2ENCA

Solution structure of the c2h2 type zinc finger (region 395-427) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPFKCEECGKGFYTNSQCYSHQRSHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 395-427) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2encA01
1BBOA 2GHFA 4F6NA 3MHSC 2YTQA 1A1IA 2EMLA 2A25A 2EOFA 4R2RA 4R2QA 1JK1A 2DGCA 2DLQA 2EOIA 2LCEA 2R1FA 1ZU1A 2EQ0A 2VRDA 2YTJA 2EM6A 4WSGA 5KL4A 2WBSA 1NCSA 3EPJA 1YSAC 1BB8A 2EN4A 1X6FA 4F6MA 2EM8A 2YSPA 2YU8A 2PRTA 2EOSA 2YRHA 2EM0A 2EOOA 1A1GA 2ENCA 2EM7A 2EL5A 2RPCA 2EN2A 2EM2A 2JPAA 2NABA 1X6EA 2YTIA 2EMGA 4R2SA 1ZR9A 4IS1C 2ELYA 2LV2A 2YTOA 3MHHC 2EMBA 5KL2A 3UK3C 2WBUA 2MKNA 2E72A 2EPUA 2BB8A 2EMWA 2EOXA 2WBTA 2CSHA 2ADRA 3M99B 2EM4A 2YRMA 2EN3A 4X9JA 2EMFA 1KJKA 2EPPA 4F2JC 1A1LA 2D9HA 2YTFA 2CT1A 2EL6A 2MDGA 1YUJA 2EOJA 2EN6A 1UN6B 1P47A 2EMZA 1A1HA 2DLKA 1G2DC 2GLIA 2EL4A 1X5WA 2EORA 1F2IG 3EPLA 3EPHA 1DGCA 2YSOA 2EPRA 2EMIA 2EOZA 2YTDA 1WJPA 2EE8A 5KL6A 2EM5A 2YU5A 2DRPA 2EPXA 2YTGA 1B69A 1AAYA 2EMYA 5KL5A 2EOMA 1A1JA 2RSIA 1Z1BA 2EMAA 2HGHA 2I13A 1MEYC 1X3CA 4R2EA 2LT7A 1A1FA 2EPAA 1YUIA 1TF6A 2EN7A 4R2DA 1JK2A 2EMXA 2EN1A 2LO3A 2EPCA 2EN8A 2ENAA 3VHTB 4R2AA 2EM3A 2WCC3 2EJ4A 1LLMC 2EPZA 2DMIA 1TN9A 2YTPA 4R2PA 2JP9A 2EOHA 2LVHA 2MKDA 1ZAAC 2CTDA 1TF3A 4M9VC 1A1KA 1G2FC 2EOYA 5KL3A 1UBDC 2EM9A 4IJDA 2EQ1A 2M9AA 4GZNC 2EOEA 1RMDA 5KL7A 2YTNA 2YTEA 2J7JA 2EMKA 3EPKA 2EOQA 1X6HA 2ELZA 4FK5C 2EQ3A 2EMHA 2ENHA 2EMCA 4R2CA 2EP3A 2YRKA
chains in the Genus database with same CATH superfamily
5FLXC 1BBOA 4F6NA 3MHSC 4O24A 4LF9E 2EMLA 1NEIA 4R2QA 2DGCA 2MC5A 2LCEA 5A69A 1YSAC 1STUA 2EN4A 4BC7A 3C4TA 1WHQA 1UILA 4MLQA 5CFFE 1XNQE 2EOOA 2YT4A 2VE7C 3ADGA 2EM2A 5BR8E 4R2SA 1ZR9A 4IS1C 2ELYA 2UXDE 5A6AA 2K4VA 3DF6A 1WHNA 2YTOA 3MHHC 2WBUA 2EPUA 4WFTA 1ZBQA 4X66E 3ADIA 4DV6E 5A6BD 4JI5E 2L2MA 1YYKA 3JAMC 3M99B 1WRJA 5LMUE 2UXBE 1HNZE 2LTRA 4RH8A 2LUPB 4ZYEA 2D9HA 1RC7A 2YTFA 3HPSA 3IWDA 2CT1A 4WXCA 4LFCE 3J81C 4B3SE 2V88A 2YPNA 1P47A 1A1HA 2EORA 3EPLA 2L6MA 4DR3E 2B9DA 2V83A 5A2QC 2YTDA 4DUZE 1WJPA 2WZOA 2RS7A 2YU5A 5LMNE 4JYAE 3OMLA 4OOGC 1ZBTA 4NXME 1N32E 1AAYA 2EOMA 2RSIA 2JVAA 2HGHA 5IWAE 1GQEA 2GPIA 5LL6R 3C6MA 3KZZA 1TF6A 2EN7A 4GEQB 2M7QA 5F3WA 2V85A 3QG5C 1XNRE 2EJ4A 1LLMC 4DV0E 1TN9A 2YTPA 4JI2E 2LVHA 1ZAAC 2MKDA 4M2ZA 2CTDA 4M9VC 4LTYA 4X8WA 4DV2E 2M9AA 2LE2A 1XMOE 3HTXA 4LF4E 2YTEA 2VQEE 3KWRA 4L5NC 1IMUA 2F8BA 2L8TA 2EOQA 2ENHA 2EMCA 2LTSA 2EPKX 4LU9A 4NXNE 1N3GA 4JI4E 2ODRD 2UUAE 3H09A 2EPLX 2EOFA 5ADZA 4R2RA 2DB2A 2EQ0A 2VF1A 3THOB 3TQMA 5A6JA 1HNXE 2V8QB 1NCSA 4BMJA 5LLQA 4F6MA 5DNYA 1PJTA 3J7AG 4DV7E 2EOSA 2YRHA 4DR2E 2RPCA 2JPAA 2L33A 2EMGA 3J80C 2I9IA 4YHHE 4WYQB 1PKPA 2K7IA 1AH5A 3F6GA 2EMBA 2RQLA 4DR6E 4L8NA 2G7HA 2KONA 5A6BA 4BS9A 2EOXA 2ODRC 4KZSA 1L4SA 3LMLA 1IBKE 2EMFA 4JI1E 1KJKA 2JXPA 1N34E 4F2JC 4ZYGA 4DR1E 2EN6A 4M30A 4DV5E 2M4IA 2GLIA 1HR0E 3EPHA 2EPRA 4O4KA 4F9BB 2R76A 4LFAE 3THNA 3T1HE 2EM5A 1DI2A 3JTZA 2YTGA 4M0VA 1N33E 2EMYA 2EPNA 1A1JA 4B3RE 2DSYA 2EMAA 1FJGE 1J5EE 1MEYC 4WSPA 3JU0A 1A1FA 2EPAA 1UHZA 1YUIA 1T4LB 1JK2A 4R8OA 2EN1A 3IWCA 2LO3A 5IV8B 2ENAA 2EM3A 2WCC3 2MC6A 1T39A 2JP9A 4R2PA 2FTXB 4Q35B 2EOHA 3ZOQB 1YYOA 3VYXA 2B7TA 5KL3A 4LFBE 2FGGA 4IJDA 4I8OA 2LJHA 1KYQA 2YTNA 3FIGA 4GKKE 2EMKA 2L3JA 4FK5C 4BC9A 4DR5E 2ZM6E 2EQ3A 1WXRA 4OX9E 2EP3A 1FKAE 1X48A 5IT9C 3AUZA 2GHFA 4X65E 1A1IA 2L2KB 2DLQA 4HEIA 4O5GA 1YZ9A 2R1FA 1ZU1A 4KHPE 4X64E 2YTJA 4AQYE 4N4RB 3EPJA 4B3TE 4R03A 2KHXA 2JR1A 4LF7E 2NUGA 1T4OA 2EM8A 2YSPA 2PRTA 2ENCA 2E5LE 4DMIA 2EN2A 3RMPA 2NABA 2YTIA 4Q28A 3IWBA 3J7Yp 4JI3E 1IQOA 1T4NA 4DUYE 4LF6E 3MSWA 2LV2A 2DMYA 2B7VA 1EKZA 4DV1E 3DJWA 4DV4E 4TUGA 3UK3C 4J8ZA 2E72A 1XMQE 4LF8E 2N3HA 2MDRA 2RS6A 3AV0A 2EMWA 2RTXA 3F6HA 2EZ6A 2V87A 2JOBA 1SFEA 2N8XA 2EM4A 2YRMA 2EPPA 2H36X 1A1LA 2LMZA 1GZ6A 2MDGA 1YUJA 3T1YE 4P78A 4RHBB 2CPNA 2DLKA 1G2DC 1MGTA 5AASA 2EL4A 4DKKA 4LF5E 1F2IG 1YYWA 3OTOE 1DGCA 1IBLE 2YSOA 3VK6A 2UUCE 2EMIA 2EOZA 5KL6A 2EE8A 3L00A 1DQ3A 2EPXA 1B69A 5KL5A 3KZYA 1EH7A 1Z1BA 3HXLA 2I13A 2JY9A 3ADJA 4R2EA 5AC4A 4R2DA 2EMXA 3C6KA 1YFHA 2EPCA 2EN8A 3EQ1A 3VHTB 5AE3A 4DR7E 4BCAA 2HJJA 2EPMX 1TF3A 4X62E 2L3CA 4B3ME 3BGHA 4NHRA 1YPNA 4F9CB 1G2FC 4GKJE 4O43A 2EM9A 2F4VE 2V86A 4JI6E 2NUFA 2EOEA 4K0KE 1X47A 2J7JA 3EPKA 2ELZA 1RQ0A 2YRKA 2YWQA 2KOUA 3P1XA 2UXCE 2VQFE 4WXDA 2LBSB 1IBME 2YTQA 3ECRA 2A25A 1EH8A 1JK1A 2EOIA 1PDAA 2UUBE 2VRDA 2EM6A 4WSGA 2LUQA 4BHBA 5KL4A 4TUIA 2WBSA 2JOXA 1BB8A 3LLHA 1X6FA 3VYYA 2FV4B 2YU8A 2YZTA 4BHCA 5TSEA 2EPOA 2EM0A 1A1GA 4F54A 2EM7A 2EL5A 3HQ1A 2NA2A 1X6EA 2IHR1 4JI7E 1QU6A 4KWYA 5KL2A 2MKNA 5T6JA 2UU9E 2BB8A 1IQSA 2JWOA 2HC5A 2WBTA 3ADLA 2L2NA 5IXMB 3BBGA 5AE2A 2CSHA 1I94E 2ADRA 2EN3A 1J26A 4JI0E 4X9JA 5A6KA 5AE1A 1T38A 2EL6A 2LJUA 2HHHE 2EOJA 2EWLA 4NZVA 1UN6B 3BF2A 2EMZA 1HNWE 1X5WA 1X49A 4MLVA 2LRSA 1PJSA 5AC5A 4DR4E 2DRPA 4WPYA 1O0WA 4P7DA 4YY3E 1X3CA 2JYAA 2LT7A 4DV3E 1BBGA 1SR9A 4BBYA 2NUEA 4ZYHA 4R2AA 2L92A 2EPZA 2DMIA 1N36E 1PJQA 4JI8E 2DIXA 2BBGA 1A1KA 2EOYA 2M1SA 4ZYDA 3HPZA 1UBDC 4WX9A 3C4BA 3BIDA 2EQ1A 4GZNC 2Q8UA 2N3GA 1RMDA 5KL7A 1EH6A 2RSMA 1GTKA 1QNTA 4JV5E 1X6HA 4HTGA 4R2CA 2EMHA 2E1MA 2V89A 3K6QA 2B3TB 4F9AB
chains in the Genus database with same CATH topology
1BBOA 2GHFA 4F6NA 3MHSC 2YTQA 1A1IA 2EMLA 2A25A 2EOFA 4R2RA 4R2QA 1JK1A 2DGCA 2DLQA 2EOIA 2LCEA 2R1FA 1ZU1A 2EQ0A 2VRDA 2YTJA 2EM6A 4WSGA 5KL4A 2WBSA 1NCSA 3EPJA 1YSAC 1BB8A 2EN4A 1X6FA 4F6MA 2EM8A 2YSPA 2YU8A 2PRTA 2EOSA 2YRHA 2EM0A 2EOOA 1A1GA 2ENCA 2EM7A 2EL5A 2RPCA 2EN2A 2EM2A 2JPAA 2NABA 1X6EA 2YTIA 2EMGA 4R2SA 1ZR9A 4IS1C 2ELYA 2LV2A 2YTOA 3MHHC 2EMBA 5KL2A 3UK3C 2WBUA 2MKNA 2E72A 2EPUA 2BB8A 2EMWA 2EOXA 2WBTA 2CSHA 2ADRA 3M99B 2EM4A 2YRMA 2EN3A 4X9JA 2EMFA 1KJKA 2EPPA 4F2JC 1A1LA 2D9HA 2YTFA 2CT1A 2EL6A 2MDGA 1YUJA 2EOJA 2EN6A 1UN6B 1P47A 2EMZA 1A1HA 2DLKA 1G2DC 2GLIA 2EL4A 1X5WA 2EORA 1F2IG 3EPLA 3EPHA 1DGCA 2YSOA 2EPRA 2EMIA 2EOZA 2YTDA 1WJPA 2EE8A 5KL6A 2EM5A 2YU5A 2DRPA 2EPXA 2YTGA 1B69A 1AAYA 2EMYA 5KL5A 2EOMA 1A1JA 2RSIA 1Z1BA 2EMAA 2HGHA 2I13A 1MEYC 1X3CA 4R2EA 2LT7A 1A1FA 2EPAA 1YUIA 1TF6A 2EN7A 4R2DA 1JK2A 2EMXA 2EN1A 2LO3A 2EPCA 2EN8A 2ENAA 3VHTB 4R2AA 2EM3A 2WCC3 2EJ4A 1LLMC 2EPZA 2DMIA 1TN9A 2YTPA 4R2PA 2JP9A 2EOHA 2LVHA 2MKDA 1ZAAC 2CTDA 1TF3A 4M9VC 1A1KA 1G2FC 2EOYA 5KL3A 1UBDC 2EM9A 4IJDA 2EQ1A 2M9AA 4GZNC 2EOEA 1RMDA 5KL7A 2YTNA 2YTEA 2J7JA 2EMKA 3EPKA 2EOQA 1X6HA 2ELZA 4FK5C 2EQ3A 2EMHA 2ENHA 2EMCA 4R2CA 2EP3A 2YRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBO A;  2GHF A;  4F6N A;  3MHS C;  2YTQ A;  1A1I A;  2EML A;  2A25 A;  2EOF A;  4R2R A;  4R2Q A;  1JK1 A;  2DGC A;  2DLQ A;  2EOI A;  2LCE A;  2R1F A;  1ZU1 A;  2EQ0 A;  2VRD A;  2YTJ A;  2EM6 A;  4WSG A;  5KL4 A;  2WBS A;  1NCS A;  3EPJ A;  1YSA C;  1BB8 A;  2EN4 A;  1X6F A;  4F6M A;  2EM8 A;  2YSP A;  2YU8 A;  2PRT A;  2EOS A;  2YRH A;  2EM0 A;  2EOO A;  1A1G A;  2ENC A;  2EM7 A;  2EL5 A;  2RPC A;  2EN2 A;  2EM2 A;  2JPA A;  2NAB A;  1X6E A;  2YTI A;  2EMG A;  4R2S A;  1ZR9 A;  4IS1 C;  2ELY A;  2LV2 A;  2YTO A;  3MHH C;  2EMB A;  5KL2 A;  3UK3 C;  2WBU A;  2MKN A;  2E72 A;  2EPU A;  2BB8 A;  2EMW A;  2EOX A;  2WBT A;  2CSH A;  2ADR A;  3M99 B;  2EM4 A;  2YRM A;  2EN3 A;  4X9J A;  2EMF A;  1KJK A;  2EPP A;  4F2J C;  1A1L A;  2D9H A;  2YTF A;  2CT1 A;  2EL6 A;  2MDG A;  1YUJ A;  2EOJ A;  2EN6 A;  1UN6 B;  1P47 A;  2EMZ A;  1A1H A;  2DLK A;  1G2D C;  2GLI A;  2EL4 A;  1X5W A;  2EOR A;  1F2I G;  3EPL A;  3EPH A;  1DGC A;  2YSO A;  2EPR A;  2EMI A;  2EOZ A;  2YTD A;  1WJP A;  2EE8 A;  5KL6 A;  2EM5 A;  2YU5 A;  2DRP A;  2EPX A;  2YTG A;  1B69 A;  1AAY A;  2EMY A;  5KL5 A;  2EOM A;  1A1J A;  2RSI A;  1Z1B A;  2EMA A;  2HGH A;  2I13 A;  1MEY C;  1X3C A;  4R2E A;  2LT7 A;  1A1F A;  2EPA A;  1YUI A;  1TF6 A;  2EN7 A;  4R2D A;  1JK2 A;  2EMX A;  2EN1 A;  2LO3 A;  2EPC A;  2EN8 A;  2ENA A;  3VHT B;  4R2A A;  2EM3 A;  2WCC 3;  2EJ4 A;  1LLM C;  2EPZ A;  2DMI A;  1TN9 A;  2YTP A;  4R2P A;  2JP9 A;  2EOH A;  2LVH A;  2MKD A;  1ZAA C;  2CTD A;  1TF3 A;  4M9V C;  1A1K A;  1G2F C;  2EOY A;  5KL3 A;  1UBD C;  2EM9 A;  4IJD A;  2EQ1 A;  2M9A A;  4GZN C;  2EOE A;  1RMD A;  5KL7 A;  2YTN A;  2YTE A;  2J7J A;  2EMK A;  3EPK A;  2EOQ A;  1X6H A;  2ELZ A;  4FK5 C;  2EQ3 A;  2EMH A;  2ENH A;  2EMC A;  4R2C A;  2EP3 A;  2YRK A; 
#chains in the Genus database with same CATH topology
 5FLX C;  1BBO A;  4F6N A;  3MHS C;  4O24 A;  4LF9 E;  2EML A;  1NEI A;  4R2Q A;  2DGC A;  2MC5 A;  2LCE A;  5A69 A;  1YSA C;  1STU A;  2EN4 A;  4BC7 A;  3C4T A;  1WHQ A;  1UIL A;  4MLQ A;  5CFF E;  1XNQ E;  2EOO A;  2YT4 A;  2VE7 C;  3ADG A;  2EM2 A;  5BR8 E;  4R2S A;  1ZR9 A;  4IS1 C;  2ELY A;  2UXD E;  5A6A A;  2K4V A;  3DF6 A;  1WHN A;  2YTO A;  3MHH C;  2WBU A;  2EPU A;  4WFT A;  1ZBQ A;  4X66 E;  3ADI A;  4DV6 E;  5A6B D;  4JI5 E;  2L2M A;  1YYK A;  3JAM C;  3M99 B;  1WRJ A;  5LMU E;  2UXB E;  1HNZ E;  2LTR A;  4RH8 A;  2LUP B;  4ZYE A;  2D9H A;  1RC7 A;  2YTF A;  3HPS A;  3IWD A;  2CT1 A;  4WXC A;  4LFC E;  3J81 C;  4B3S E;  2V88 A;  2YPN A;  1P47 A;  1A1H A;  2EOR A;  3EPL A;  2L6M A;  4DR3 E;  2B9D A;  2V83 A;  5A2Q C;  2YTD A;  4DUZ E;  1WJP A;  2WZO A;  2RS7 A;  2YU5 A;  5LMN E;  4JYA E;  3OML A;  4OOG C;  1ZBT A;  4NXM E;  1N32 E;  1AAY A;  2EOM A;  2RSI A;  2JVA A;  2HGH A;  5IWA E;  1GQE A;  2GPI A;  5LL6 R;  3C6M A;  3KZZ A;  1TF6 A;  2EN7 A;  4GEQ B;  2M7Q A;  5F3W A;  2V85 A;  3QG5 C;  1XNR E;  2EJ4 A;  1LLM C;  4DV0 E;  1TN9 A;  2YTP A;  4JI2 E;  2LVH A;  1ZAA C;  2MKD A;  4M2Z A;  2CTD A;  4M9V C;  4LTY A;  4X8W A;  4DV2 E;  2M9A A;  2LE2 A;  1XMO E;  3HTX A;  4LF4 E;  2YTE A;  2VQE E;  3KWR A;  4L5N C;  1IMU A;  2F8B A;  2L8T A;  2EOQ A;  2ENH A;  2EMC A;  2LTS A;  2EPK X;  4LU9 A;  4NXN E;  1N3G A;  4JI4 E;  2ODR D;  2UUA E;  3H09 A;  2EPL X;  2EOF A;  5ADZ A;  4R2R A;  2DB2 A;  2EQ0 A;  2VF1 A;  3THO B;  3TQM A;  5A6J A;  1HNX E;  2V8Q B;  1NCS A;  4BMJ A;  5LLQ A;  4F6M A;  5DNY A;  1PJT A;  3J7A G;  4DV7 E;  2EOS A;  2YRH A;  4DR2 E;  2RPC A;  2JPA A;  2L33 A;  2EMG A;  3J80 C;  2I9I A;  4YHH E;  4WYQ B;  1PKP A;  2K7I A;  1AH5 A;  3F6G A;  2EMB A;  2RQL A;  4DR6 E;  4L8N A;  2G7H A;  2KON A;  5A6B A;  4BS9 A;  2EOX A;  2ODR C;  4KZS A;  1L4S A;  3LML A;  1IBK E;  2EMF A;  4JI1 E;  1KJK A;  2JXP A;  1N34 E;  4F2J C;  4ZYG A;  4DR1 E;  2EN6 A;  4M30 A;  4DV5 E;  2M4I A;  2GLI A;  1HR0 E;  3EPH A;  2EPR A;  4O4K A;  4F9B B;  2R76 A;  4LFA E;  3THN A;  3T1H E;  2EM5 A;  1DI2 A;  3JTZ A;  2YTG A;  4M0V A;  1N33 E;  2EMY A;  2EPN A;  1A1J A;  4B3R E;  2DSY A;  2EMA A;  1FJG E;  1J5E E;  1MEY C;  4WSP A;  3JU0 A;  1A1F A;  2EPA A;  1UHZ A;  1YUI A;  1T4L B;  1JK2 A;  4R8O A;  2EN1 A;  3IWC A;  2LO3 A;  5IV8 B;  2ENA A;  2EM3 A;  2WCC 3;  2MC6 A;  1T39 A;  2JP9 A;  4R2P A;  2FTX B;  4Q35 B;  2EOH A;  3ZOQ B;  1YYO A;  3VYX A;  2B7T A;  5KL3 A;  4LFB E;  2FGG A;  4IJD A;  4I8O A;  2LJH A;  1KYQ A;  2YTN A;  3FIG A;  4GKK E;  2EMK A;  2L3J A;  4FK5 C;  4BC9 A;  4DR5 E;  2ZM6 E;  2EQ3 A;  1WXR A;  4OX9 E;  2EP3 A;  1FKA E;  1X48 A;  5IT9 C;  3AUZ A;  2GHF A;  4X65 E;  1A1I A;  2L2K B;  2DLQ A;  4HEI A;  4O5G A;  1YZ9 A;  2R1F A;  1ZU1 A;  4KHP E;  4X64 E;  2YTJ A;  4AQY E;  4N4R B;  3EPJ A;  4B3T E;  4R03 A;  2KHX A;  2JR1 A;  4LF7 E;  2NUG A;  1T4O A;  2EM8 A;  2YSP A;  2PRT A;  2ENC A;  2E5L E;  4DMI A;  2EN2 A;  3RMP A;  2NAB A;  2YTI A;  4Q28 A;  3IWB A;  3J7Y p;  4JI3 E;  1IQO A;  1T4N A;  4DUY E;  4LF6 E;  3MSW A;  2LV2 A;  2DMY A;  2B7V A;  1EKZ A;  4DV1 E;  3DJW A;  4DV4 E;  4TUG A;  3UK3 C;  4J8Z A;  2E72 A;  1XMQ E;  4LF8 E;  2N3H A;  2MDR A;  2RS6 A;  3AV0 A;  2EMW A;  2RTX A;  3F6H A;  2EZ6 A;  2V87 A;  2JOB A;  1SFE A;  2N8X A;  2EM4 A;  2YRM A;  2EPP A;  2H36 X;  1A1L A;  2LMZ A;  1GZ6 A;  2MDG A;  1YUJ A;  3T1Y E;  4P78 A;  4RHB B;  2CPN A;  2DLK A;  1G2D C;  1MGT A;  5AAS A;  2EL4 A;  4DKK A;  4LF5 E;  1F2I G;  1YYW A;  3OTO E;  1DGC A;  1IBL E;  2YSO A;  3VK6 A;  2UUC E;  2EMI A;  2EOZ A;  5KL6 A;  2EE8 A;  3L00 A;  1DQ3 A;  2EPX A;  1B69 A;  5KL5 A;  3KZY A;  1EH7 A;  1Z1B A;  3HXL A;  2I13 A;  2JY9 A;  3ADJ A;  4R2E A;  5AC4 A;  4R2D A;  2EMX A;  3C6K A;  1YFH A;  2EPC A;  2EN8 A;  3EQ1 A;  3VHT B;  5AE3 A;  4DR7 E;  4BCA A;  2HJJ A;  2EPM X;  1TF3 A;  4X62 E;  2L3C A;  4B3M E;  3BGH A;  4NHR A;  1YPN A;  4F9C B;  1G2F C;  4GKJ E;  4O43 A;  2EM9 A;  2F4V E;  2V86 A;  4JI6 E;  2NUF A;  2EOE A;  4K0K E;  1X47 A;  2J7J A;  3EPK A;  2ELZ A;  1RQ0 A;  2YRK A;  2YWQ A;  2KOU A;  3P1X A;  2UXC E;  2VQF E;  4WXD A;  2LBS B;  1IBM E;  2YTQ A;  3ECR A;  2A25 A;  1EH8 A;  1JK1 A;  2EOI A;  1PDA A;  2UUB E;  2VRD A;  2EM6 A;  4WSG A;  2LUQ A;  4BHB A;  5KL4 A;  4TUI A;  2WBS A;  2JOX A;  1BB8 A;  3LLH A;  1X6F A;  3VYY A;  2FV4 B;  2YU8 A;  2YZT A;  4BHC A;  5TSE A;  2EPO A;  2EM0 A;  1A1G A;  4F54 A;  2EM7 A;  2EL5 A;  3HQ1 A;  2NA2 A;  1X6E A;  2IHR 1;  4JI7 E;  1QU6 A;  4KWY A;  5KL2 A;  2MKN A;  5T6J A;  2UU9 E;  2BB8 A;  1IQS A;  2JWO A;  2HC5 A;  2WBT A;  3ADL A;  2L2N A;  5IXM B;  3BBG A;  5AE2 A;  2CSH A;  1I94 E;  2ADR A;  2EN3 A;  1J26 A;  4JI0 E;  4X9J A;  5A6K A;  5AE1 A;  1T38 A;  2EL6 A;  2LJU A;  2HHH E;  2EOJ A;  2EWL A;  4NZV A;  1UN6 B;  3BF2 A;  2EMZ A;  1HNW E;  1X5W A;  1X49 A;  4MLV A;  2LRS A;  1PJS A;  5AC5 A;  4DR4 E;  2DRP A;  4WPY A;  1O0W A;  4P7D A;  4YY3 E;  1X3C A;  2JYA A;  2LT7 A;  4DV3 E;  1BBG A;  1SR9 A;  4BBY A;  2NUE A;  4ZYH A;  4R2A A;  2L92 A;  2EPZ A;  2DMI A;  1N36 E;  1PJQ A;  4JI8 E;  2DIX A;  2BBG A;  1A1K A;  2EOY A;  2M1S A;  4ZYD A;  3HPZ A;  1UBD C;  4WX9 A;  3C4B A;  3BID A;  2EQ1 A;  4GZN C;  2Q8U A;  2N3G A;  1RMD A;  5KL7 A;  1EH6 A;  2RSM A;  1GTK A;  1QNT A;  4JV5 E;  1X6H A;  4HTG A;  4R2C A;  2EMH A;  2E1M A;  2V89 A;  3K6Q A;  2B3T B;  4F9A B; 
#chains in the Genus database with same CATH homology
 1BBO A;  2GHF A;  4F6N A;  3MHS C;  2YTQ A;  1A1I A;  2EML A;  2A25 A;  2EOF A;  4R2R A;  4R2Q A;  1JK1 A;  2DGC A;  2DLQ A;  2EOI A;  2LCE A;  2R1F A;  1ZU1 A;  2EQ0 A;  2VRD A;  2YTJ A;  2EM6 A;  4WSG A;  5KL4 A;  2WBS A;  1NCS A;  3EPJ A;  1YSA C;  1BB8 A;  2EN4 A;  1X6F A;  4F6M A;  2EM8 A;  2YSP A;  2YU8 A;  2PRT A;  2EOS A;  2YRH A;  2EM0 A;  2EOO A;  1A1G A;  2ENC A;  2EM7 A;  2EL5 A;  2RPC A;  2EN2 A;  2EM2 A;  2JPA A;  2NAB A;  1X6E A;  2YTI A;  2EMG A;  4R2S A;  1ZR9 A;  4IS1 C;  2ELY A;  2LV2 A;  2YTO A;  3MHH C;  2EMB A;  5KL2 A;  3UK3 C;  2WBU A;  2MKN A;  2E72 A;  2EPU A;  2BB8 A;  2EMW A;  2EOX A;  2WBT A;  2CSH A;  2ADR A;  3M99 B;  2EM4 A;  2YRM A;  2EN3 A;  4X9J A;  2EMF A;  1KJK A;  2EPP A;  4F2J C;  1A1L A;  2D9H A;  2YTF A;  2CT1 A;  2EL6 A;  2MDG A;  1YUJ A;  2EOJ A;  2EN6 A;  1UN6 B;  1P47 A;  2EMZ A;  1A1H A;  2DLK A;  1G2D C;  2GLI A;  2EL4 A;  1X5W A;  2EOR A;  1F2I G;  3EPL A;  3EPH A;  1DGC A;  2YSO A;  2EPR A;  2EMI A;  2EOZ A;  2YTD A;  1WJP A;  2EE8 A;  5KL6 A;  2EM5 A;  2YU5 A;  2DRP A;  2EPX A;  2YTG A;  1B69 A;  1AAY A;  2EMY A;  5KL5 A;  2EOM A;  1A1J A;  2RSI A;  1Z1B A;  2EMA A;  2HGH A;  2I13 A;  1MEY C;  1X3C A;  4R2E A;  2LT7 A;  1A1F A;  2EPA A;  1YUI A;  1TF6 A;  2EN7 A;  4R2D A;  1JK2 A;  2EMX A;  2EN1 A;  2LO3 A;  2EPC A;  2EN8 A;  2ENA A;  3VHT B;  4R2A A;  2EM3 A;  2WCC 3;  2EJ4 A;  1LLM C;  2EPZ A;  2DMI A;  1TN9 A;  2YTP A;  4R2P A;  2JP9 A;  2EOH A;  2LVH A;  2MKD A;  1ZAA C;  2CTD A;  1TF3 A;  4M9V C;  1A1K A;  1G2F C;  2EOY A;  5KL3 A;  1UBD C;  2EM9 A;  4IJD A;  2EQ1 A;  2M9A A;  4GZN C;  2EOE A;  1RMD A;  5KL7 A;  2YTN A;  2YTE A;  2J7J A;  2EMK A;  3EPK A;  2EOQ A;  1X6H A;  2ELZ A;  4FK5 C;  2EQ3 A;  2EMH A;  2ENH A;  2EMC A;  4R2C A;  2EP3 A;  2YRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...