2ENCA

Solution structure of the c2h2 type zinc finger (region 395-427) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPFKCEECGKGFYTNSQCYSHQRSHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 395-427) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2encA01
2EN7A 2RPCA 2EPXA 2HGHA 1TN9A 4IS1C 2LT7A 2ELYA 1TF6A 1YSAC 2JP9A 4F6NA 1KJKA 2EN8A 1NCSA 1WJPA 2ENCA 2EM4A 1JK1A 2EMWA 2EORA 3M99B 2BB8A 2YU8A 1ZU1A 4R2SA 2YTIA 2EPAA 1ZAAC 2PRTA 1A1JA 1DGCA 2EOIA 2EOXA 2EM9A 1A1KA 1RMDA 2EMCA 2EOYA 2EM6A 2EOJA 2EJ4A 2EOZA 2VRDA 1F2IG 2EP3A 2YTOA 5KL3A 3EPJA 2EOHA 2YTJA 5KL4A 4R2PA 2R1FA 4GZNC 1YUIA 1X6FA 2YTEA 2EPRA 2WBUA 2EMHA 2YTGA 2CT1A 1AAYA 3MHSC 2WBTA 4R2QA 2YSPA 2GHFA 1ZR9A 1UBDC 3EPHA 1TF3A 4R2RA 2WCC3 1BB8A 2EE8A 2EM3A 2EN1A 2EMIA 2EMZA 2EN6A 4R2AA 2EM2A 2EMBA 2EPZA 4M9VC 1JK2A 3MHHC 1X3CA 2YTFA 2J7JA 2DLQA 2EPPA 2I13A 4FK5C 1G2FC 5KL5A 2RSIA 2EQ3A 2EMFA 2YTPA 2A25A 2EM7A 2NABA 2ENHA 3EPLA 3UK3C 4F2JC 2EOOA 2CTDA 2EL5A 4R2EA 2LCEA 2EQ1A 2EMAA 2YRMA 2EMKA 2EOQA 2EN2A 4X9JA 2EM5A 2WBSA 2D9HA 1P47A 1A1HA 1A1FA 2EPUA 1MEYC 1UN6B 1Z1BA 2MDGA 2YU5A 2EMGA 2EN4A 2YTNA 2LV2A 4IJDA 1B69A 2MKDA 1X6EA 2EN3A 2EL4A 2LVHA 5KL6A 2JPAA 4WSGA 2ADRA 2YTQA 1X6HA 4R2CA 1YUJA 2EMYA 5KL2A 2YTDA 2DRPA 2DMIA 2EL6A 2EM8A 1A1IA 2GLIA 1BBOA 2EOMA 2EMXA 1A1LA 2YSOA 2EQ0A 2M9AA 4R2DA 2EOFA 1A1GA 2DLKA 2MKNA 2DGCA 5KL7A 2ELZA 2YRHA 2EM0A 3EPKA 2E72A 2ENAA 2EMLA 4F6MA 1G2DC 2YRKA 1X5WA 1LLMC 3VHTB 2EOSA 2EPCA 2LO3A 2CSHA 2EOEA
chains in the Genus database with same CATH superfamily
2EN7A 2B7VA 2RPCA 1PJQA 4LFCE 1MGTA 2LT7A 1TF6A 2JP9A 4RH8A 1NEIA 4JI6E 3C6KA 4BC9A 2YTIA 3J7AG 1DQ3A 4LF5E 4DR6E 2JOBA 2EOIA 2F4VE 4LTYA 2EP3A 2UXCE 5KL3A 2YTJA 4JI1E 2B7TA 5LLQA 2UUAE 4DUYE 2VF1A 2EPRA 2WBUA 4J8ZA 2CT1A 1YPNA 1T4NA 2WBTA 2YSPA 1IBKE 1TF3A 1N3GA 2IHR1 4R2RA 4BC7A 4X65E 2EM3A 1ZBTA 2EMIA 2EMBA 2V87A 2I9IA 4DV4E 4M9VC 3HQ1A 1DI2A 4KWYA 1X3CA 4GKKE 2NUGA 2K4VA 3L00A 1G2FC 2GPIA 2EQ3A 2EMFA 4DR3E 1XNQE 2HJJA 3BIDA 4WPYA 4YY3E 4NHRA 1XMQE 1IBME 5AASA 2EQ1A 1HR0E 1X47A 2MDRA 4LU9A 2WBSA 2EM5A 1A1HA 2EPUA 2L2NA 2MDGA 2YU5A 2EPLX 2K7IA 2N3GA 4LF8E 1RQ0A 3C4BA 2CPNA 1X6EA 3TQMA 2EL4A 1J5EE 3T1YE 5KL6A 4F9CB 2ADRA 2YTQA 3F6HA 1XMOE 4DR7E 5AC5A 4JI2E 1YUJA 5KL2A 2EPNA 4BHBA 4NXNE 3IWCA 2EMXA 2EQ0A 2M9AA 4R2DA 2EOFA 2NUEA 1QNTA 4M0VA 3ADLA 2ELZA 2M7QA 2YRHA 2EM0A 4DR1E 1YFHA 2ENAA 1SFEA 4HTGA 4F6MA 2YT4A 4O4KA 2ZM6E 3THNA 2M4IA 3LMLA 2CSHA 3ADIA 2LUQA 4R03A 4ZYEA 2EPXA 4P78A 1TN9A 4F6NA 2JY9A 2EN8A 1WJPA 4KHPE 2EMWA 2EORA 1EH6A 2YU8A 2EPAA 2V86A 4M30A 2RTXA 1DGCA 5AE1A 1KYQA 2DB2A 2EOZA 2EJ4A 5ADZA 2RSMA 2RQLA 3EPJA 4L8NA 2L6MA 2E5LE 1PJSA 5TSEA 1X6FA 2YTEA 3C6MA 4JI7E 5A6BA 4B3SE 2JWOA 1X48A 1UBDC 4WX9A 4Q28A 3FIGA 1YYWA 1QU6A 2WCC3 2DMYA 1BB8A 2H36X 2KONA 4JI8E 2EMZA 2EN6A 5LMUE 1O0WA 3MHHC 1PDAA 2J7JA 3T1HE 2JR1A 2EPPA 4X66E 5A2QC 1YYKA 2DSYA 1YZ9A 2HHHE 1GTKA 1WHNA 3AV0A 4TUGA 1BBGA 2EM7A 2V8QB 3DF6A 1EKZA 4DR4E 5T6JA 5A6BD 3UK3C 2G7HA 4R2EA 4X64E 1I94E 5IV8B 1P47A 2EN2A 4X9JA 1UN6B 1XNRE 2N8XA 1PKPA 1WRJA 4LF4E 1UILA 4BMJA 3OMLA 4F9BB 4DUZE 2E1MA 2JPAA 3VYYA 3IWBA 1X6HA 1N32E 2DIXA 2KHXA 4ZYHA 2YTDA 3KZYA 2EL6A 2EM8A 4L5NC 2GLIA 3ZOQB 1PJTA 2EOMA 2WZOA 4BHCA 1HNXE 1A1GA 2MKNA 2DGCA 4B3TE 5IXMB 4DV3E 2KOUA 2EPKX 4BCAA 2YRKA 3VHTB 4DR5E 4OX9E 2EPCA 2R76A 4MLVA 3BF2A 3RMPA 2HGHA 4JYAE 2L33A 1KJKA 1NCSA 4DMIA 2YWQA 3M99B 2BB8A 1ZU1A 2V85A 4Q35B 4X62E 4B3RE 4M2ZA 2MC5A 4JV5E 1HNWE 1A1KA 2EMCA 2EOYA 2EM6A 2VRDA 4DV1E 1GZ6A 2YTOA 2EOHA 5KL4A 1T4LB 4R2PA 2R1FA 4GZNC 1UHZA 3LLHA 2UU9E 2UUBE 1HNZE 1YUIA 2YTGA 4OOGC 4GKJE 1AAYA 3QG5C 2FTXB 3KZZA 2LBSB 4WYQB 2EPOA 1IQSA 1ZR9A 4AQYE 2RS7A 4BBYA 4DKKA 1T38A 4X8WA 2EE8A 5A6KA 2EN1A 2JVAA 5A6JA 1FKAE 4WFTA 4R2AA 4R8OA 2RS6A 2B9DA 3F6GA 5A6AA 1STUA 2LJHA 1GQEA 4O43A 2FGGA 1AH5A 2RSIA 2YTPA 4DR2E 2ENHA 4MLQA 3EPLA 3MSWA 2UXBE 2EOOA 2EL5A 3J80C 2LCEA 2LTRA 2YRMA 2EOQA 1IMUA 1A1FA 2D9HA 2N3HA 2BBGA 5FLXC 1WXRA 5A69A 2VQEE 5AE3A 2EMGA 5IT9C 2EN4A 4IJDA 1WHQA 3OTOE 2V89A 2EN3A 2LE2A 4NZVA 2M1SA 3VYXA 2LVHA 4B3ME 4LFBE 1IBLE 2V88A 4R2CA 4JI5E 4F54A 5IWAE 4JI4E 2DMIA 3HPSA 5DNYA 2JOXA 2JXPA 2YSOA 3EQ1A 1T4OA 2L2MA 5KL7A 1ZBQA 2EMLA 2UXDE 4O5GA 1X5WA 2L92A 2EOSA 3KWRA 2LUPB 1IQOA 1EH7A 4TUIA 2L8TA 2EOEA 3H09A 5LL6R 3JTZA 4DV7E 4DV2E 4IS1C 2ELYA 1YSAC 4WXCA 2L3JA 2ENCA 4WXDA 2EM4A 1JK1A 2LTSA 4R2SA 1ZAAC 4N4RB 2NA2A 2PRTA 1A1JA 2YZTA 4I8OA 2EOXA 3HTXA 1J26A 2EM9A 1RMDA 2B3TB 3THOB 2EOJA 1F2IG 2V83A 2LJUA 3HXLA 2ODRC 4WSPA 2EZ6A 3BGHA 4BS9A 2LRSA 4GEQB 1N36E 4DV0E 2EMHA 3MHSC 4R2QA 2GHFA 3EPHA 2MC6A 3IWDA 2HC5A 3HPZA 1N33E 4LF7E 1EH8A 2EM2A 2EPZA 4P7DA 4YHHE 4JI3E 3ADJA 5AE2A 4HEIA 1JK2A 2LMZA 2Q8UA 2YTFA 2DLQA 2I13A 2JYAA 4FK5C 4DV5E 4ZYGA 5KL5A 3J7Yp 2A25A 2NABA 3K6QA 2L2KB 4LF9E 2YPNA 4F2JC 4JI0E 5LMNE 4K0KE 1X49A 2CTDA 4RHBB 3BBGA 2EMAA 3ECRA 5AC4A 2EMKA 2VQFE 1MEYC 2EPMX 1Z1BA 4O24A 4LFAE 3JU0A 4KZSA 4LF6E 2YTNA 1B69A 2LV2A 2MKDA 3C4TA 1SR9A 2EWLA 3JAMC 2NUFA 4WSGA 3ADGA 3DJWA 1T39A 4DV6E 1YYOA 3VK6A 4ZYDA 2EMYA 2UUCE 5CFFE 2DRPA 1BBOA 1A1IA 1A1LA 2F8BA 2VE7C 2DLKA 2ODRD 3AUZA 1RC7A 4NXME 2L3CA 3EPKA 2E72A 1N34E 3J81C 3P1XA 1G2DC 1L4SA 1LLMC 5F3WA 2FV4B 4F9AB 5BR8E 2LO3A 1FJGE
chains in the Genus database with same CATH topology
2EN7A 2RPCA 2EPXA 2HGHA 1TN9A 4IS1C 2LT7A 2ELYA 1TF6A 1YSAC 2JP9A 4F6NA 1KJKA 2EN8A 1NCSA 1WJPA 2ENCA 2EM4A 1JK1A 2EMWA 2EORA 3M99B 2BB8A 2YU8A 1ZU1A 4R2SA 2YTIA 2EPAA 1ZAAC 2PRTA 1A1JA 1DGCA 2EOIA 2EOXA 2EM9A 1A1KA 1RMDA 2EMCA 2EOYA 2EM6A 2EOJA 2EJ4A 2EOZA 2VRDA 1F2IG 2EP3A 2YTOA 5KL3A 3EPJA 2EOHA 2YTJA 5KL4A 4R2PA 2R1FA 4GZNC 1YUIA 1X6FA 2YTEA 2EPRA 2WBUA 2EMHA 2YTGA 2CT1A 1AAYA 3MHSC 2WBTA 4R2QA 2YSPA 2GHFA 1ZR9A 1UBDC 3EPHA 1TF3A 4R2RA 2WCC3 1BB8A 2EE8A 2EM3A 2EN1A 2EMIA 2EMZA 2EN6A 4R2AA 2EM2A 2EMBA 2EPZA 4M9VC 1JK2A 3MHHC 1X3CA 2YTFA 2J7JA 2DLQA 2EPPA 2I13A 4FK5C 1G2FC 5KL5A 2RSIA 2EQ3A 2EMFA 2YTPA 2A25A 2EM7A 2NABA 2ENHA 3EPLA 3UK3C 4F2JC 2EOOA 2CTDA 2EL5A 4R2EA 2LCEA 2EQ1A 2EMAA 2YRMA 2EMKA 2EOQA 2EN2A 4X9JA 2EM5A 2WBSA 2D9HA 1P47A 1A1HA 1A1FA 2EPUA 1MEYC 1UN6B 1Z1BA 2MDGA 2YU5A 2EMGA 2EN4A 2YTNA 2LV2A 4IJDA 1B69A 2MKDA 1X6EA 2EN3A 2EL4A 2LVHA 5KL6A 2JPAA 4WSGA 2ADRA 2YTQA 1X6HA 4R2CA 1YUJA 2EMYA 5KL2A 2YTDA 2DRPA 2DMIA 2EL6A 2EM8A 1A1IA 2GLIA 1BBOA 2EOMA 2EMXA 1A1LA 2YSOA 2EQ0A 2M9AA 4R2DA 2EOFA 1A1GA 2DLKA 2MKNA 2DGCA 5KL7A 2ELZA 2YRHA 2EM0A 3EPKA 2E72A 2ENAA 2EMLA 4F6MA 1G2DC 2YRKA 1X5WA 1LLMC 3VHTB 2EOSA 2EPCA 2LO3A 2CSHA 2EOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN7 A;  2RPC A;  2EPX A;  2HGH A;  1TN9 A;  4IS1 C;  2LT7 A;  2ELY A;  1TF6 A;  1YSA C;  2JP9 A;  4F6N A;  1KJK A;  2EN8 A;  1NCS A;  1WJP A;  2ENC A;  2EM4 A;  1JK1 A;  2EMW A;  2EOR A;  3M99 B;  2BB8 A;  2YU8 A;  1ZU1 A;  4R2S A;  2YTI A;  2EPA A;  1ZAA C;  2PRT A;  1A1J A;  1DGC A;  2EOI A;  2EOX A;  2EM9 A;  1A1K A;  1RMD A;  2EMC A;  2EOY A;  2EM6 A;  2EOJ A;  2EJ4 A;  2EOZ A;  2VRD A;  1F2I G;  2EP3 A;  2YTO A;  5KL3 A;  3EPJ A;  2EOH A;  2YTJ A;  5KL4 A;  4R2P A;  2R1F A;  4GZN C;  1YUI A;  1X6F A;  2YTE A;  2EPR A;  2WBU A;  2EMH A;  2YTG A;  2CT1 A;  1AAY A;  3MHS C;  2WBT A;  4R2Q A;  2YSP A;  2GHF A;  1ZR9 A;  1UBD C;  3EPH A;  1TF3 A;  4R2R A;  2WCC 3;  1BB8 A;  2EE8 A;  2EM3 A;  2EN1 A;  2EMI A;  2EMZ A;  2EN6 A;  4R2A A;  2EM2 A;  2EMB A;  2EPZ A;  4M9V C;  1JK2 A;  3MHH C;  1X3C A;  2YTF A;  2J7J A;  2DLQ A;  2EPP A;  2I13 A;  4FK5 C;  1G2F C;  5KL5 A;  2RSI A;  2EQ3 A;  2EMF A;  2YTP A;  2A25 A;  2EM7 A;  2NAB A;  2ENH A;  3EPL A;  3UK3 C;  4F2J C;  2EOO A;  2CTD A;  2EL5 A;  4R2E A;  2LCE A;  2EQ1 A;  2EMA A;  2YRM A;  2EMK A;  2EOQ A;  2EN2 A;  4X9J A;  2EM5 A;  2WBS A;  2D9H A;  1P47 A;  1A1H A;  1A1F A;  2EPU A;  1MEY C;  1UN6 B;  1Z1B A;  2MDG A;  2YU5 A;  2EMG A;  2EN4 A;  2YTN A;  2LV2 A;  4IJD A;  1B69 A;  2MKD A;  1X6E A;  2EN3 A;  2EL4 A;  2LVH A;  5KL6 A;  2JPA A;  4WSG A;  2ADR A;  2YTQ A;  1X6H A;  4R2C A;  1YUJ A;  2EMY A;  5KL2 A;  2YTD A;  2DRP A;  2DMI A;  2EL6 A;  2EM8 A;  1A1I A;  2GLI A;  1BBO A;  2EOM A;  2EMX A;  1A1L A;  2YSO A;  2EQ0 A;  2M9A A;  4R2D A;  2EOF A;  1A1G A;  2DLK A;  2MKN A;  2DGC A;  5KL7 A;  2ELZ A;  2YRH A;  2EM0 A;  3EPK A;  2E72 A;  2ENA A;  2EML A;  4F6M A;  1G2D C;  2YRK A;  1X5W A;  1LLM C;  3VHT B;  2EOS A;  2EPC A;  2LO3 A;  2CSH A;  2EOE A; 
#chains in the Genus database with same CATH topology
 2EN7 A;  2B7V A;  2RPC A;  1PJQ A;  4LFC E;  1MGT A;  2LT7 A;  1TF6 A;  2JP9 A;  4RH8 A;  1NEI A;  4JI6 E;  3C6K A;  4BC9 A;  2YTI A;  3J7A G;  1DQ3 A;  4LF5 E;  4DR6 E;  2JOB A;  2EOI A;  2F4V E;  4LTY A;  2EP3 A;  2UXC E;  5KL3 A;  2YTJ A;  4JI1 E;  2B7T A;  5LLQ A;  2UUA E;  4DUY E;  2VF1 A;  2EPR A;  2WBU A;  4J8Z A;  2CT1 A;  1YPN A;  1T4N A;  2WBT A;  2YSP A;  1IBK E;  1TF3 A;  1N3G A;  2IHR 1;  4R2R A;  4BC7 A;  4X65 E;  2EM3 A;  1ZBT A;  2EMI A;  2EMB A;  2V87 A;  2I9I A;  4DV4 E;  4M9V C;  3HQ1 A;  1DI2 A;  4KWY A;  1X3C A;  4GKK E;  2NUG A;  2K4V A;  3L00 A;  1G2F C;  2GPI A;  2EQ3 A;  2EMF A;  4DR3 E;  1XNQ E;  2HJJ A;  3BID A;  4WPY A;  4YY3 E;  4NHR A;  1XMQ E;  1IBM E;  5AAS A;  2EQ1 A;  1HR0 E;  1X47 A;  2MDR A;  4LU9 A;  2WBS A;  2EM5 A;  1A1H A;  2EPU A;  2L2N A;  2MDG A;  2YU5 A;  2EPL X;  2K7I A;  2N3G A;  4LF8 E;  1RQ0 A;  3C4B A;  2CPN A;  1X6E A;  3TQM A;  2EL4 A;  1J5E E;  3T1Y E;  5KL6 A;  4F9C B;  2ADR A;  2YTQ A;  3F6H A;  1XMO E;  4DR7 E;  5AC5 A;  4JI2 E;  1YUJ A;  5KL2 A;  2EPN A;  4BHB A;  4NXN E;  3IWC A;  2EMX A;  2EQ0 A;  2M9A A;  4R2D A;  2EOF A;  2NUE A;  1QNT A;  4M0V A;  3ADL A;  2ELZ A;  2M7Q A;  2YRH A;  2EM0 A;  4DR1 E;  1YFH A;  2ENA A;  1SFE A;  4HTG A;  4F6M A;  2YT4 A;  4O4K A;  2ZM6 E;  3THN A;  2M4I A;  3LML A;  2CSH A;  3ADI A;  2LUQ A;  4R03 A;  4ZYE A;  2EPX A;  4P78 A;  1TN9 A;  4F6N A;  2JY9 A;  2EN8 A;  1WJP A;  4KHP E;  2EMW A;  2EOR A;  1EH6 A;  2YU8 A;  2EPA A;  2V86 A;  4M30 A;  2RTX A;  1DGC A;  5AE1 A;  1KYQ A;  2DB2 A;  2EOZ A;  2EJ4 A;  5ADZ A;  2RSM A;  2RQL A;  3EPJ A;  4L8N A;  2L6M A;  2E5L E;  1PJS A;  5TSE A;  1X6F A;  2YTE A;  3C6M A;  4JI7 E;  5A6B A;  4B3S E;  2JWO A;  1X48 A;  1UBD C;  4WX9 A;  4Q28 A;  3FIG A;  1YYW A;  1QU6 A;  2WCC 3;  2DMY A;  1BB8 A;  2H36 X;  2KON A;  4JI8 E;  2EMZ A;  2EN6 A;  5LMU E;  1O0W A;  3MHH C;  1PDA A;  2J7J A;  3T1H E;  2JR1 A;  2EPP A;  4X66 E;  5A2Q C;  1YYK A;  2DSY A;  1YZ9 A;  2HHH E;  1GTK A;  1WHN A;  3AV0 A;  4TUG A;  1BBG A;  2EM7 A;  2V8Q B;  3DF6 A;  1EKZ A;  4DR4 E;  5T6J A;  5A6B D;  3UK3 C;  2G7H A;  4R2E A;  4X64 E;  1I94 E;  5IV8 B;  1P47 A;  2EN2 A;  4X9J A;  1UN6 B;  1XNR E;  2N8X A;  1PKP A;  1WRJ A;  4LF4 E;  1UIL A;  4BMJ A;  3OML A;  4F9B B;  4DUZ E;  2E1M A;  2JPA A;  3VYY A;  3IWB A;  1X6H A;  1N32 E;  2DIX A;  2KHX A;  4ZYH A;  2YTD A;  3KZY A;  2EL6 A;  2EM8 A;  4L5N C;  2GLI A;  3ZOQ B;  1PJT A;  2EOM A;  2WZO A;  4BHC A;  1HNX E;  1A1G A;  2MKN A;  2DGC A;  4B3T E;  5IXM B;  4DV3 E;  2KOU A;  2EPK X;  4BCA A;  2YRK A;  3VHT B;  4DR5 E;  4OX9 E;  2EPC A;  2R76 A;  4MLV A;  3BF2 A;  3RMP A;  2HGH A;  4JYA E;  2L33 A;  1KJK A;  1NCS A;  4DMI A;  2YWQ A;  3M99 B;  2BB8 A;  1ZU1 A;  2V85 A;  4Q35 B;  4X62 E;  4B3R E;  4M2Z A;  2MC5 A;  4JV5 E;  1HNW E;  1A1K A;  2EMC A;  2EOY A;  2EM6 A;  2VRD A;  4DV1 E;  1GZ6 A;  2YTO A;  2EOH A;  5KL4 A;  1T4L B;  4R2P A;  2R1F A;  4GZN C;  1UHZ A;  3LLH A;  2UU9 E;  2UUB E;  1HNZ E;  1YUI A;  2YTG A;  4OOG C;  4GKJ E;  1AAY A;  3QG5 C;  2FTX B;  3KZZ A;  2LBS B;  4WYQ B;  2EPO A;  1IQS A;  1ZR9 A;  4AQY E;  2RS7 A;  4BBY A;  4DKK A;  1T38 A;  4X8W A;  2EE8 A;  5A6K A;  2EN1 A;  2JVA A;  5A6J A;  1FKA E;  4WFT A;  4R2A A;  4R8O A;  2RS6 A;  2B9D A;  3F6G A;  5A6A A;  1STU A;  2LJH A;  1GQE A;  4O43 A;  2FGG A;  1AH5 A;  2RSI A;  2YTP A;  4DR2 E;  2ENH A;  4MLQ A;  3EPL A;  3MSW A;  2UXB E;  2EOO A;  2EL5 A;  3J80 C;  2LCE A;  2LTR A;  2YRM A;  2EOQ A;  1IMU A;  1A1F A;  2D9H A;  2N3H A;  2BBG A;  5FLX C;  1WXR A;  5A69 A;  2VQE E;  5AE3 A;  2EMG A;  5IT9 C;  2EN4 A;  4IJD A;  1WHQ A;  3OTO E;  2V89 A;  2EN3 A;  2LE2 A;  4NZV A;  2M1S A;  3VYX A;  2LVH A;  4B3M E;  4LFB E;  1IBL E;  2V88 A;  4R2C A;  4JI5 E;  4F54 A;  5IWA E;  4JI4 E;  2DMI A;  3HPS A;  5DNY A;  2JOX A;  2JXP A;  2YSO A;  3EQ1 A;  1T4O A;  2L2M A;  5KL7 A;  1ZBQ A;  2EML A;  2UXD E;  4O5G A;  1X5W A;  2L92 A;  2EOS A;  3KWR A;  2LUP B;  1IQO A;  1EH7 A;  4TUI A;  2L8T A;  2EOE A;  3H09 A;  5LL6 R;  3JTZ A;  4DV7 E;  4DV2 E;  4IS1 C;  2ELY A;  1YSA C;  4WXC A;  2L3J A;  2ENC A;  4WXD A;  2EM4 A;  1JK1 A;  2LTS A;  4R2S A;  1ZAA C;  4N4R B;  2NA2 A;  2PRT A;  1A1J A;  2YZT A;  4I8O A;  2EOX A;  3HTX A;  1J26 A;  2EM9 A;  1RMD A;  2B3T B;  3THO B;  2EOJ A;  1F2I G;  2V83 A;  2LJU A;  3HXL A;  2ODR C;  4WSP A;  2EZ6 A;  3BGH A;  4BS9 A;  2LRS A;  4GEQ B;  1N36 E;  4DV0 E;  2EMH A;  3MHS C;  4R2Q A;  2GHF A;  3EPH A;  2MC6 A;  3IWD A;  2HC5 A;  3HPZ A;  1N33 E;  4LF7 E;  1EH8 A;  2EM2 A;  2EPZ A;  4P7D A;  4YHH E;  4JI3 E;  3ADJ A;  5AE2 A;  4HEI A;  1JK2 A;  2LMZ A;  2Q8U A;  2YTF A;  2DLQ A;  2I13 A;  2JYA A;  4FK5 C;  4DV5 E;  4ZYG A;  5KL5 A;  3J7Y p;  2A25 A;  2NAB A;  3K6Q A;  2L2K B;  4LF9 E;  2YPN A;  4F2J C;  4JI0 E;  5LMN E;  4K0K E;  1X49 A;  2CTD A;  4RHB B;  3BBG A;  2EMA A;  3ECR A;  5AC4 A;  2EMK A;  2VQF E;  1MEY C;  2EPM X;  1Z1B A;  4O24 A;  4LFA E;  3JU0 A;  4KZS A;  4LF6 E;  2YTN A;  1B69 A;  2LV2 A;  2MKD A;  3C4T A;  1SR9 A;  2EWL A;  3JAM C;  2NUF A;  4WSG A;  3ADG A;  3DJW A;  1T39 A;  4DV6 E;  1YYO A;  3VK6 A;  4ZYD A;  2EMY A;  2UUC E;  5CFF E;  2DRP A;  1BBO A;  1A1I A;  1A1L A;  2F8B A;  2VE7 C;  2DLK A;  2ODR D;  3AUZ A;  1RC7 A;  4NXM E;  2L3C A;  3EPK A;  2E72 A;  1N34 E;  3J81 C;  3P1X A;  1G2D C;  1L4S A;  1LLM C;  5F3W A;  2FV4 B;  4F9A B;  5BR8 E;  2LO3 A;  1FJG E; 
#chains in the Genus database with same CATH homology
 2EN7 A;  2RPC A;  2EPX A;  2HGH A;  1TN9 A;  4IS1 C;  2LT7 A;  2ELY A;  1TF6 A;  1YSA C;  2JP9 A;  4F6N A;  1KJK A;  2EN8 A;  1NCS A;  1WJP A;  2ENC A;  2EM4 A;  1JK1 A;  2EMW A;  2EOR A;  3M99 B;  2BB8 A;  2YU8 A;  1ZU1 A;  4R2S A;  2YTI A;  2EPA A;  1ZAA C;  2PRT A;  1A1J A;  1DGC A;  2EOI A;  2EOX A;  2EM9 A;  1A1K A;  1RMD A;  2EMC A;  2EOY A;  2EM6 A;  2EOJ A;  2EJ4 A;  2EOZ A;  2VRD A;  1F2I G;  2EP3 A;  2YTO A;  5KL3 A;  3EPJ A;  2EOH A;  2YTJ A;  5KL4 A;  4R2P A;  2R1F A;  4GZN C;  1YUI A;  1X6F A;  2YTE A;  2EPR A;  2WBU A;  2EMH A;  2YTG A;  2CT1 A;  1AAY A;  3MHS C;  2WBT A;  4R2Q A;  2YSP A;  2GHF A;  1ZR9 A;  1UBD C;  3EPH A;  1TF3 A;  4R2R A;  2WCC 3;  1BB8 A;  2EE8 A;  2EM3 A;  2EN1 A;  2EMI A;  2EMZ A;  2EN6 A;  4R2A A;  2EM2 A;  2EMB A;  2EPZ A;  4M9V C;  1JK2 A;  3MHH C;  1X3C A;  2YTF A;  2J7J A;  2DLQ A;  2EPP A;  2I13 A;  4FK5 C;  1G2F C;  5KL5 A;  2RSI A;  2EQ3 A;  2EMF A;  2YTP A;  2A25 A;  2EM7 A;  2NAB A;  2ENH A;  3EPL A;  3UK3 C;  4F2J C;  2EOO A;  2CTD A;  2EL5 A;  4R2E A;  2LCE A;  2EQ1 A;  2EMA A;  2YRM A;  2EMK A;  2EOQ A;  2EN2 A;  4X9J A;  2EM5 A;  2WBS A;  2D9H A;  1P47 A;  1A1H A;  1A1F A;  2EPU A;  1MEY C;  1UN6 B;  1Z1B A;  2MDG A;  2YU5 A;  2EMG A;  2EN4 A;  2YTN A;  2LV2 A;  4IJD A;  1B69 A;  2MKD A;  1X6E A;  2EN3 A;  2EL4 A;  2LVH A;  5KL6 A;  2JPA A;  4WSG A;  2ADR A;  2YTQ A;  1X6H A;  4R2C A;  1YUJ A;  2EMY A;  5KL2 A;  2YTD A;  2DRP A;  2DMI A;  2EL6 A;  2EM8 A;  1A1I A;  2GLI A;  1BBO A;  2EOM A;  2EMX A;  1A1L A;  2YSO A;  2EQ0 A;  2M9A A;  4R2D A;  2EOF A;  1A1G A;  2DLK A;  2MKN A;  2DGC A;  5KL7 A;  2ELZ A;  2YRH A;  2EM0 A;  3EPK A;  2E72 A;  2ENA A;  2EML A;  4F6M A;  1G2D C;  2YRK A;  1X5W A;  1LLM C;  3VHT B;  2EOS A;  2EPC A;  2LO3 A;  2CSH A;  2EOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...