A 2KONA 2V88A 4DV3E 4DR3E 1HNZE 3IWCA 2N3GA 1WXRA 4OOGC 4BS9A 4DR1E 3H09A 1J5EE 4JI6E 4LFAE 1YZ9A 1N33E 4DV7E 1RC7A 4GKJE 2UUAE 4LF7E 2L2KB 4BC9A 4X66E 4JI1E 1YYOA 4DV6E 1QU6A 1STUA 4KZSA 1GQEA 1HR0E 4BMJA 4I8OA 2RTXA 3ADJA 2B9DA 1YYWA 2VQEE 1DI2A 2JWOA 2UXCE 2ODRD 4DV5E 2L92A 2YT4A 2JY9A 5A2QC 2V86A 3JTZA 1UILA 3ZOQB 5ADZA 5BR8E 2UUCE 1ZBTA 2RSMA 1SR9A 2M4IA 4DR2E 4JI2E 1J26A 5T6JA 1DQ3A 5LL6R 3LMLA 3MSWA 4P7DA 5F3WA 2B3TB 3K6QA 3VYXA 4L8NA 4AQYE 1XMQE 2HHHE 4M0VA 2JR1A 5LMUE 2N3HA 2E1MA 4B3SE 2IHR1 5FLXC 4DV4E 4J8ZA 2JOBA 2V87A 2VE7C 3KWRA 1WHQA 2ODRC 4TUIA 2MC6A 2LMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V85 A;  2V83 A;  2JWO A;  2V89 A;  2V87 A;  2V88 A;  2V86 A; 
#chains in the Genus database with same CATH topology
 4WSP A;  4X65 E;  5TSE A;  4LFC E;  4WYQ B;  2NUF A;  2WCC 3;  4L5N C;  3MHH C;  3IWB A;  2JPA A;  4O5G A;  1T4O A;  4R2C A;  2ENC A;  4ZYD A;  1G2F C;  4DV2 E;  4RHB B;  2EMG A;  4O43 A;  2B7T A;  2EPN A;  3VHT B;  5KL6 A;  2NUG A;  3ADL A;  2L2N A;  2EPK X;  5AC4 A;  1PJS A;  5AE2 A;  5IT9 C;  2LUQ A;  5KL2 A;  2EN6 A;  5AE1 A;  1XMO E;  3C6K A;  3JAM C;  5LLQ A;  4M2Z A;  4JI7 E;  1GZ6 A;  4NXM E;  1RQ0 A;  2LJU A;  1EH7 A;  1X48 A;  4GZN C;  4JI5 E;  1YYK A;  4LF4 E;  3J80 C;  4KWY A;  1UBD C;  4DMI A;  2RQL A;  1T39 A;  2M7Q A;  4JI0 E;  1BBG A;  1EH8 A;  2F4V E;  2JXP A;  3J7A G;  2EPR A;  4F9C B;  4LF5 E;  4LFB E;  4R2E A;  4R2S A;  2R76 A;  2EN8 A;  4X64 E;  2EN4 A;  1PJQ A;  2EJ4 A;  2F8B A;  3HQ1 A;  1T4L B;  2EM2 A;  2WBU A;  4F2J C;  2EM3 A;  4DR6 E;  4BCA A;  2K7I A;  3BF2 A;  2YSO A;  5A69 A;  2ELZ A;  2FV4 B;  2L2M A;  5CFF E;  5IXM B;  2JVA A;  4X62 E;  2V8Q B;  1EH6 A;  4RH8 A;  2L3J A;  1N36 E;  1X49 A;  4R2R A;  4DV3 E;  3IWC A;  4BS9 A;  3H09 A;  1J5E E;  1YZ9 A;  2EQ1 A;  2EM6 A;  2LO3 A;  2YTQ A;  2EL6 A;  1QU6 A;  1STU A;  4BMJ A;  4I8O A;  2YTG A;  1A1K A;  2EM4 A;  2VQE E;  5A2Q C;  3ZOQ B;  5BR8 E;  2UUC E;  1L4S A;  2MKD A;  2M9A A;  2DRP A;  1IQS A;  2PRT A;  2B3T B;  1XMQ E;  2EMC A;  2JR1 A;  2EM5 A;  1YUJ A;  4B3S E;  2VE7 C;  2E72 A;  1WHQ A;  4DUY E;  1A1I A;  1A1H A;  1PKP A;  2LTR A;  2NA2 A;  4TUG A;  2DLK A;  2EOZ A;  3HTX A;  3P1X A;  4HEI A;  2V89 A;  2EOQ A;  2LUP B;  3LLH A;  3FIG A;  2EOX A;  5A6J A;  2EOJ A;  4LF8 E;  2B7V A;  4ZYH A;  5IV8 B;  2MKN A;  2YTI A;  4DR7 E;  4DUZ E;  1YUI A;  2FGG A;  4YY3 E;  2EPZ A;  2EOS A;  2CTD A;  2EOI A;  4Q35 B;  1PJT A;  2YRH A;  2YTN A;  3C6M A;  3EPK A;  1NCS A;  1ZU1 A;  1TF6 A;  2LRS A;  1ZAA C;  4BC7 A;  1A1F A;  1AAY A;  4F54 A;  4WSG A;  3F6H A;  4GKK E;  5KL7 A;  5DNY A;  3F6G A;  1ZBQ A;  4F9B B;  2ELY A;  1N3G A;  2EPU A;  4DR5 E;  3EQ1 A;  2YWQ A;  2VRD A;  4M9V C;  2DLQ A;  1XNR E;  2MC5 A;  2LCE A;  1X47 A;  2L8T A;  1WJP A;  5A6A A;  1JK2 A;  1IBM E;  2LTS A;  1TF3 A;  4JYA E;  2LE2 A;  1X5W A;  2UXB E;  1XNQ E;  2YTJ A;  2EOY A;  1UN6 B;  3J81 C;  4F9A B;  2EPX A;  2DGC A;  4Q28 A;  1UHZ A;  3ADI A;  4JI8 E;  2FTX B;  2WZO A;  4BHC A;  3VYY A;  3DF6 A;  2KON A;  4DR3 E;  1GTK A;  2EMW A;  1YFH A;  4IJD A;  1G2D C;  4JI6 E;  2EMZ A;  4LF7 E;  4X66 E;  1WRJ A;  2BBG A;  4KZS A;  1YYW A;  1DI2 A;  2UXC E;  2ENH A;  1MEY C;  2EPL X;  1UIL A;  3THN A;  1J26 A;  2RSM A;  2M4I A;  1BB8 A;  5LL6 R;  5F3W A;  3K6Q A;  2EMY A;  2MDG A;  1DGC A;  2N3H A;  1X3C A;  2IHR 1;  3TQM A;  4R2D A;  3ECR A;  2YTD A;  2MC6 A;  2Q8U A;  2L33 A;  5KL4 A;  2EM9 A;  2EOM A;  2DB2 A;  2LBS B;  2HJJ A;  2RSI A;  2ENA A;  1IBL E;  4R03 A;  4X8W A;  4ZYG A;  2GHF A;  1WHN A;  3J7Y p;  4DKK A;  2DMI A;  5KL5 A;  2EZ6 A;  2JYA A;  1JK1 A;  1YPN A;  4DV0 E;  2DMY A;  4JI3 E;  4YHH E;  3EPJ A;  2EPM X;  3QG5 C;  4ZYE A;  3C4B A;  2EN1 A;  2LT7 A;  1EKZ A;  2UUB E;  3EPH A;  2YTF A;  2NUE A;  3OML A;  1QNT A;  2EL5 A;  2KHX A;  2YTE A;  2RS6 A;  1MGT A;  4F6M A;  1HNX E;  2BB8 A;  1TN9 A;  2EMA A;  4WXD A;  3AUZ A;  2YTP A;  2N8X A;  2CT1 A;  4R2P A;  2YSP A;  4R8O A;  2YPN A;  4JI4 E;  1A1L A;  2EN3 A;  5KL3 A;  1B69 A;  3MHS C;  4JV5 E;  5AE3 A;  2KOU A;  4M30 A;  1FJG E;  2ADR A;  4MLV A;  2MDR A;  4K0K E;  2CPN A;  2D9H A;  3IWD A;  2VQF E;  4WPY A;  2ZM6 E;  4R2Q A;  4X9J A;  1KYQ A;  2JP9 A;  3JU0 A;  2UXD E;  3BID A;  2EM7 A;  2E5L E;  4DR4 E;  3HPS A;  2YZT A;  4N4R B;  4O24 A;  3EPL A;  4B3T E;  3ADG A;  4WX9 A;  5A6B D;  4B3R E;  1NEI A;  2HGH A;  2V85 A;  2YRK A;  2J7J A;  5AAS A;  4BBY A;  4HTG A;  3OTO E;  2EOR A;  4DV1 E;  4LTY A;  1LLM C;  2EMX A;  2V88 A;  3UK3 C;  4OOG C;  4DR1 E;  4LFA E;  2EN2 A;  1N33 E;  2UUA E;  2L2K B;  4BC9 A;  4DV6 E;  2LV2 A;  3ADJ A;  2EMB A;  4DV5 E;  1A1G A;  2L92 A;  2YT4 A;  3JTZ A;  5ADZ A;  2I13 A;  1ZBT A;  3KZY A;  1SR9 A;  4DR2 E;  1DQ3 A;  2EE8 A;  4NZV A;  1X6H A;  3VYX A;  4AQY E;  2HHH E;  2NAB A;  5LMU E;  2EMK A;  5FLX C;  4DV4 E;  2V87 A;  3KWR A;  2EQ0 A;  2EOE A;  2ODR C;  4R2A A;  4TUI A;  4LF9 E;  3M99 B;  2EMH A;  1SFE A;  1IMU A;  2LJH A;  1ZR9 A;  5IWA E;  2EWL A;  2EMF A;  2EPO A;  4GEQ B;  2L6M A;  4KHP E;  1AH5 A;  1FKA E;  4BHB A;  3BBG A;  1N32 E;  2VF1 A;  1T4N A;  1X6F A;  2H36 X;  2M1S A;  2G7H A;  1IQO A;  2K4V A;  2EML A;  4NXN E;  2EPC A;  2EOO A;  2WBT A;  3C4T A;  4F6N A;  4LU9 A;  1Z1B A;  3DJW A;  3HPZ A;  1X6E A;  2EPP A;  4WFT A;  2WBS A;  2UU9 E;  1HNW E;  2DSY A;  2EMI A;  4B3M E;  1O0W A;  2A25 A;  3HXL A;  2YRM A;  3RMP A;  2EL4 A;  1IBK E;  2V83 A;  3AV0 A;  4P78 A;  4IS1 C;  2RPC A;  2L3C A;  5LMN E;  3T1H E;  2I9I A;  2DIX A;  1PDA A;  4OX9 E;  3VK6 A;  1F2I G;  2EN7 A;  2EM8 A;  2LVH A;  2RS7 A;  3KZZ A;  2HC5 A;  3L00 A;  3T1Y E;  4NHR A;  2YU5 A;  4FK5 C;  2EPA A;  2GLI A;  5AC5 A;  1N34 E;  2R1F A;  1I94 E;  3THO B;  2EOF A;  2JOX A;  4O4K A;  4LF6 E;  1HNZ E;  1A1J A;  3BGH A;  5A6K A;  2N3G A;  1WXR A;  2EOH A;  1YSA C;  4DV7 E;  1RC7 A;  4GKJ E;  4JI1 E;  1YYO A;  2YTO A;  2EP3 A;  1GQE A;  1P47 A;  2RTX A;  1RMD A;  2B9D A;  2JWO A;  4MLQ A;  2ODR D;  2GPI A;  2JY9 A;  2EM0 A;  2V86 A;  4WXC A;  4JI2 E;  1BBO A;  1KJK A;  5T6J A;  3LML A;  2CSH A;  3MSW A;  4P7D A;  5A6B A;  4L8N A;  4M0V A;  2E1M A;  4J8Z A;  2JOB A;  2YU8 A;  2EQ3 A;  1T38 A;  1HR0 E;  2LMZ A; 
#chains in the Genus database with same CATH homology
 2L33 A;  4WSP A;  4LF9 E;  4DUY E;  4X65 E;  2DB2 A;  2LBS B;  4LFC E;  4WYQ B;  1PKP A;  2LTR A;  2NA2 A;  4L5N C;  4TUG A;  2NUF A;  2LJH A;  5IWA E;  1IBL E;  3HTX A;  3P1X A;  3IWB A;  2EWL A;  2V89 A;  4R03 A;  1T4O A;  4X8W A;  1WHN A;  2LUP B;  3LLH A;  3FIG A;  3J7Y p;  4DKK A;  4GEQ B;  2EZ6 A;  2L6M A;  4DV2 E;  4DV0 E;  2DMY A;  4LF8 E;  2B7V A;  2B7T A;  2NUG A;  3ADL A;  4KHP E;  1FKA E;  4JI3 E;  1N32 E;  2L2N A;  2VF1 A;  1T4N A;  4DR7 E;  2H36 X;  4DUZ E;  2M1S A;  2FGG A;  2G7H A;  4YY3 E;  4YHH E;  2K4V A;  2UUB E;  3C4B A;  1EKZ A;  5AE2 A;  5IT9 C;  4NXN E;  2LUQ A;  3C4T A;  5AE1 A;  1XMO E;  2NUE A;  3OML A;  3JAM C;  4M2Z A;  4JI7 E;  4LU9 A;  2LRS A;  2KHX A;  1GZ6 A;  4NXM E;  1RQ0 A;  3DJW A;  4BC7 A;  2RS6 A;  1HNX E;  1X48 A;  4F54 A;  4JI5 E;  3AUZ A;  3HPZ A;  1YYK A;  3F6H A;  4GKK E;  4LF4 E;  4WFT A;  3J80 C;  5DNY A;  4R8O A;  3F6G A;  1ZBQ A;  4DMI A;  4F9B B;  2UU9 E;  2M7Q A;  4JI4 E;  4JI0 E;  1HNW E;  2F4V E;  4DR5 E;  3J7A G;  2DSY A;  4JV5 E;  5AE3 A;  4B3M E;  2KOU A;  4M30 A;  1O0W A;  4F9C B;  4LF5 E;  1FJG E;  4LFB E;  1XNR E;  2MDR A;  2MC5 A;  3HQ1 A;  2F8B A;  2CPN A;  4X64 E;  3HXL A;  4K0K E;  1X47 A;  2L8T A;  3IWD A;  3RMP A;  1T4L B;  2VQF E;  1IBK E;  4WPY A;  2V83 A;  3AV0 A;  1IBM E;  2LTS A;  4P78 A;  2ZM6 E;  4JYA E;  3JU0 A;  2UXD E;  2LE2 A;  2L3C A;  5LMN E;  3T1H E;  1XNQ E;  4DR6 E;  2UXB E;  2DIX A;  4OX9 E;  2E5L E;  3VK6 A;  4BCA A;  3J81 C;  4F9A B;  3HPS A;  2YZT A;  4DR4 E;  4Q28 A;  4B3T E;  2RS7 A;  3ADG A;  2FV4 B;  3T1Y E;  4B3R E;  2L2M A;  1UHZ A;  2V85 A;  2JVA A;  5CFF E;  4X62 E;  4JI8 E;  5AAS A;  2V8Q B;  3ADI A;  4BBY A;  2FTX B;  3OTO E;  1N34 E;  1I94 E;  4DV1 E;  2WZO A;  4LTY A;  2L3J A;  1N36 E;  2JOX A;  3VYY A;  3DF6 A;  4LF6 E;  1X49 A;  2KON A;  2V88 A;  4DV3 E;  4DR3 E;  1HNZ E;  3IWC A;  2N3G A;  1WXR A;  4OOG C;  4BS9 A;  4DR1 E;  3H09 A;  1J5E E;  4JI6 E;  4LFA E;  1YZ9 A;  1N33 E;  4DV7 E;  1RC7 A;  4GKJ E;  2UUA E;  4LF7 E;  2L2K B;  4BC9 A;  4X66 E;  4JI1 E;  1YYO A;  4DV6 E;  1QU6 A;  1STU A;  4KZS A;  1GQE A;  1HR0 E;  4BMJ A;  4I8O A;  2RTX A;  3ADJ A;  2B9D A;  1YYW A;  2VQE E;  1DI2 A;  2JWO A;  2UXC E;  2ODR D;  4DV5 E;  2L92 A;  2YT4 A;  2JY9 A;  5A2Q C;  2V86 A;  3JTZ A;  1UIL A;  3ZOQ B;  5ADZ A;  5BR8 E;  2UUC E;  1ZBT A;  2RSM A;  1SR9 A;  2M4I A;  4DR2 E;  4JI2 E;  1J26 A;  5T6J A;  1DQ3 A;  5LL6 R;  3LML A;  3MSW A;  4P7D A;  5F3W A;  2B3T B;  3K6Q A;  3VYX A;  4L8N A;  4AQY E;  1XMQ E;  2HHH E;  4M0V A;  2JR1 A;  5LMU E;  2N3H A;  2E1M A;  4B3S E;  2IHR 1;  5FLX C;  4DV4 E;  4J8Z A;  2JOB A;  2V87 A;  2VE7 C;  3KWR A;  1WHQ A;  2ODR C;  4TUI A;  2MC6 A;  2LMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...