2ENCA

Solution structure of the c2h2 type zinc finger (region 395-427) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPFKCEECGKGFYTNSQCYSHQRSHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 395-427) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2encA01
2EM4A 2EJ4A 2YSOA 2EMHA 2EMBA 2PRTA 2A25A 2YU8A 1AAYA 2DLKA 2DRPA 2VRDA 2EOZA 4FK5C 2LO3A 2YTEA 1JK2A 1BB8A 2EM7A 2EORA 2EN4A 2YTIA 4F6MA 1A1LA 2EL4A 4M9VC 1YUIA 4R2EA 4F2JC 1B69A 1X6FA 5KL5A 2EMGA 4X9JA 2EM9A 2NABA 2EOJA 2YU5A 1A1IA 2EOIA 2EP3A 2LVHA 1X6EA 1LLMC 2EN3A 4R2DA 5KL2A 2ELYA 2EE8A 4WSGA 2JP9A 2CTDA 2EN6A 2EPAA 4IJDA 2EN7A 2EL6A 1KJKA 2EPZA 2EOFA 2YTDA 4F6NA 2WBSA 2GLIA 1YSAC 2EM6A 2HGHA 4R2PA 2EN2A 1WJPA 2EPUA 2WBTA 2EM3A 2EPCA 2EMLA 2LCEA 2YRHA 2EM5A 2YTJA 2EPXA 2EOOA 2EQ1A 1RMDA 1A1HA 2GHFA 2EQ3A 2EQ0A 2E72A 3EPJA 2M9AA 2EPRA 4R2SA 1A1FA 2MKDA 3EPHA 2EOHA 2DMIA 2EMIA 2RPCA 3EPKA 2YRKA 2EL5A 2J7JA 2YTOA 1ZR9A 2D9HA 2EOXA 2EPPA 2WCC3 5KL3A 2DGCA 2EMWA 1A1JA 5KL6A 3M99B 2EMFA 1MEYC 2R1FA 4R2CA 2EM8A 3MHHC 1A1KA 2EN1A 1G2DC 1ZU1A 1UBDC 2ADRA 2EMKA 2ENHA 2YTFA 1P47A 1JK1A 2BB8A 2I13A 2YSPA 3EPLA 4R2RA 1TF3A 2LT7A 1Z1BA 2JPAA 2ENAA 3UK3C 2EM0A 2YTPA 2EOSA 2EMXA 2ELZA 2EOQA 3VHTB 5KL4A 1DGCA 1ZAAC 2EMCA 2EN8A 2CSHA 2YTQA 1G2FC 1NCSA 1YUJA 2MDGA 2YTNA 1A1GA 2DLQA 2EOEA 2WBUA 1TF6A 2LV2A 2YRMA 4GZNC 2RSIA 1F2IG 2EOYA 4R2AA 2ENCA 2EM2A 2CT1A 2EMAA 3MHSC 2YTGA 1X6HA 4IS1C 2MKNA 1UN6B 1TN9A 1BBOA 5KL7A 2EMZA 2EOMA 2EMYA 1X3CA 4R2QA 1X5WA
chains in the Genus database with same CATH superfamily
5A6BA 3C6MA 4NXNE 1L4SA 2MC6A 3C6KA 1JK2A 1X48A 1BB8A 4F6MA 1YYWA 4HTGA 2LBSB 4K0KE 1YUIA 1WXRA 2LUPB 4R2EA 4DUZE 4TUIA 2NABA 2EOJA 2YU5A 2EP3A 1X6EA 3HPSA 4ZYHA 1LLMC 1STUA 2JP9A 5AE1A 1IBLE 5AE3A 1GZ6A 5AC4A 2YTDA 4BS9A 2WBSA 2Q8UA 2L3JA 1X49A 2EM6A 2JOBA 2LUQA 2EPUA 2WBTA 3K6QA 4X64E 2LCEA 2EM5A 2YTJA 1A1HA 4DV0E 5A2QC 5LMNE 3AUZA 2JR1A 4R2SA 4ZYDA 3JU0A 2V88A 4O43A 4DV3E 2V8QB 3HTXA 3JTZA 2YRKA 2J7JA 2EPNA 2RSMA 2F4VE 3BIDA 1N3GA 5KL6A 3M99B 2EMFA 4MLVA 2ODRC 1T38A 4OOGC 1ZU1A 2L92A 3C4BA 4B3TE 1P47A 5LL6R 3VYXA 2BB8A 4AQYE 2I13A 2YSPA 3AV0A 1Z1BA 2JPAA 1NEIA 4BHBA 2I9IA 2ELZA 3VHTB 5KL4A 4WFTA 4YHHE 2EN8A 3JAMC 4WX9A 2CSHA 3THNA 1G2FC 1N33E 2UXDE 2YTNA 2DLQA 4LFAE 2JOXA 1TF6A 1IBKE 4JI1E 2HJJA 4WXDA 1WHNA 1WRJA 5A6JA 3MHSC 1X6HA 5KL7A 1T4OA 2BBGA 2EOMA 5A69A 4R2QA 3UK3C 4ZYEA 2EM4A 2EMHA 2EMBA 2PRTA 2A25A 2FTXB 4M0VA 2VRDA 2EOZA 2LO3A 2YTEA 3KWRA 3BGHA 4BBYA 1A1LA 4KWYA 2UU9E 2JWOA 4N4RB 4M9VC 3IWBA 2RS6A 4HEIA 2EMGA 4X9JA 3HPZA 2FGGA 2EOIA 2LVHA 4ZYGA 5AASA 5ADZA 4WSPA 5LLQA 4WYQB 4R2DA 3OTOE 5KL2A 1HR0E 2ELYA 2EE8A 4F9CB 1IQOA 4BCAA 2EPAA 4IJDA 2RTXA 4B3RE 2WZOA 2V85A 3F6HA 2YWQA 2KONA 4P78A 2EN2A 2NA2A 4X65E 3T1YE 2EPCA 2LMZA 4GKKE 2ODRD 1T4LB 1PKPA 2EQ1A 4JI5E 2GHFA 2EQ3A 2EQ0A 2E72A 2MDRA 2DB2A 1A1FA 4DUYE 4NHRA 4Q35B 2MKDA 2EOHA 2YZTA 2EMIA 4NXME 4BHCA 2YTOA 2KOUA 2LTRA 1PJQA 2WCC3 2EMWA 1A1JA 1RC7A 4DKKA 4DR7E 1EKZA 4JYAE 3F6GA 1YZ9A 4RH8A 1X47A 4DV6E 2R1FA 1J26A 4O24A 1PJTA 3MHHC 4X8WA 3J81C 1UBDC 2L33A 2ENHA 2YTFA 1I94E 4JV5E 2JVAA 5TSEA 4F9BB 4LU9A 2EZ6A 2EPLX 5A6KA 1TF3A 4LF4E 3KZYA 2N8XA 3P1XA 2EM0A 2L2MA 2EOSA 1FJGE 2EMXA 1ZAAC 4B3SE 1HNWE 4O4KA 4DV4E 2YTQA 1YUJA 4JI7E 2EOEA 1GQEA 2JXPA 5AE2A 3ADIA 1F2IG 2DSYA 3IWCA 4GEQB 4R2AA 2YT4A 2V87A 1XNRE 3L00A 4BMJA 1YYKA 4JI2E 4LF8E 2NUFA 4LTYA 2YSOA 4GKJE 1AAYA 1SFEA 4DR2E 1T39A 2L6MA 4JI0E 4FK5C 2EORA 2EN4A 2B7VA 1XNQE 2LJUA 5IWAE 4F2JC 1B69A 1HNZE 2NUEA 5KL5A 2FV4B 3J80C 3MSWA 5A6BD 2EL6A 2EOFA 2YPNA 4KZSA 4JI8E 2GLIA 2B9DA 2L8TA 2JY9A 2E1MA 1UHZA 2HGHA 3ZOQB 2EM3A 4Q28A 2EMLA 2VQFE 5IXMB 2EPXA 2EOOA 1O0WA 1RMDA 3THOB 2UXBE 2EPMX 3EPJA 1N36E 1UILA 4DR5E 4LF5E 4M2ZA 1YFHA 3EPHA 2IHR1 1ZBQA 2N3GA 2RPCA 2HC5A 1ZR9A 5BR8E 2D9HA 2EOXA 4WXCA 3BBGA 2N3HA 3LLHA 1IBME 2K7IA 5AC5A 5LMUE 2UUAE 4BC7A 1MEYC 2NUGA 1YPNA 5IT9C 1G2DC 2LRSA 2E5LE 3KZZA 3C4TA 4OX9E 2ADRA 2EMKA 2UUBE 4YY3E 1JK1A 3IWDA 3BF2A 3J7AG 2LT7A 2V86A 2ENAA 2YTPA 1RQ0A 2VE7C 1EH8A 1IMUA 4LF7E 2R76A 1WHQA 5FLXC 2UUCE 3ADGA 3ADJA 2L2KB 5T6JA 2M1SA 1A1GA 2EPOA 3DF6A 4DR3E 2WBUA 2LV2A 4GZNC 4DMIA 2ENCA 2EM2A 1DQ3A 3EQ1A 4IS1C 4L8NA 2YTGA 4R8OA 2VQEE 2DIXA 3FIGA 2EMYA 1X5WA 4TUGA 1N32E 1EH7A 2EJ4A 4DR1E 4I8OA 2YU8A 2DLKA 2DRPA 3ECRA 4LFBE 2EM7A 2YTIA 4F54A 4O5GA 3QG5C 2ZM6E 2EL4A 2V89A 1YYOA 4DR6E 3OMLA 1QNTA 1X6FA 4DV5E 2EM9A 1A1IA 1XMOE 4P7DA 2M7QA 1N34E 4X62E 1PJSA 2EN3A 4LF9E 4R03A 4WSGA 2CTDA 1IQSA 2EN6A 2EN7A 1KJKA 1ZBTA 2EPZA 3LMLA 3J7Yp 5IV8B 2B3TB 4WPYA 4F6NA 2B7TA 1YSAC 1PDAA 4F9AB 4R2PA 1WJPA 2RS7A 5A6AA 4JI6E 2YRHA 1J5EE 4NZVA 3ADLA 2L3CA 3DJWA 2M4IA 2DMYA 2M9AA 2EPRA 4L5NC 3T1HE 2CPNA 2MC5A 2EPKX 4X66E 4DV2E 2DMIA 1MGTA 3EPKA 4LF6E 2EL5A 1GTKA 2LE2A 2EPPA 3H09A 1BBGA 2VF1A 1FKAE 4LFCE 5KL3A 2DGCA 4DV7E 3TQMA 3HXLA 4M30A 1QU6A 2F8BA 4B3ME 2LJHA 4MLQA 4R2CA 2G7HA 2EM8A 3HQ1A 5F3WA 2EN1A 1A1KA 4DR4E 4BC9A 1KYQA 1SR9A 4KHPE 3RMPA 1HNXE 2RQLA 3EPLA 4R2RA 2HHHE 5DNYA 1AH5A 4J8ZA 2JYAA 2EOQA 2K4VA 1DGCA 2EMCA 1T4NA 1EH6A 3VK6A 1XMQE 4JI3E 2EWLA 1DI2A 1NCSA 4JI4E 2MDGA 3VYYA 2KHXA 2H36X 2UXCE 2YRMA 5CFFE 2LTSA 2RSIA 2EOYA 4DV1E 2CT1A 2EMAA 4RHBB 2MKNA 1UN6B 1TN9A 1BBOA 2L2NA 2EMZA 2GPIA 2V83A 1X3CA
chains in the Genus database with same CATH topology
2EM4A 2EJ4A 2YSOA 2EMHA 2EMBA 2PRTA 2A25A 2YU8A 1AAYA 2DLKA 2DRPA 2VRDA 2EOZA 4FK5C 2LO3A 2YTEA 1JK2A 1BB8A 2EM7A 2EORA 2EN4A 2YTIA 4F6MA 1A1LA 2EL4A 4M9VC 1YUIA 4R2EA 4F2JC 1B69A 1X6FA 5KL5A 2EMGA 4X9JA 2EM9A 2NABA 2EOJA 2YU5A 1A1IA 2EOIA 2EP3A 2LVHA 1X6EA 1LLMC 2EN3A 4R2DA 5KL2A 2ELYA 2EE8A 4WSGA 2JP9A 2CTDA 2EN6A 2EPAA 4IJDA 2EN7A 2EL6A 1KJKA 2EPZA 2EOFA 2YTDA 4F6NA 2WBSA 2GLIA 1YSAC 2EM6A 2HGHA 4R2PA 2EN2A 1WJPA 2EPUA 2WBTA 2EM3A 2EPCA 2EMLA 2LCEA 2YRHA 2EM5A 2YTJA 2EPXA 2EOOA 2EQ1A 1RMDA 1A1HA 2GHFA 2EQ3A 2EQ0A 2E72A 3EPJA 2M9AA 2EPRA 4R2SA 1A1FA 2MKDA 3EPHA 2EOHA 2DMIA 2EMIA 2RPCA 3EPKA 2YRKA 2EL5A 2J7JA 2YTOA 1ZR9A 2D9HA 2EOXA 2EPPA 2WCC3 5KL3A 2DGCA 2EMWA 1A1JA 5KL6A 3M99B 2EMFA 1MEYC 2R1FA 4R2CA 2EM8A 3MHHC 1A1KA 2EN1A 1G2DC 1ZU1A 1UBDC 2ADRA 2EMKA 2ENHA 2YTFA 1P47A 1JK1A 2BB8A 2I13A 2YSPA 3EPLA 4R2RA 1TF3A 2LT7A 1Z1BA 2JPAA 2ENAA 3UK3C 2EM0A 2YTPA 2EOSA 2EMXA 2ELZA 2EOQA 3VHTB 5KL4A 1DGCA 1ZAAC 2EMCA 2EN8A 2CSHA 2YTQA 1G2FC 1NCSA 1YUJA 2MDGA 2YTNA 1A1GA 2DLQA 2EOEA 2WBUA 1TF6A 2LV2A 2YRMA 4GZNC 2RSIA 1F2IG 2EOYA 4R2AA 2ENCA 2EM2A 2CT1A 2EMAA 3MHSC 2YTGA 1X6HA 4IS1C 2MKNA 1UN6B 1TN9A 1BBOA 5KL7A 2EMZA 2EOMA 2EMYA 1X3CA 4R2QA 1X5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM4 A;  2EJ4 A;  2YSO A;  2EMH A;  2EMB A;  2PRT A;  2A25 A;  2YU8 A;  1AAY A;  2DLK A;  2DRP A;  2VRD A;  2EOZ A;  4FK5 C;  2LO3 A;  2YTE A;  1JK2 A;  1BB8 A;  2EM7 A;  2EOR A;  2EN4 A;  2YTI A;  4F6M A;  1A1L A;  2EL4 A;  4M9V C;  1YUI A;  4R2E A;  4F2J C;  1B69 A;  1X6F A;  5KL5 A;  2EMG A;  4X9J A;  2EM9 A;  2NAB A;  2EOJ A;  2YU5 A;  1A1I A;  2EOI A;  2EP3 A;  2LVH A;  1X6E A;  1LLM C;  2EN3 A;  4R2D A;  5KL2 A;  2ELY A;  2EE8 A;  4WSG A;  2JP9 A;  2CTD A;  2EN6 A;  2EPA A;  4IJD A;  2EN7 A;  2EL6 A;  1KJK A;  2EPZ A;  2EOF A;  2YTD A;  4F6N A;  2WBS A;  2GLI A;  1YSA C;  2EM6 A;  2HGH A;  4R2P A;  2EN2 A;  1WJP A;  2EPU A;  2WBT A;  2EM3 A;  2EPC A;  2EML A;  2LCE A;  2YRH A;  2EM5 A;  2YTJ A;  2EPX A;  2EOO A;  2EQ1 A;  1RMD A;  1A1H A;  2GHF A;  2EQ3 A;  2EQ0 A;  2E72 A;  3EPJ A;  2M9A A;  2EPR A;  4R2S A;  1A1F A;  2MKD A;  3EPH A;  2EOH A;  2DMI A;  2EMI A;  2RPC A;  3EPK A;  2YRK A;  2EL5 A;  2J7J A;  2YTO A;  1ZR9 A;  2D9H A;  2EOX A;  2EPP A;  2WCC 3;  5KL3 A;  2DGC A;  2EMW A;  1A1J A;  5KL6 A;  3M99 B;  2EMF A;  1MEY C;  2R1F A;  4R2C A;  2EM8 A;  3MHH C;  1A1K A;  2EN1 A;  1G2D C;  1ZU1 A;  1UBD C;  2ADR A;  2EMK A;  2ENH A;  2YTF A;  1P47 A;  1JK1 A;  2BB8 A;  2I13 A;  2YSP A;  3EPL A;  4R2R A;  1TF3 A;  2LT7 A;  1Z1B A;  2JPA A;  2ENA A;  3UK3 C;  2EM0 A;  2YTP A;  2EOS A;  2EMX A;  2ELZ A;  2EOQ A;  3VHT B;  5KL4 A;  1DGC A;  1ZAA C;  2EMC A;  2EN8 A;  2CSH A;  2YTQ A;  1G2F C;  1NCS A;  1YUJ A;  2MDG A;  2YTN A;  1A1G A;  2DLQ A;  2EOE A;  2WBU A;  1TF6 A;  2LV2 A;  2YRM A;  4GZN C;  2RSI A;  1F2I G;  2EOY A;  4R2A A;  2ENC A;  2EM2 A;  2CT1 A;  2EMA A;  3MHS C;  2YTG A;  1X6H A;  4IS1 C;  2MKN A;  1UN6 B;  1TN9 A;  1BBO A;  5KL7 A;  2EMZ A;  2EOM A;  2EMY A;  1X3C A;  4R2Q A;  1X5W A; 
#chains in the Genus database with same CATH topology
 5A6B A;  3C6M A;  4NXN E;  1L4S A;  2MC6 A;  3C6K A;  1JK2 A;  1X48 A;  1BB8 A;  4F6M A;  1YYW A;  4HTG A;  2LBS B;  4K0K E;  1YUI A;  1WXR A;  2LUP B;  4R2E A;  4DUZ E;  4TUI A;  2NAB A;  2EOJ A;  2YU5 A;  2EP3 A;  1X6E A;  3HPS A;  4ZYH A;  1LLM C;  1STU A;  2JP9 A;  5AE1 A;  1IBL E;  5AE3 A;  1GZ6 A;  5AC4 A;  2YTD A;  4BS9 A;  2WBS A;  2Q8U A;  2L3J A;  1X49 A;  2EM6 A;  2JOB A;  2LUQ A;  2EPU A;  2WBT A;  3K6Q A;  4X64 E;  2LCE A;  2EM5 A;  2YTJ A;  1A1H A;  4DV0 E;  5A2Q C;  5LMN E;  3AUZ A;  2JR1 A;  4R2S A;  4ZYD A;  3JU0 A;  2V88 A;  4O43 A;  4DV3 E;  2V8Q B;  3HTX A;  3JTZ A;  2YRK A;  2J7J A;  2EPN A;  2RSM A;  2F4V E;  3BID A;  1N3G A;  5KL6 A;  3M99 B;  2EMF A;  4MLV A;  2ODR C;  1T38 A;  4OOG C;  1ZU1 A;  2L92 A;  3C4B A;  4B3T E;  1P47 A;  5LL6 R;  3VYX A;  2BB8 A;  4AQY E;  2I13 A;  2YSP A;  3AV0 A;  1Z1B A;  2JPA A;  1NEI A;  4BHB A;  2I9I A;  2ELZ A;  3VHT B;  5KL4 A;  4WFT A;  4YHH E;  2EN8 A;  3JAM C;  4WX9 A;  2CSH A;  3THN A;  1G2F C;  1N33 E;  2UXD E;  2YTN A;  2DLQ A;  4LFA E;  2JOX A;  1TF6 A;  1IBK E;  4JI1 E;  2HJJ A;  4WXD A;  1WHN A;  1WRJ A;  5A6J A;  3MHS C;  1X6H A;  5KL7 A;  1T4O A;  2BBG A;  2EOM A;  5A69 A;  4R2Q A;  3UK3 C;  4ZYE A;  2EM4 A;  2EMH A;  2EMB A;  2PRT A;  2A25 A;  2FTX B;  4M0V A;  2VRD A;  2EOZ A;  2LO3 A;  2YTE A;  3KWR A;  3BGH A;  4BBY A;  1A1L A;  4KWY A;  2UU9 E;  2JWO A;  4N4R B;  4M9V C;  3IWB A;  2RS6 A;  4HEI A;  2EMG A;  4X9J A;  3HPZ A;  2FGG A;  2EOI A;  2LVH A;  4ZYG A;  5AAS A;  5ADZ A;  4WSP A;  5LLQ A;  4WYQ B;  4R2D A;  3OTO E;  5KL2 A;  1HR0 E;  2ELY A;  2EE8 A;  4F9C B;  1IQO A;  4BCA A;  2EPA A;  4IJD A;  2RTX A;  4B3R E;  2WZO A;  2V85 A;  3F6H A;  2YWQ A;  2KON A;  4P78 A;  2EN2 A;  2NA2 A;  4X65 E;  3T1Y E;  2EPC A;  2LMZ A;  4GKK E;  2ODR D;  1T4L B;  1PKP A;  2EQ1 A;  4JI5 E;  2GHF A;  2EQ3 A;  2EQ0 A;  2E72 A;  2MDR A;  2DB2 A;  1A1F A;  4DUY E;  4NHR A;  4Q35 B;  2MKD A;  2EOH A;  2YZT A;  2EMI A;  4NXM E;  4BHC A;  2YTO A;  2KOU A;  2LTR A;  1PJQ A;  2WCC 3;  2EMW A;  1A1J A;  1RC7 A;  4DKK A;  4DR7 E;  1EKZ A;  4JYA E;  3F6G A;  1YZ9 A;  4RH8 A;  1X47 A;  4DV6 E;  2R1F A;  1J26 A;  4O24 A;  1PJT A;  3MHH C;  4X8W A;  3J81 C;  1UBD C;  2L33 A;  2ENH A;  2YTF A;  1I94 E;  4JV5 E;  2JVA A;  5TSE A;  4F9B B;  4LU9 A;  2EZ6 A;  2EPL X;  5A6K A;  1TF3 A;  4LF4 E;  3KZY A;  2N8X A;  3P1X A;  2EM0 A;  2L2M A;  2EOS A;  1FJG E;  2EMX A;  1ZAA C;  4B3S E;  1HNW E;  4O4K A;  4DV4 E;  2YTQ A;  1YUJ A;  4JI7 E;  2EOE A;  1GQE A;  2JXP A;  5AE2 A;  3ADI A;  1F2I G;  2DSY A;  3IWC A;  4GEQ B;  4R2A A;  2YT4 A;  2V87 A;  1XNR E;  3L00 A;  4BMJ A;  1YYK A;  4JI2 E;  4LF8 E;  2NUF A;  4LTY A;  2YSO A;  4GKJ E;  1AAY A;  1SFE A;  4DR2 E;  1T39 A;  2L6M A;  4JI0 E;  4FK5 C;  2EOR A;  2EN4 A;  2B7V A;  1XNQ E;  2LJU A;  5IWA E;  4F2J C;  1B69 A;  1HNZ E;  2NUE A;  5KL5 A;  2FV4 B;  3J80 C;  3MSW A;  5A6B D;  2EL6 A;  2EOF A;  2YPN A;  4KZS A;  4JI8 E;  2GLI A;  2B9D A;  2L8T A;  2JY9 A;  2E1M A;  1UHZ A;  2HGH A;  3ZOQ B;  2EM3 A;  4Q28 A;  2EML A;  2VQF E;  5IXM B;  2EPX A;  2EOO A;  1O0W A;  1RMD A;  3THO B;  2UXB E;  2EPM X;  3EPJ A;  1N36 E;  1UIL A;  4DR5 E;  4LF5 E;  4M2Z A;  1YFH A;  3EPH A;  2IHR 1;  1ZBQ A;  2N3G A;  2RPC A;  2HC5 A;  1ZR9 A;  5BR8 E;  2D9H A;  2EOX A;  4WXC A;  3BBG A;  2N3H A;  3LLH A;  1IBM E;  2K7I A;  5AC5 A;  5LMU E;  2UUA E;  4BC7 A;  1MEY C;  2NUG A;  1YPN A;  5IT9 C;  1G2D C;  2LRS A;  2E5L E;  3KZZ A;  3C4T A;  4OX9 E;  2ADR A;  2EMK A;  2UUB E;  4YY3 E;  1JK1 A;  3IWD A;  3BF2 A;  3J7A G;  2LT7 A;  2V86 A;  2ENA A;  2YTP A;  1RQ0 A;  2VE7 C;  1EH8 A;  1IMU A;  4LF7 E;  2R76 A;  1WHQ A;  5FLX C;  2UUC E;  3ADG A;  3ADJ A;  2L2K B;  5T6J A;  2M1S A;  1A1G A;  2EPO A;  3DF6 A;  4DR3 E;  2WBU A;  2LV2 A;  4GZN C;  4DMI A;  2ENC A;  2EM2 A;  1DQ3 A;  3EQ1 A;  4IS1 C;  4L8N A;  2YTG A;  4R8O A;  2VQE E;  2DIX A;  3FIG A;  2EMY A;  1X5W A;  4TUG A;  1N32 E;  1EH7 A;  2EJ4 A;  4DR1 E;  4I8O A;  2YU8 A;  2DLK A;  2DRP A;  3ECR A;  4LFB E;  2EM7 A;  2YTI A;  4F54 A;  4O5G A;  3QG5 C;  2ZM6 E;  2EL4 A;  2V89 A;  1YYO A;  4DR6 E;  3OML A;  1QNT A;  1X6F A;  4DV5 E;  2EM9 A;  1A1I A;  1XMO E;  4P7D A;  2M7Q A;  1N34 E;  4X62 E;  1PJS A;  2EN3 A;  4LF9 E;  4R03 A;  4WSG A;  2CTD A;  1IQS A;  2EN6 A;  2EN7 A;  1KJK A;  1ZBT A;  2EPZ A;  3LML A;  3J7Y p;  5IV8 B;  2B3T B;  4WPY A;  4F6N A;  2B7T A;  1YSA C;  1PDA A;  4F9A B;  4R2P A;  1WJP A;  2RS7 A;  5A6A A;  4JI6 E;  2YRH A;  1J5E E;  4NZV A;  3ADL A;  2L3C A;  3DJW A;  2M4I A;  2DMY A;  2M9A A;  2EPR A;  4L5N C;  3T1H E;  2CPN A;  2MC5 A;  2EPK X;  4X66 E;  4DV2 E;  2DMI A;  1MGT A;  3EPK A;  4LF6 E;  2EL5 A;  1GTK A;  2LE2 A;  2EPP A;  3H09 A;  1BBG A;  2VF1 A;  1FKA E;  4LFC E;  5KL3 A;  2DGC A;  4DV7 E;  3TQM A;  3HXL A;  4M30 A;  1QU6 A;  2F8B A;  4B3M E;  2LJH A;  4MLQ A;  4R2C A;  2G7H A;  2EM8 A;  3HQ1 A;  5F3W A;  2EN1 A;  1A1K A;  4DR4 E;  4BC9 A;  1KYQ A;  1SR9 A;  4KHP E;  3RMP A;  1HNX E;  2RQL A;  3EPL A;  4R2R A;  2HHH E;  5DNY A;  1AH5 A;  4J8Z A;  2JYA A;  2EOQ A;  2K4V A;  1DGC A;  2EMC A;  1T4N A;  1EH6 A;  3VK6 A;  1XMQ E;  4JI3 E;  2EWL A;  1DI2 A;  1NCS A;  4JI4 E;  2MDG A;  3VYY A;  2KHX A;  2H36 X;  2UXC E;  2YRM A;  5CFF E;  2LTS A;  2RSI A;  2EOY A;  4DV1 E;  2CT1 A;  2EMA A;  4RHB B;  2MKN A;  1UN6 B;  1TN9 A;  1BBO A;  2L2N A;  2EMZ A;  2GPI A;  2V83 A;  1X3C A; 
#chains in the Genus database with same CATH homology
 2EM4 A;  2EJ4 A;  2YSO A;  2EMH A;  2EMB A;  2PRT A;  2A25 A;  2YU8 A;  1AAY A;  2DLK A;  2DRP A;  2VRD A;  2EOZ A;  4FK5 C;  2LO3 A;  2YTE A;  1JK2 A;  1BB8 A;  2EM7 A;  2EOR A;  2EN4 A;  2YTI A;  4F6M A;  1A1L A;  2EL4 A;  4M9V C;  1YUI A;  4R2E A;  4F2J C;  1B69 A;  1X6F A;  5KL5 A;  2EMG A;  4X9J A;  2EM9 A;  2NAB A;  2EOJ A;  2YU5 A;  1A1I A;  2EOI A;  2EP3 A;  2LVH A;  1X6E A;  1LLM C;  2EN3 A;  4R2D A;  5KL2 A;  2ELY A;  2EE8 A;  4WSG A;  2JP9 A;  2CTD A;  2EN6 A;  2EPA A;  4IJD A;  2EN7 A;  2EL6 A;  1KJK A;  2EPZ A;  2EOF A;  2YTD A;  4F6N A;  2WBS A;  2GLI A;  1YSA C;  2EM6 A;  2HGH A;  4R2P A;  2EN2 A;  1WJP A;  2EPU A;  2WBT A;  2EM3 A;  2EPC A;  2EML A;  2LCE A;  2YRH A;  2EM5 A;  2YTJ A;  2EPX A;  2EOO A;  2EQ1 A;  1RMD A;  1A1H A;  2GHF A;  2EQ3 A;  2EQ0 A;  2E72 A;  3EPJ A;  2M9A A;  2EPR A;  4R2S A;  1A1F A;  2MKD A;  3EPH A;  2EOH A;  2DMI A;  2EMI A;  2RPC A;  3EPK A;  2YRK A;  2EL5 A;  2J7J A;  2YTO A;  1ZR9 A;  2D9H A;  2EOX A;  2EPP A;  2WCC 3;  5KL3 A;  2DGC A;  2EMW A;  1A1J A;  5KL6 A;  3M99 B;  2EMF A;  1MEY C;  2R1F A;  4R2C A;  2EM8 A;  3MHH C;  1A1K A;  2EN1 A;  1G2D C;  1ZU1 A;  1UBD C;  2ADR A;  2EMK A;  2ENH A;  2YTF A;  1P47 A;  1JK1 A;  2BB8 A;  2I13 A;  2YSP A;  3EPL A;  4R2R A;  1TF3 A;  2LT7 A;  1Z1B A;  2JPA A;  2ENA A;  3UK3 C;  2EM0 A;  2YTP A;  2EOS A;  2EMX A;  2ELZ A;  2EOQ A;  3VHT B;  5KL4 A;  1DGC A;  1ZAA C;  2EMC A;  2EN8 A;  2CSH A;  2YTQ A;  1G2F C;  1NCS A;  1YUJ A;  2MDG A;  2YTN A;  1A1G A;  2DLQ A;  2EOE A;  2WBU A;  1TF6 A;  2LV2 A;  2YRM A;  4GZN C;  2RSI A;  1F2I G;  2EOY A;  4R2A A;  2ENC A;  2EM2 A;  2CT1 A;  2EMA A;  3MHS C;  2YTG A;  1X6H A;  4IS1 C;  2MKN A;  1UN6 B;  1TN9 A;  1BBO A;  5KL7 A;  2EMZ A;  2EOM A;  2EMY A;  1X3C A;  4R2Q A;  1X5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...