2ENCA

Solution structure of the c2h2 type zinc finger (region 395-427) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGSGEKPFKCEECGKGFYTNSQCYSHQRSHSGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 395-427) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2encA01
2EOEA 2DLQA 1A1KA 3VHTB 1Z1BA 2EOQA 2EPUA 3UK3C 2EM8A 2J7JA 2EOSA 1WJPA 2WCC3 4IS1C 4R2PA 2MKDA 2EOIA 4M9VC 1A1LA 1MEYC 2EMXA 2EMAA 2EMKA 2EMCA 2YTGA 2RPCA 2BB8A 1TN9A 2EMBA 1X6EA 2YTFA 2EMFA 2EN2A 1B69A 2EM7A 4F2JC 2ADRA 2EN4A 4GZNC 2EMWA 2YRKA 5KL7A 1A1GA 2PRTA 2CTDA 2YTNA 2LO3A 2DMIA 2EM9A 2M9AA 5KL2A 2EJ4A 2EN7A 3MHSC 2VRDA 3MHHC 2LV2A 2NABA 2GLIA 4IJDA 2YSPA 2CSHA 2YTJA 2ENCA 1A1HA 4F6MA 1A1JA 2EOFA 4R2DA 3EPKA 2YSOA 1TF6A 3M99B 1X5WA 2YTEA 4F6NA 2EMYA 2EN3A 5KL6A 2EOJA 2EN8A 2EPXA 2EOMA 4FK5C 3EPLA 2EOYA 1YSAC 2EM0A 1YUIA 2EMLA 2LT7A 2EQ1A 2EOOA 2WBSA 2EM3A 2LCEA 1X6FA 2EPZA 2ENAA 2ELZA 1YUJA 2MKNA 2EM6A 1X6HA 1ZR9A 2EM2A 2EMZA 2R1FA 4R2EA 1TF3A 2EN6A 3EPHA 1UBDC 4R2SA 2EPCA 4R2QA 2EOZA 5KL3A 2DGCA 2EORA 2EMIA 1X3CA 2WBTA 1ZAAC 2YRHA 1G2DC 1JK2A 2CT1A 2EOHA 2YTIA 5KL5A 1NCSA 2YTOA 1F2IG 2A25A 2WBUA 2I13A 2EM5A 2RSIA 4X9JA 1A1FA 2DLKA 2JP9A 2EL5A 2EPAA 1LLMC 2YTPA 2EP3A 1AAYA 1DGCA 2EQ3A 2JPAA 2YRMA 4R2AA 4R2RA 2EN1A 2EE8A 2EPRA 2EMGA 2YU5A 2ENHA 2ELYA 2YTQA 1BBOA 1G2FC 3EPJA 2EMHA 2MDGA 2LVHA 2DRPA 2EM4A 1A1IA 2D9HA 2EOXA 2EQ0A 4WSGA 1P47A 2EPPA 2YU8A 5KL4A 2EL4A 4R2CA 1UN6B 2YTDA 2HGHA 1BB8A 2GHFA 1KJKA 2E72A 2EL6A 1JK1A 1ZU1A 1RMDA
chains in the Genus database with same CATH superfamily
2LUPB 1A1KA 4DR7E 2EOQA 1QNTA 2RTXA 1SFEA 4ZYDA 1A1LA 1PJTA 4DV3E 2EMKA 4BHBA 4DR1E 4X65E 2N3HA 2BB8A 1X47A 2EMFA 2EN2A 3THOB 4F9CB 4NXME 5DNYA 2DSYA 2ADRA 3VYYA 2EMWA 2YRKA 4DV5E 1HR0E 1IQOA 4BHCA 2CTDA 2YTNA 2M1SA 4M30A 4DV7E 2UUCE 4LF8E 2M9AA 4JI8E 4X64E 5KL2A 2EJ4A 2JOBA 3P1XA 2NABA 4J8ZA 2LJHA 4ZYEA 2YZTA 2EWLA 1A1HA 4F6MA 1N34E 2EOFA 2UXCE 1X5WA 3THNA 5AC5A 2EPLX 3F6HA 4LFCE 1BBGA 1YFHA 2EN8A 1YSAC 1YUIA 1YPNA 1WHNA 2M4IA 2UXDE 3JAMC 2EM3A 1N36E 3H09A 2EM6A 2VQFE 4DV4E 3KWRA 4BBYA 2VE7C 1UILA 5KL3A 3TQMA 2HHHE 4KWYA 2EMIA 4LF9E 3QG5C 1SR9A 4GKKE 2B7TA 4P78A 2RSMA 2EPOA 1F2IG 5AE2A 4O4KA 5A6BD 2RS7A 1ZBTA 2RSIA 2JYAA 2JY9A 1PKPA 4JI1E 1IMUA 1AAYA 2LJUA 2EPRA 2YU5A 2ENHA 2ELYA 1BBOA 4L5NC 1WRJA 4WPYA 1J5EE 1NEIA 5IV8B 3BGHA 1A1IA 2D9HA 2LMZA 1PDAA 2WZOA 1AH5A 1P47A 4NXNE 4ZYGA 4R2CA 4KHPE 4JI2E 2HGHA 4AQYE 2G7HA 3HTXA 5A6KA 4DR2E 2DLQA 4WX9A 4LFBE 4JI6E 1Z1BA 2B9DA 2EPUA 1FJGE 4DV0E 4R8OA 2EOSA 2L2NA 2WCC3 4IS1C 4R2PA 2UUAE 4WXDA 4F9BB 4DV6E 1TN9A 2EMBA 4M2ZA 4RHBB 2DB2A 2NUGA 4LF7E 2EM7A 4DKKA 3OTOE 4DR6E 1O0WA 2EPNA 1IBKE 2MDRA 2LO3A 4BS9A 2CPNA 2EM9A 1YZ9A 4DUYE 3LLHA 3LMLA 3T1HE 2LV2A 2V87A 2YSPA 2CSHA 2YTJA 3EPKA 1YYWA 1TF6A 5AC4A 2ODRC 2EMYA 3ADIA 4DR3E 3EPLA 2LBSB 2L92A 2EM0A 2JXPA 4P7DA 2EQ1A 2WBSA 3HPZA 2JR1A 2LCEA 2R76A 1YUJA 2ELZA 4F9AB 1X6HA 1ZR9A 2L3CA 2FTXB 2EMZA 3RMPA 4HEIA 2RS6A 4R03A 1ZBQA 1TF3A 3IWBA 2EN6A 1N32E 4BC7A 2V83A 5F3WA 3HQ1A 3KZYA 4R2QA 2I9IA 2DGCA 2EORA 2NUFA 2WBTA 2YRHA 2FGGA 5KL5A 2B3TB 4B3SE 2LUQA 1NCSA 2A25A 2KOUA 2EM5A 4X9JA 2DLKA 1FKAE 1DI2A 1IQSA 1N33E 5IXMB 2EPKX 4X8WA 4KZSA 2EQ3A 1RQ0A 4MLQA 5CFFE 2YRMA 2HC5A 4OX9E 4JV5E 2YTQA 1G2FC 4L8NA 4LTYA 2LRSA 3EPJA 2EMHA 3C4TA 5LLQA 4YHHE 3J7Yp 2BBGA 2EQ0A 2L33A 4WSGA 1YYKA 2EPPA 4BC9A 2K7IA 4Q28A 1UN6B 4TUGA 1KJKA 2EL6A 1JK1A 1RMDA 1IBME 5A6BA 3BIDA 3UK3C 2EM8A 2J7JA 5AE3A 4I8OA 3KZZA 3C6MA 4DV1E 3ECRA 5LL6R 2EMXA 4DUZE 1XMQE 3C6KA 2YTGA 1GTKA 2RPCA 2L6MA 1WXRA 2L3JA 2YTFA 2B7VA 1XMOE 1X49A 3HXLA 2JVAA 4F2JC 2NUEA 2LTRA 4LF5E 4K0KE 1T4LB 2L2KB 5KL7A 2PRTA 2UXBE 2L2MA 4GEQB 3MHSC 1QU6A 1N3GA 2N3GA 1XNQE 2HJJA 1GZ6A 3K6QA 3HPSA 2YSOA 3M99B 4DV2E 4F6NA 1IBLE 5KL6A 2EOJA 4JI5E 2EPXA 4FK5C 2EOYA 2EPMX 4NZVA 2EMLA 2EOOA 1HNXE 1X6FA 2EPZA 2MKNA 2F4VE 3ZOQB 2VQEE 2R1FA 3IWCA 5FLXC 2KONA 3EPHA 4R2SA 2LE2A 4LU9A 2EOZA 2RQLA 4B3TE 1XNRE 3T1YE 1T4NA 4BMJA 1G2DC 1JK2A 1EH7A 2CT1A 3BBGA 2EOHA 2JOXA 2YTOA 2E5LE 2I13A 5A2QC 2EL5A 3FIGA 2FV4B 1LLMC 1PJSA 2YTPA 2NA2A 1UHZA 2K4VA 3AV0A 5TSEA 4N4RB 4MLVA 1DGCA 4WXCA 2JPAA 5IT9C 4R2AA 4R2RA 2EE8A 3C4BA 3J80C 2EMGA 3L00A 5A6JA 4LFAE 1WHQA 2V89A 3IWDA 2MDGA 1KYQA 3ADGA 2EM4A 1EH6A 2Q8UA 4F54A 4X62E 2VF1A 2YU8A 3DF6A 4O5GA 2EL4A 4JI7E 3J7AG 4B3RE 1BB8A 2GHFA 2E1MA 2E72A 4O24A 4YY3E 4NHRA 2EOEA 3ADLA 3VHTB 4DR5E 5T6JA 4LF6E 4WYQB 2JWOA 4LF4E 2UUBE 5BR8E 2V86A 1WJPA 5A69A 2MKDA 1GQEA 2EOIA 4M9VC 2EZ6A 3VYXA 5LMUE 1MEYC 2EMAA 2EMCA 1X6EA 4JYAE 1B69A 2DMYA 1T39A 1EH8A 3OMLA 2EN4A 4GZNC 1RC7A 4JI0E 2MC6A 5ADZA 2F8BA 1A1GA 4DR4E 2DMIA 1T38A 1L4SA 4WSPA 1DQ3A 2EN7A 4Q35B 2VRDA 3MHHC 2GPIA 2GLIA 3DJWA 4IJDA 3F6GA 4DMIA 4WFTA 2ENCA 3AUZA 5AE1A 1A1JA 3JTZA 3J81C 4R2DA 3MSWA 4O43A 2YTEA 2MC5A 5A6AA 3ADJA 2EN3A 2EOMA 2LT7A 2DIXA 2IHR1 2ENAA 2YT4A 4B3ME 2YWQA 2EM2A 4R2EA 1MGTA 1UBDC 1J26A 1HNWE 2EPCA 4ZYHA 1I94E 2H36X 2V85A 5IWAE 1EKZA 2M7QA 4X66E 5LMNE 1ZAAC 1X3CA 1HNZE 2ODRD 2ZM6E 1STUA 1PJQA 5AASA 2YTIA 3JU0A 2WBUA 2L8TA 1A1FA 4M0VA 1X48A 2JP9A 4TUIA 1T4OA 2EPAA 3EQ1A 2KHXA 2EP3A 1YYOA 4JI4E 4GKJE 2EN1A 4BCAA 2V88A 3BF2A 2LVHA 3VK6A 2DRPA 2UU9E 4OOGC 4RH8A 2EOXA 4JI3E 4HTGA 2LTSA 2V8QB 5KL4A 2YTDA 2N8XA 1ZU1A 2YPNA
chains in the Genus database with same CATH topology
2EOEA 2DLQA 1A1KA 3VHTB 1Z1BA 2EOQA 2EPUA 3UK3C 2EM8A 2J7JA 2EOSA 1WJPA 2WCC3 4IS1C 4R2PA 2MKDA 2EOIA 4M9VC 1A1LA 1MEYC 2EMXA 2EMAA 2EMKA 2EMCA 2YTGA 2RPCA 2BB8A 1TN9A 2EMBA 1X6EA 2YTFA 2EMFA 2EN2A 1B69A 2EM7A 4F2JC 2ADRA 2EN4A 4GZNC 2EMWA 2YRKA 5KL7A 1A1GA 2PRTA 2CTDA 2YTNA 2LO3A 2DMIA 2EM9A 2M9AA 5KL2A 2EJ4A 2EN7A 3MHSC 2VRDA 3MHHC 2LV2A 2NABA 2GLIA 4IJDA 2YSPA 2CSHA 2YTJA 2ENCA 1A1HA 4F6MA 1A1JA 2EOFA 4R2DA 3EPKA 2YSOA 1TF6A 3M99B 1X5WA 2YTEA 4F6NA 2EMYA 2EN3A 5KL6A 2EOJA 2EN8A 2EPXA 2EOMA 4FK5C 3EPLA 2EOYA 1YSAC 2EM0A 1YUIA 2EMLA 2LT7A 2EQ1A 2EOOA 2WBSA 2EM3A 2LCEA 1X6FA 2EPZA 2ENAA 2ELZA 1YUJA 2MKNA 2EM6A 1X6HA 1ZR9A 2EM2A 2EMZA 2R1FA 4R2EA 1TF3A 2EN6A 3EPHA 1UBDC 4R2SA 2EPCA 4R2QA 2EOZA 5KL3A 2DGCA 2EORA 2EMIA 1X3CA 2WBTA 1ZAAC 2YRHA 1G2DC 1JK2A 2CT1A 2EOHA 2YTIA 5KL5A 1NCSA 2YTOA 1F2IG 2A25A 2WBUA 2I13A 2EM5A 2RSIA 4X9JA 1A1FA 2DLKA 2JP9A 2EL5A 2EPAA 1LLMC 2YTPA 2EP3A 1AAYA 1DGCA 2EQ3A 2JPAA 2YRMA 4R2AA 4R2RA 2EN1A 2EE8A 2EPRA 2EMGA 2YU5A 2ENHA 2ELYA 2YTQA 1BBOA 1G2FC 3EPJA 2EMHA 2MDGA 2LVHA 2DRPA 2EM4A 1A1IA 2D9HA 2EOXA 2EQ0A 4WSGA 1P47A 2EPPA 2YU8A 5KL4A 2EL4A 4R2CA 1UN6B 2YTDA 2HGHA 1BB8A 2GHFA 1KJKA 2E72A 2EL6A 1JK1A 1ZU1A 1RMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOE A;  2DLQ A;  1A1K A;  3VHT B;  1Z1B A;  2EOQ A;  2EPU A;  3UK3 C;  2EM8 A;  2J7J A;  2EOS A;  1WJP A;  2WCC 3;  4IS1 C;  4R2P A;  2MKD A;  2EOI A;  4M9V C;  1A1L A;  1MEY C;  2EMX A;  2EMA A;  2EMK A;  2EMC A;  2YTG A;  2RPC A;  2BB8 A;  1TN9 A;  2EMB A;  1X6E A;  2YTF A;  2EMF A;  2EN2 A;  1B69 A;  2EM7 A;  4F2J C;  2ADR A;  2EN4 A;  4GZN C;  2EMW A;  2YRK A;  5KL7 A;  1A1G A;  2PRT A;  2CTD A;  2YTN A;  2LO3 A;  2DMI A;  2EM9 A;  2M9A A;  5KL2 A;  2EJ4 A;  2EN7 A;  3MHS C;  2VRD A;  3MHH C;  2LV2 A;  2NAB A;  2GLI A;  4IJD A;  2YSP A;  2CSH A;  2YTJ A;  2ENC A;  1A1H A;  4F6M A;  1A1J A;  2EOF A;  4R2D A;  3EPK A;  2YSO A;  1TF6 A;  3M99 B;  1X5W A;  2YTE A;  4F6N A;  2EMY A;  2EN3 A;  5KL6 A;  2EOJ A;  2EN8 A;  2EPX A;  2EOM A;  4FK5 C;  3EPL A;  2EOY A;  1YSA C;  2EM0 A;  1YUI A;  2EML A;  2LT7 A;  2EQ1 A;  2EOO A;  2WBS A;  2EM3 A;  2LCE A;  1X6F A;  2EPZ A;  2ENA A;  2ELZ A;  1YUJ A;  2MKN A;  2EM6 A;  1X6H A;  1ZR9 A;  2EM2 A;  2EMZ A;  2R1F A;  4R2E A;  1TF3 A;  2EN6 A;  3EPH A;  1UBD C;  4R2S A;  2EPC A;  4R2Q A;  2EOZ A;  5KL3 A;  2DGC A;  2EOR A;  2EMI A;  1X3C A;  2WBT A;  1ZAA C;  2YRH A;  1G2D C;  1JK2 A;  2CT1 A;  2EOH A;  2YTI A;  5KL5 A;  1NCS A;  2YTO A;  1F2I G;  2A25 A;  2WBU A;  2I13 A;  2EM5 A;  2RSI A;  4X9J A;  1A1F A;  2DLK A;  2JP9 A;  2EL5 A;  2EPA A;  1LLM C;  2YTP A;  2EP3 A;  1AAY A;  1DGC A;  2EQ3 A;  2JPA A;  2YRM A;  4R2A A;  4R2R A;  2EN1 A;  2EE8 A;  2EPR A;  2EMG A;  2YU5 A;  2ENH A;  2ELY A;  2YTQ A;  1BBO A;  1G2F C;  3EPJ A;  2EMH A;  2MDG A;  2LVH A;  2DRP A;  2EM4 A;  1A1I A;  2D9H A;  2EOX A;  2EQ0 A;  4WSG A;  1P47 A;  2EPP A;  2YU8 A;  5KL4 A;  2EL4 A;  4R2C A;  1UN6 B;  2YTD A;  2HGH A;  1BB8 A;  2GHF A;  1KJK A;  2E72 A;  2EL6 A;  1JK1 A;  1ZU1 A;  1RMD A; 
#chains in the Genus database with same CATH topology
 2LUP B;  1A1K A;  4DR7 E;  2EOQ A;  1QNT A;  2RTX A;  1SFE A;  4ZYD A;  1A1L A;  1PJT A;  4DV3 E;  2EMK A;  4BHB A;  4DR1 E;  4X65 E;  2N3H A;  2BB8 A;  1X47 A;  2EMF A;  2EN2 A;  3THO B;  4F9C B;  4NXM E;  5DNY A;  2DSY A;  2ADR A;  3VYY A;  2EMW A;  2YRK A;  4DV5 E;  1HR0 E;  1IQO A;  4BHC A;  2CTD A;  2YTN A;  2M1S A;  4M30 A;  4DV7 E;  2UUC E;  4LF8 E;  2M9A A;  4JI8 E;  4X64 E;  5KL2 A;  2EJ4 A;  2JOB A;  3P1X A;  2NAB A;  4J8Z A;  2LJH A;  4ZYE A;  2YZT A;  2EWL A;  1A1H A;  4F6M A;  1N34 E;  2EOF A;  2UXC E;  1X5W A;  3THN A;  5AC5 A;  2EPL X;  3F6H A;  4LFC E;  1BBG A;  1YFH A;  2EN8 A;  1YSA C;  1YUI A;  1YPN A;  1WHN A;  2M4I A;  2UXD E;  3JAM C;  2EM3 A;  1N36 E;  3H09 A;  2EM6 A;  2VQF E;  4DV4 E;  3KWR A;  4BBY A;  2VE7 C;  1UIL A;  5KL3 A;  3TQM A;  2HHH E;  4KWY A;  2EMI A;  4LF9 E;  3QG5 C;  1SR9 A;  4GKK E;  2B7T A;  4P78 A;  2RSM A;  2EPO A;  1F2I G;  5AE2 A;  4O4K A;  5A6B D;  2RS7 A;  1ZBT A;  2RSI A;  2JYA A;  2JY9 A;  1PKP A;  4JI1 E;  1IMU A;  1AAY A;  2LJU A;  2EPR A;  2YU5 A;  2ENH A;  2ELY A;  1BBO A;  4L5N C;  1WRJ A;  4WPY A;  1J5E E;  1NEI A;  5IV8 B;  3BGH A;  1A1I A;  2D9H A;  2LMZ A;  1PDA A;  2WZO A;  1AH5 A;  1P47 A;  4NXN E;  4ZYG A;  4R2C A;  4KHP E;  4JI2 E;  2HGH A;  4AQY E;  2G7H A;  3HTX A;  5A6K A;  4DR2 E;  2DLQ A;  4WX9 A;  4LFB E;  4JI6 E;  1Z1B A;  2B9D A;  2EPU A;  1FJG E;  4DV0 E;  4R8O A;  2EOS A;  2L2N A;  2WCC 3;  4IS1 C;  4R2P A;  2UUA E;  4WXD A;  4F9B B;  4DV6 E;  1TN9 A;  2EMB A;  4M2Z A;  4RHB B;  2DB2 A;  2NUG A;  4LF7 E;  2EM7 A;  4DKK A;  3OTO E;  4DR6 E;  1O0W A;  2EPN A;  1IBK E;  2MDR A;  2LO3 A;  4BS9 A;  2CPN A;  2EM9 A;  1YZ9 A;  4DUY E;  3LLH A;  3LML A;  3T1H E;  2LV2 A;  2V87 A;  2YSP A;  2CSH A;  2YTJ A;  3EPK A;  1YYW A;  1TF6 A;  5AC4 A;  2ODR C;  2EMY A;  3ADI A;  4DR3 E;  3EPL A;  2LBS B;  2L92 A;  2EM0 A;  2JXP A;  4P7D A;  2EQ1 A;  2WBS A;  3HPZ A;  2JR1 A;  2LCE A;  2R76 A;  1YUJ A;  2ELZ A;  4F9A B;  1X6H A;  1ZR9 A;  2L3C A;  2FTX B;  2EMZ A;  3RMP A;  4HEI A;  2RS6 A;  4R03 A;  1ZBQ A;  1TF3 A;  3IWB A;  2EN6 A;  1N32 E;  4BC7 A;  2V83 A;  5F3W A;  3HQ1 A;  3KZY A;  4R2Q A;  2I9I A;  2DGC A;  2EOR A;  2NUF A;  2WBT A;  2YRH A;  2FGG A;  5KL5 A;  2B3T B;  4B3S E;  2LUQ A;  1NCS A;  2A25 A;  2KOU A;  2EM5 A;  4X9J A;  2DLK A;  1FKA E;  1DI2 A;  1IQS A;  1N33 E;  5IXM B;  2EPK X;  4X8W A;  4KZS A;  2EQ3 A;  1RQ0 A;  4MLQ A;  5CFF E;  2YRM A;  2HC5 A;  4OX9 E;  4JV5 E;  2YTQ A;  1G2F C;  4L8N A;  4LTY A;  2LRS A;  3EPJ A;  2EMH A;  3C4T A;  5LLQ A;  4YHH E;  3J7Y p;  2BBG A;  2EQ0 A;  2L33 A;  4WSG A;  1YYK A;  2EPP A;  4BC9 A;  2K7I A;  4Q28 A;  1UN6 B;  4TUG A;  1KJK A;  2EL6 A;  1JK1 A;  1RMD A;  1IBM E;  5A6B A;  3BID A;  3UK3 C;  2EM8 A;  2J7J A;  5AE3 A;  4I8O A;  3KZZ A;  3C6M A;  4DV1 E;  3ECR A;  5LL6 R;  2EMX A;  4DUZ E;  1XMQ E;  3C6K A;  2YTG A;  1GTK A;  2RPC A;  2L6M A;  1WXR A;  2L3J A;  2YTF A;  2B7V A;  1XMO E;  1X49 A;  3HXL A;  2JVA A;  4F2J C;  2NUE A;  2LTR A;  4LF5 E;  4K0K E;  1T4L B;  2L2K B;  5KL7 A;  2PRT A;  2UXB E;  2L2M A;  4GEQ B;  3MHS C;  1QU6 A;  1N3G A;  2N3G A;  1XNQ E;  2HJJ A;  1GZ6 A;  3K6Q A;  3HPS A;  2YSO A;  3M99 B;  4DV2 E;  4F6N A;  1IBL E;  5KL6 A;  2EOJ A;  4JI5 E;  2EPX A;  4FK5 C;  2EOY A;  2EPM X;  4NZV A;  2EML A;  2EOO A;  1HNX E;  1X6F A;  2EPZ A;  2MKN A;  2F4V E;  3ZOQ B;  2VQE E;  2R1F A;  3IWC A;  5FLX C;  2KON A;  3EPH A;  4R2S A;  2LE2 A;  4LU9 A;  2EOZ A;  2RQL A;  4B3T E;  1XNR E;  3T1Y E;  1T4N A;  4BMJ A;  1G2D C;  1JK2 A;  1EH7 A;  2CT1 A;  3BBG A;  2EOH A;  2JOX A;  2YTO A;  2E5L E;  2I13 A;  5A2Q C;  2EL5 A;  3FIG A;  2FV4 B;  1LLM C;  1PJS A;  2YTP A;  2NA2 A;  1UHZ A;  2K4V A;  3AV0 A;  5TSE A;  4N4R B;  4MLV A;  1DGC A;  4WXC A;  2JPA A;  5IT9 C;  4R2A A;  4R2R A;  2EE8 A;  3C4B A;  3J80 C;  2EMG A;  3L00 A;  5A6J A;  4LFA E;  1WHQ A;  2V89 A;  3IWD A;  2MDG A;  1KYQ A;  3ADG A;  2EM4 A;  1EH6 A;  2Q8U A;  4F54 A;  4X62 E;  2VF1 A;  2YU8 A;  3DF6 A;  4O5G A;  2EL4 A;  4JI7 E;  3J7A G;  4B3R E;  1BB8 A;  2GHF A;  2E1M A;  2E72 A;  4O24 A;  4YY3 E;  4NHR A;  2EOE A;  3ADL A;  3VHT B;  4DR5 E;  5T6J A;  4LF6 E;  4WYQ B;  2JWO A;  4LF4 E;  2UUB E;  5BR8 E;  2V86 A;  1WJP A;  5A69 A;  2MKD A;  1GQE A;  2EOI A;  4M9V C;  2EZ6 A;  3VYX A;  5LMU E;  1MEY C;  2EMA A;  2EMC A;  1X6E A;  4JYA E;  1B69 A;  2DMY A;  1T39 A;  1EH8 A;  3OML A;  2EN4 A;  4GZN C;  1RC7 A;  4JI0 E;  2MC6 A;  5ADZ A;  2F8B A;  1A1G A;  4DR4 E;  2DMI A;  1T38 A;  1L4S A;  4WSP A;  1DQ3 A;  2EN7 A;  4Q35 B;  2VRD A;  3MHH C;  2GPI A;  2GLI A;  3DJW A;  4IJD A;  3F6G A;  4DMI A;  4WFT A;  2ENC A;  3AUZ A;  5AE1 A;  1A1J A;  3JTZ A;  3J81 C;  4R2D A;  3MSW A;  4O43 A;  2YTE A;  2MC5 A;  5A6A A;  3ADJ A;  2EN3 A;  2EOM A;  2LT7 A;  2DIX A;  2IHR 1;  2ENA A;  2YT4 A;  4B3M E;  2YWQ A;  2EM2 A;  4R2E A;  1MGT A;  1UBD C;  1J26 A;  1HNW E;  2EPC A;  4ZYH A;  1I94 E;  2H36 X;  2V85 A;  5IWA E;  1EKZ A;  2M7Q A;  4X66 E;  5LMN E;  1ZAA C;  1X3C A;  1HNZ E;  2ODR D;  2ZM6 E;  1STU A;  1PJQ A;  5AAS A;  2YTI A;  3JU0 A;  2WBU A;  2L8T A;  1A1F A;  4M0V A;  1X48 A;  2JP9 A;  4TUI A;  1T4O A;  2EPA A;  3EQ1 A;  2KHX A;  2EP3 A;  1YYO A;  4JI4 E;  4GKJ E;  2EN1 A;  4BCA A;  2V88 A;  3BF2 A;  2LVH A;  3VK6 A;  2DRP A;  2UU9 E;  4OOG C;  4RH8 A;  2EOX A;  4JI3 E;  4HTG A;  2LTS A;  2V8Q B;  5KL4 A;  2YTD A;  2N8X A;  1ZU1 A;  2YPN A; 
#chains in the Genus database with same CATH homology
 2EOE A;  2DLQ A;  1A1K A;  3VHT B;  1Z1B A;  2EOQ A;  2EPU A;  3UK3 C;  2EM8 A;  2J7J A;  2EOS A;  1WJP A;  2WCC 3;  4IS1 C;  4R2P A;  2MKD A;  2EOI A;  4M9V C;  1A1L A;  1MEY C;  2EMX A;  2EMA A;  2EMK A;  2EMC A;  2YTG A;  2RPC A;  2BB8 A;  1TN9 A;  2EMB A;  1X6E A;  2YTF A;  2EMF A;  2EN2 A;  1B69 A;  2EM7 A;  4F2J C;  2ADR A;  2EN4 A;  4GZN C;  2EMW A;  2YRK A;  5KL7 A;  1A1G A;  2PRT A;  2CTD A;  2YTN A;  2LO3 A;  2DMI A;  2EM9 A;  2M9A A;  5KL2 A;  2EJ4 A;  2EN7 A;  3MHS C;  2VRD A;  3MHH C;  2LV2 A;  2NAB A;  2GLI A;  4IJD A;  2YSP A;  2CSH A;  2YTJ A;  2ENC A;  1A1H A;  4F6M A;  1A1J A;  2EOF A;  4R2D A;  3EPK A;  2YSO A;  1TF6 A;  3M99 B;  1X5W A;  2YTE A;  4F6N A;  2EMY A;  2EN3 A;  5KL6 A;  2EOJ A;  2EN8 A;  2EPX A;  2EOM A;  4FK5 C;  3EPL A;  2EOY A;  1YSA C;  2EM0 A;  1YUI A;  2EML A;  2LT7 A;  2EQ1 A;  2EOO A;  2WBS A;  2EM3 A;  2LCE A;  1X6F A;  2EPZ A;  2ENA A;  2ELZ A;  1YUJ A;  2MKN A;  2EM6 A;  1X6H A;  1ZR9 A;  2EM2 A;  2EMZ A;  2R1F A;  4R2E A;  1TF3 A;  2EN6 A;  3EPH A;  1UBD C;  4R2S A;  2EPC A;  4R2Q A;  2EOZ A;  5KL3 A;  2DGC A;  2EOR A;  2EMI A;  1X3C A;  2WBT A;  1ZAA C;  2YRH A;  1G2D C;  1JK2 A;  2CT1 A;  2EOH A;  2YTI A;  5KL5 A;  1NCS A;  2YTO A;  1F2I G;  2A25 A;  2WBU A;  2I13 A;  2EM5 A;  2RSI A;  4X9J A;  1A1F A;  2DLK A;  2JP9 A;  2EL5 A;  2EPA A;  1LLM C;  2YTP A;  2EP3 A;  1AAY A;  1DGC A;  2EQ3 A;  2JPA A;  2YRM A;  4R2A A;  4R2R A;  2EN1 A;  2EE8 A;  2EPR A;  2EMG A;  2YU5 A;  2ENH A;  2ELY A;  2YTQ A;  1BBO A;  1G2F C;  3EPJ A;  2EMH A;  2MDG A;  2LVH A;  2DRP A;  2EM4 A;  1A1I A;  2D9H A;  2EOX A;  2EQ0 A;  4WSG A;  1P47 A;  2EPP A;  2YU8 A;  5KL4 A;  2EL4 A;  4R2C A;  1UN6 B;  2YTD A;  2HGH A;  1BB8 A;  2GHF A;  1KJK A;  2E72 A;  2EL6 A;  1JK1 A;  1ZU1 A;  1RMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...