1JK2A

Zif268 d20a mutant bound to the gct dna site
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*TP*G)-3'
publication title Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk2A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk2A01
2ELYA 1RMDA 2BB8A 2EMYA 2ENAA 2EORA 2ADRA 2EE8A 3EPLA 2WBTA 2YTOA 2EOQA 3MHSC 5KL4A 1A1HA 2YU5A 2EMFA 1A1IA 1X6EA 2EPUA 1G2DC 2EMLA 3EPKA 2EMKA 2YTIA 2EL5A 2EN8A 1DGCA 1WJPA 2GLIA 2EMBA 2EMZA 2VRDA 2DMIA 1A1KA 1YUIA 2A25A 2R1FA 2WCC3 2EOIA 2EPPA 1YUJA 2CT1A 2EQ1A 4R2SA 1YSAC 2M9AA 1BB8A 2EM0A 2LT7A 1BBOA 1ZAAC 2EN1A 2YRMA 2EM4A 2ENHA 2EPRA 2EM2A 2YTFA 1A1GA 2DLKA 1MEYC 1X6FA 2CTDA 2EOXA 1X3CA 2EMWA 2EOMA 2EP3A 2EOEA 2EM3A 5KL5A 2EMHA 2YTEA 2WBUA 2EN2A 2EOYA 2YTNA 4M9VC 1UN6B 3EPHA 2EN7A 2MKNA 2EOHA 1KJKA 4R2RA 2I13A 2EMAA 2EPAA 4R2AA 1NCSA 2J7JA 2EOFA 2EQ0A 2EMIA 1AAYA 5KL3A 5KL7A 4F2JC 2YTJA 2ELZA 2EM6A 1TF3A 1A1JA 1LLMC 4IJDA 4FK5C 3UK3C 2JP9A 5KL2A 2LO3A 2LV2A 2DRPA 2D9HA 1JK1A 4F6MA 2RSIA 2DLQA 2YRHA 3M99B 2HGHA 3VHTB 2YRKA 2EOOA 4R2DA 4X9JA 2EMGA 2MKDA 1B69A 2EOJA 2EN6A 5KL6A 2EL6A 4IS1C 2EQ3A 4F6NA 2EPZA 1Z1BA 2MDGA 2EM5A 2JPAA 2EM9A 2E72A 1JK2A 2LVHA 2EM7A 2GHFA 4R2PA 1P47A 2CSHA 4GZNC 2YSOA 2PRTA 4R2QA 2RPCA 2YTQA 1ZU1A 2YSPA 2EM8A 3MHHC 1ZR9A 1UBDC 2DGCA 2EN4A 2EJ4A 1G2FC 2EPCA 1TF6A 2YTGA 2WBSA 4R2EA 2ENCA 2EOSA 2NABA 1F2IG 1TN9A 2EOZA 2EPXA 2EMXA 1X6HA 2EN3A 1X5WA 2YTPA 1A1LA 2EMCA 2LCEA 1A1FA 2YTDA 2YU8A 3EPJA 2EL4A 4WSGA 4R2CA
chains in the Genus database with same CATH superfamily
2ELYA 3C4TA 1SR9A 2EMYA 3EPLA 2LRSA 5KL4A 1FKAE 1T4OA 2EMFA 2M1SA 5A6KA 4JI4E 4RHBB 1T39A 4F9CB 1PJSA 1G2DC 2ODRD 2M4IA 4M2ZA 2L2NA 2RTXA 1PDAA 2EMKA 5IT9C 4DR2E 1N36E 2EMZA 2N3HA 4GEQB 2A25A 2WCC3 3JU0A 2EOIA 4JI7E 2JR1A 2L3JA 1YUJA 2UUCE 4NXME 4LF5E 4JI3E 3T1YE 2EN1A 4ZYHA 1EH8A 4BMJA 2EM4A 4BCAA 2EM2A 2B3TB 2RS7A 4DKKA 2VQEE 2EOXA 1IQSA 4YHHE 4MLQA 1ZBQA 4DV3E 4BS9A 2WBUA 2EMHA 2EOYA 2YTNA 2EWLA 5IV8B 1UN6B 1RC7A 1X49A 2EPAA 2V88A 4R2AA 3J7Yp 1NCSA 3ZOQB 2BBGA 4WSPA 2LTRA 5KL7A 4BC9A 4F9AB 2LE2A 5AASA 1EH7A 1A1JA 3AV0A 3UK3C 4X66E 3RMPA 5KL2A 2HJJA 2DRPA 2D9HA 2JY9A 3THNA 1QNTA 2VE7C 2L33A 3L00A 2VQFE 4F6MA 1IQOA 1J26A 2EPKX 2YRHA 4WPYA 3F6GA 4O5GA 4X9JA 2EMGA 2L2MA 4JI0E 1B69A 2UUBE 4JV5E 4OOGC 5AC4A 3HQ1A 4IS1C 1RQ0A 3T1HE 1ZBTA 4F6NA 2EPZA 2MDGA 2JOXA 2JPAA 3KWRA 1JK2A 4L5NC 3DJWA 4GZNC 2PRTA 2B7TA 4I8OA 4R2QA 4OX9E 1EKZA 4NXNE 4KZSA 4DR5E 2EN4A 4DR7E 4B3TE 2H36X 1FJGE 5IWAE 2YTGA 2WBSA 1PJQA 1QU6A 1F2IG 3BBGA 1N34E 1X6HA 4M0VA 1X5WA 3C4BA 3LLHA 4P78A 2YU8A 2YZTA 5A6BD 2UXCE 5A2QC 1HNZE 5A6BA 1YYWA 4KWYA 2EORA 3OTOE 2EE8A 2EOQA 4B3SE 4LF7E 4K0KE 3EPKA 4ZYEA 2EL5A 2EN8A 1WJPA 3C6KA 4LTYA 1YUIA 3P1XA 2NUFA 1GTKA 2R1FA 2E5LE 5A6JA 1YPNA 4L8NA 2EQ1A 2M9AA 2N3GA 4GKKE 4DMIA 1A1GA 2JVAA 4WYQB 3JAMC 3BGHA 4JI8E 5DNYA 1X3CA 2UUAE 4LU9A 2M7QA 2MC6A 4O43A 4AQYE 3EPHA 2EOHA 3J7AG 2I13A 3J80C 2RS6A 2J7JA 2EQ0A 1AAYA 1YYKA 1HR0E 4DUYE 2YTJA 2MDRA 1MGTA 2ELZA 4DV0E 1TF3A 4LF6E 5LL6R 2ZM6E 2JP9A 4LF9E 3OMLA 4BC7A 2ODRC 2V85A 2RSIA 2E1MA 3M99B 1UHZA 4DV1E 4B3RE 4J8ZA 2EOOA 3HPSA 2EOJA 2I9IA 3C6MA 4DR3E 2EL6A 1Z1BA 3TQMA 4WXDA 1DQ3A 1I94E 2K7IA 4R2PA 1GQEA 4X62E 4JYAE 3DF6A 2EPNA 2JXPA 2YTQA 2UU9E 1ZU1A 2YSPA 2WZOA 1IBKE 1GZ6A 2HHHE 2B9DA 2DMYA 2L8TA 2L92A 4NHRA 2L3CA 1EH6A 2HC5A 4R2EA 1J5EE 1O0WA 2EZ6A 2NABA 2N8XA 2EN3A 1PKPA 5T6JA 3VYYA 2K4VA 2F8BA 2LMZA 2UXDE 3MSWA 2VF1A 2FTXB 2EL4A 1WHNA 5CFFE 4B3ME 1RMDA 3VYXA 2ENAA 1KYQA 2ADRA 1WXRA 2WBTA 1N3GA 2YT4A 2YTOA 1A1HA 2YU5A 1A1IA 1BBGA 3BIDA 3IWDA 2L2KB 2EMLA 3JTZA 2YTIA 2KOUA 1DGCA 2GLIA 3VK6A 2VRDA 2DMIA 3ADJA 4F9BB 1WRJA 4MLVA 1YYOA 4R8OA 1SFEA 2CT1A 2KHXA 2YPNA 3HXLA 1BB8A 1ZAAC 2YRMA 1T4LB 2V86A 1T38A 2ENHA 2EPRA 2GPIA 2YTFA 2DLKA 4TUIA 3THOB 1MEYC 2KONA 1X6FA 2CTDA 2EPMX 3KZYA 5AE3A 1PJTA 2EMWA 2EOMA 2EOEA 2EM3A 5KL5A 2YTEA 2EN2A 4M9VC 1L4SA 1KJKA 4LF8E 2EMAA 5IXMB 2EOFA 2CPNA 2EMIA 2RQLA 4DV4E 4GKJE 3EQ1A 4KHPE 1LLMC 1XNRE 2LO3A 2LV2A 4LFBE 4N4RB 1UILA 2EPOA 2V83A 4ZYGA 2DLQA 1WHQA 4YY3E 2HGHA 3VHTB 3ADGA 2V89A 4R2DA 4DV5E 4LF4E 2MKDA 5AE2A 5FLXC 2Q8UA 5KL6A 4DV7E 2YWQA 2EQ3A 3K6QA 2G7HA 2EM5A 2LJUA 3ADLA 2RSMA 2LVHA 2EM7A 2CSHA 4DR1E 2IHR1 2YSOA 1X48A 2RPCA 1N32E 2EM8A 2F4VE 1N33E 3IWCA 4X64E 2B7VA 3HPZA 1TF6A 3KZZA 2FV4B 4LFCE 2V8QB 2V87A 2EOSA 1TN9A 2EPXA 1IBLE 2YTPA 2EMCA 1A1FA 3J81C 4Q35B 3EPJA 1T4NA 2LUQA 4R2CA 4R2RA 4DUZE 2BB8A 4BBYA 1HNXE 5F3WA 2EPLX 1YFHA 3MHSC 3QG5C 1IMUA 3H09A 1X6EA 2EPUA 4HEIA 3BF2A 4X8WA 4HTGA 1STUA 2DSYA 2JYAA 2NUGA 2EMBA 4BHBA 1AH5A 1A1KA 5TSEA 5LMUE 2R76A 4WX9A 2EPPA 4WFTA 2DB2A 4R2SA 1YSAC 2DIXA 2JOBA 2EM0A 2LT7A 1BBOA 4X65E 5A6AA 1YZ9A 3FIGA 4WXCA 4M30A 4JI1E 1NEIA 1XMQE 4O24A 1XNQE 4RH8A 4BHCA 2JWOA 2L6MA 2MC5A 5LMNE 3ADIA 2EP3A 2FGGA 4DV6E 2EN7A 2MKNA 4NZVA 5KL3A 3IWBA 4ZYDA 4F2JC 2LUPB 2EM6A 2NA2A 3AUZA 4IJDA 4FK5C 5ADZA 1JK1A 1HNWE 3HTXA 4JI5E 4O4KA 3F6HA 5A69A 2YRKA 4F54A 5AE1A 1DI2A 2EN6A 1X47A 4JI2E 2E72A 2EM9A 4R03A 2GHFA 4TUGA 1P47A 3MHHC 4JI6E 3LMLA 1IBME 1ZR9A 4LFAE 1UBDC 2DGCA 3ECRA 4P7DA 2EJ4A 5LLQA 1G2FC 2EPCA 2LTSA 5BR8E 2ENCA 5AC5A 2EOZA 2EMXA 2NUEA 1A1LA 2UXBE 2LCEA 2LBSB 1XMOE 2LJHA 2YTDA 4Q28A 4DR6E 4DR4E 4WSGA 4DV2E
chains in the Genus database with same CATH topology
2ELYA 1RMDA 2BB8A 2EMYA 2ENAA 2EORA 2ADRA 2EE8A 3EPLA 2WBTA 2YTOA 2EOQA 3MHSC 5KL4A 1A1HA 2YU5A 2EMFA 1A1IA 1X6EA 2EPUA 1G2DC 2EMLA 3EPKA 2EMKA 2YTIA 2EL5A 2EN8A 1DGCA 1WJPA 2GLIA 2EMBA 2EMZA 2VRDA 2DMIA 1A1KA 1YUIA 2A25A 2R1FA 2WCC3 2EOIA 2EPPA 1YUJA 2CT1A 2EQ1A 4R2SA 1YSAC 2M9AA 1BB8A 2EM0A 2LT7A 1BBOA 1ZAAC 2EN1A 2YRMA 2EM4A 2ENHA 2EPRA 2EM2A 2YTFA 1A1GA 2DLKA 1MEYC 1X6FA 2CTDA 2EOXA 1X3CA 2EMWA 2EOMA 2EP3A 2EOEA 2EM3A 5KL5A 2EMHA 2YTEA 2WBUA 2EN2A 2EOYA 2YTNA 4M9VC 1UN6B 3EPHA 2EN7A 2MKNA 2EOHA 1KJKA 4R2RA 2I13A 2EMAA 2EPAA 4R2AA 1NCSA 2J7JA 2EOFA 2EQ0A 2EMIA 1AAYA 5KL3A 5KL7A 4F2JC 2YTJA 2ELZA 2EM6A 1TF3A 1A1JA 1LLMC 4IJDA 4FK5C 3UK3C 2JP9A 5KL2A 2LO3A 2LV2A 2DRPA 2D9HA 1JK1A 4F6MA 2RSIA 2DLQA 2YRHA 3M99B 2HGHA 3VHTB 2YRKA 2EOOA 4R2DA 4X9JA 2EMGA 2MKDA 1B69A 2EOJA 2EN6A 5KL6A 2EL6A 4IS1C 2EQ3A 4F6NA 2EPZA 1Z1BA 2MDGA 2EM5A 2JPAA 2EM9A 2E72A 1JK2A 2LVHA 2EM7A 2GHFA 4R2PA 1P47A 2CSHA 4GZNC 2YSOA 2PRTA 4R2QA 2RPCA 2YTQA 1ZU1A 2YSPA 2EM8A 3MHHC 1ZR9A 1UBDC 2DGCA 2EN4A 2EJ4A 1G2FC 2EPCA 1TF6A 2YTGA 2WBSA 4R2EA 2ENCA 2EOSA 2NABA 1F2IG 1TN9A 2EOZA 2EPXA 2EMXA 1X6HA 2EN3A 1X5WA 2YTPA 1A1LA 2EMCA 2LCEA 1A1FA 2YTDA 2YU8A 3EPJA 2EL4A 4WSGA 4R2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELY A;  1RMD A;  2BB8 A;  2EMY A;  2ENA A;  2EOR A;  2ADR A;  2EE8 A;  3EPL A;  2WBT A;  2YTO A;  2EOQ A;  3MHS C;  5KL4 A;  1A1H A;  2YU5 A;  2EMF A;  1A1I A;  1X6E A;  2EPU A;  1G2D C;  2EML A;  3EPK A;  2EMK A;  2YTI A;  2EL5 A;  2EN8 A;  1DGC A;  1WJP A;  2GLI A;  2EMB A;  2EMZ A;  2VRD A;  2DMI A;  1A1K A;  1YUI A;  2A25 A;  2R1F A;  2WCC 3;  2EOI A;  2EPP A;  1YUJ A;  2CT1 A;  2EQ1 A;  4R2S A;  1YSA C;  2M9A A;  1BB8 A;  2EM0 A;  2LT7 A;  1BBO A;  1ZAA C;  2EN1 A;  2YRM A;  2EM4 A;  2ENH A;  2EPR A;  2EM2 A;  2YTF A;  1A1G A;  2DLK A;  1MEY C;  1X6F A;  2CTD A;  2EOX A;  1X3C A;  2EMW A;  2EOM A;  2EP3 A;  2EOE A;  2EM3 A;  5KL5 A;  2EMH A;  2YTE A;  2WBU A;  2EN2 A;  2EOY A;  2YTN A;  4M9V C;  1UN6 B;  3EPH A;  2EN7 A;  2MKN A;  2EOH A;  1KJK A;  4R2R A;  2I13 A;  2EMA A;  2EPA A;  4R2A A;  1NCS A;  2J7J A;  2EOF A;  2EQ0 A;  2EMI A;  1AAY A;  5KL3 A;  5KL7 A;  4F2J C;  2YTJ A;  2ELZ A;  2EM6 A;  1TF3 A;  1A1J A;  1LLM C;  4IJD A;  4FK5 C;  3UK3 C;  2JP9 A;  5KL2 A;  2LO3 A;  2LV2 A;  2DRP A;  2D9H A;  1JK1 A;  4F6M A;  2RSI A;  2DLQ A;  2YRH A;  3M99 B;  2HGH A;  3VHT B;  2YRK A;  2EOO A;  4R2D A;  4X9J A;  2EMG A;  2MKD A;  1B69 A;  2EOJ A;  2EN6 A;  5KL6 A;  2EL6 A;  4IS1 C;  2EQ3 A;  4F6N A;  2EPZ A;  1Z1B A;  2MDG A;  2EM5 A;  2JPA A;  2EM9 A;  2E72 A;  1JK2 A;  2LVH A;  2EM7 A;  2GHF A;  4R2P A;  1P47 A;  2CSH A;  4GZN C;  2YSO A;  2PRT A;  4R2Q A;  2RPC A;  2YTQ A;  1ZU1 A;  2YSP A;  2EM8 A;  3MHH C;  1ZR9 A;  1UBD C;  2DGC A;  2EN4 A;  2EJ4 A;  1G2F C;  2EPC A;  1TF6 A;  2YTG A;  2WBS A;  4R2E A;  2ENC A;  2EOS A;  2NAB A;  1F2I G;  1TN9 A;  2EOZ A;  2EPX A;  2EMX A;  1X6H A;  2EN3 A;  1X5W A;  2YTP A;  1A1L A;  2EMC A;  2LCE A;  1A1F A;  2YTD A;  2YU8 A;  3EPJ A;  2EL4 A;  4WSG A;  4R2C A; 
#chains in the Genus database with same CATH topology
 2ELY A;  3C4T A;  1SR9 A;  2EMY A;  3EPL A;  2LRS A;  5KL4 A;  1FKA E;  1T4O A;  2EMF A;  2M1S A;  5A6K A;  4JI4 E;  4RHB B;  1T39 A;  4F9C B;  1PJS A;  1G2D C;  2ODR D;  2M4I A;  4M2Z A;  2L2N A;  2RTX A;  1PDA A;  2EMK A;  5IT9 C;  4DR2 E;  1N36 E;  2EMZ A;  2N3H A;  4GEQ B;  2A25 A;  2WCC 3;  3JU0 A;  2EOI A;  4JI7 E;  2JR1 A;  2L3J A;  1YUJ A;  2UUC E;  4NXM E;  4LF5 E;  4JI3 E;  3T1Y E;  2EN1 A;  4ZYH A;  1EH8 A;  4BMJ A;  2EM4 A;  4BCA A;  2EM2 A;  2B3T B;  2RS7 A;  4DKK A;  2VQE E;  2EOX A;  1IQS A;  4YHH E;  4MLQ A;  1ZBQ A;  4DV3 E;  4BS9 A;  2WBU A;  2EMH A;  2EOY A;  2YTN A;  2EWL A;  5IV8 B;  1UN6 B;  1RC7 A;  1X49 A;  2EPA A;  2V88 A;  4R2A A;  3J7Y p;  1NCS A;  3ZOQ B;  2BBG A;  4WSP A;  2LTR A;  5KL7 A;  4BC9 A;  4F9A B;  2LE2 A;  5AAS A;  1EH7 A;  1A1J A;  3AV0 A;  3UK3 C;  4X66 E;  3RMP A;  5KL2 A;  2HJJ A;  2DRP A;  2D9H A;  2JY9 A;  3THN A;  1QNT A;  2VE7 C;  2L33 A;  3L00 A;  2VQF E;  4F6M A;  1IQO A;  1J26 A;  2EPK X;  2YRH A;  4WPY A;  3F6G A;  4O5G A;  4X9J A;  2EMG A;  2L2M A;  4JI0 E;  1B69 A;  2UUB E;  4JV5 E;  4OOG C;  5AC4 A;  3HQ1 A;  4IS1 C;  1RQ0 A;  3T1H E;  1ZBT A;  4F6N A;  2EPZ A;  2MDG A;  2JOX A;  2JPA A;  3KWR A;  1JK2 A;  4L5N C;  3DJW A;  4GZN C;  2PRT A;  2B7T A;  4I8O A;  4R2Q A;  4OX9 E;  1EKZ A;  4NXN E;  4KZS A;  4DR5 E;  2EN4 A;  4DR7 E;  4B3T E;  2H36 X;  1FJG E;  5IWA E;  2YTG A;  2WBS A;  1PJQ A;  1QU6 A;  1F2I G;  3BBG A;  1N34 E;  1X6H A;  4M0V A;  1X5W A;  3C4B A;  3LLH A;  4P78 A;  2YU8 A;  2YZT A;  5A6B D;  2UXC E;  5A2Q C;  1HNZ E;  5A6B A;  1YYW A;  4KWY A;  2EOR A;  3OTO E;  2EE8 A;  2EOQ A;  4B3S E;  4LF7 E;  4K0K E;  3EPK A;  4ZYE A;  2EL5 A;  2EN8 A;  1WJP A;  3C6K A;  4LTY A;  1YUI A;  3P1X A;  2NUF A;  1GTK A;  2R1F A;  2E5L E;  5A6J A;  1YPN A;  4L8N A;  2EQ1 A;  2M9A A;  2N3G A;  4GKK E;  4DMI A;  1A1G A;  2JVA A;  4WYQ B;  3JAM C;  3BGH A;  4JI8 E;  5DNY A;  1X3C A;  2UUA E;  4LU9 A;  2M7Q A;  2MC6 A;  4O43 A;  4AQY E;  3EPH A;  2EOH A;  3J7A G;  2I13 A;  3J80 C;  2RS6 A;  2J7J A;  2EQ0 A;  1AAY A;  1YYK A;  1HR0 E;  4DUY E;  2YTJ A;  2MDR A;  1MGT A;  2ELZ A;  4DV0 E;  1TF3 A;  4LF6 E;  5LL6 R;  2ZM6 E;  2JP9 A;  4LF9 E;  3OML A;  4BC7 A;  2ODR C;  2V85 A;  2RSI A;  2E1M A;  3M99 B;  1UHZ A;  4DV1 E;  4B3R E;  4J8Z A;  2EOO A;  3HPS A;  2EOJ A;  2I9I A;  3C6M A;  4DR3 E;  2EL6 A;  1Z1B A;  3TQM A;  4WXD A;  1DQ3 A;  1I94 E;  2K7I A;  4R2P A;  1GQE A;  4X62 E;  4JYA E;  3DF6 A;  2EPN A;  2JXP A;  2YTQ A;  2UU9 E;  1ZU1 A;  2YSP A;  2WZO A;  1IBK E;  1GZ6 A;  2HHH E;  2B9D A;  2DMY A;  2L8T A;  2L92 A;  4NHR A;  2L3C A;  1EH6 A;  2HC5 A;  4R2E A;  1J5E E;  1O0W A;  2EZ6 A;  2NAB A;  2N8X A;  2EN3 A;  1PKP A;  5T6J A;  3VYY A;  2K4V A;  2F8B A;  2LMZ A;  2UXD E;  3MSW A;  2VF1 A;  2FTX B;  2EL4 A;  1WHN A;  5CFF E;  4B3M E;  1RMD A;  3VYX A;  2ENA A;  1KYQ A;  2ADR A;  1WXR A;  2WBT A;  1N3G A;  2YT4 A;  2YTO A;  1A1H A;  2YU5 A;  1A1I A;  1BBG A;  3BID A;  3IWD A;  2L2K B;  2EML A;  3JTZ A;  2YTI A;  2KOU A;  1DGC A;  2GLI A;  3VK6 A;  2VRD A;  2DMI A;  3ADJ A;  4F9B B;  1WRJ A;  4MLV A;  1YYO A;  4R8O A;  1SFE A;  2CT1 A;  2KHX A;  2YPN A;  3HXL A;  1BB8 A;  1ZAA C;  2YRM A;  1T4L B;  2V86 A;  1T38 A;  2ENH A;  2EPR A;  2GPI A;  2YTF A;  2DLK A;  4TUI A;  3THO B;  1MEY C;  2KON A;  1X6F A;  2CTD A;  2EPM X;  3KZY A;  5AE3 A;  1PJT A;  2EMW A;  2EOM A;  2EOE A;  2EM3 A;  5KL5 A;  2YTE A;  2EN2 A;  4M9V C;  1L4S A;  1KJK A;  4LF8 E;  2EMA A;  5IXM B;  2EOF A;  2CPN A;  2EMI A;  2RQL A;  4DV4 E;  4GKJ E;  3EQ1 A;  4KHP E;  1LLM C;  1XNR E;  2LO3 A;  2LV2 A;  4LFB E;  4N4R B;  1UIL A;  2EPO A;  2V83 A;  4ZYG A;  2DLQ A;  1WHQ A;  4YY3 E;  2HGH A;  3VHT B;  3ADG A;  2V89 A;  4R2D A;  4DV5 E;  4LF4 E;  2MKD A;  5AE2 A;  5FLX C;  2Q8U A;  5KL6 A;  4DV7 E;  2YWQ A;  2EQ3 A;  3K6Q A;  2G7H A;  2EM5 A;  2LJU A;  3ADL A;  2RSM A;  2LVH A;  2EM7 A;  2CSH A;  4DR1 E;  2IHR 1;  2YSO A;  1X48 A;  2RPC A;  1N32 E;  2EM8 A;  2F4V E;  1N33 E;  3IWC A;  4X64 E;  2B7V A;  3HPZ A;  1TF6 A;  3KZZ A;  2FV4 B;  4LFC E;  2V8Q B;  2V87 A;  2EOS A;  1TN9 A;  2EPX A;  1IBL E;  2YTP A;  2EMC A;  1A1F A;  3J81 C;  4Q35 B;  3EPJ A;  1T4N A;  2LUQ A;  4R2C A;  4R2R A;  4DUZ E;  2BB8 A;  4BBY A;  1HNX E;  5F3W A;  2EPL X;  1YFH A;  3MHS C;  3QG5 C;  1IMU A;  3H09 A;  1X6E A;  2EPU A;  4HEI A;  3BF2 A;  4X8W A;  4HTG A;  1STU A;  2DSY A;  2JYA A;  2NUG A;  2EMB A;  4BHB A;  1AH5 A;  1A1K A;  5TSE A;  5LMU E;  2R76 A;  4WX9 A;  2EPP A;  4WFT A;  2DB2 A;  4R2S A;  1YSA C;  2DIX A;  2JOB A;  2EM0 A;  2LT7 A;  1BBO A;  4X65 E;  5A6A A;  1YZ9 A;  3FIG A;  4WXC A;  4M30 A;  4JI1 E;  1NEI A;  1XMQ E;  4O24 A;  1XNQ E;  4RH8 A;  4BHC A;  2JWO A;  2L6M A;  2MC5 A;  5LMN E;  3ADI A;  2EP3 A;  2FGG A;  4DV6 E;  2EN7 A;  2MKN A;  4NZV A;  5KL3 A;  3IWB A;  4ZYD A;  4F2J C;  2LUP B;  2EM6 A;  2NA2 A;  3AUZ A;  4IJD A;  4FK5 C;  5ADZ A;  1JK1 A;  1HNW E;  3HTX A;  4JI5 E;  4O4K A;  3F6H A;  5A69 A;  2YRK A;  4F54 A;  5AE1 A;  1DI2 A;  2EN6 A;  1X47 A;  4JI2 E;  2E72 A;  2EM9 A;  4R03 A;  2GHF A;  4TUG A;  1P47 A;  3MHH C;  4JI6 E;  3LML A;  1IBM E;  1ZR9 A;  4LFA E;  1UBD C;  2DGC A;  3ECR A;  4P7D A;  2EJ4 A;  5LLQ A;  1G2F C;  2EPC A;  2LTS A;  5BR8 E;  2ENC A;  5AC5 A;  2EOZ A;  2EMX A;  2NUE A;  1A1L A;  2UXB E;  2LCE A;  2LBS B;  1XMO E;  2LJH A;  2YTD A;  4Q28 A;  4DR6 E;  4DR4 E;  4WSG A;  4DV2 E; 
#chains in the Genus database with same CATH homology
 2ELY A;  1RMD A;  2BB8 A;  2EMY A;  2ENA A;  2EOR A;  2ADR A;  2EE8 A;  3EPL A;  2WBT A;  2YTO A;  2EOQ A;  3MHS C;  5KL4 A;  1A1H A;  2YU5 A;  2EMF A;  1A1I A;  1X6E A;  2EPU A;  1G2D C;  2EML A;  3EPK A;  2EMK A;  2YTI A;  2EL5 A;  2EN8 A;  1DGC A;  1WJP A;  2GLI A;  2EMB A;  2EMZ A;  2VRD A;  2DMI A;  1A1K A;  1YUI A;  2A25 A;  2R1F A;  2WCC 3;  2EOI A;  2EPP A;  1YUJ A;  2CT1 A;  2EQ1 A;  4R2S A;  1YSA C;  2M9A A;  1BB8 A;  2EM0 A;  2LT7 A;  1BBO A;  1ZAA C;  2EN1 A;  2YRM A;  2EM4 A;  2ENH A;  2EPR A;  2EM2 A;  2YTF A;  1A1G A;  2DLK A;  1MEY C;  1X6F A;  2CTD A;  2EOX A;  1X3C A;  2EMW A;  2EOM A;  2EP3 A;  2EOE A;  2EM3 A;  5KL5 A;  2EMH A;  2YTE A;  2WBU A;  2EN2 A;  2EOY A;  2YTN A;  4M9V C;  1UN6 B;  3EPH A;  2EN7 A;  2MKN A;  2EOH A;  1KJK A;  4R2R A;  2I13 A;  2EMA A;  2EPA A;  4R2A A;  1NCS A;  2J7J A;  2EOF A;  2EQ0 A;  2EMI A;  1AAY A;  5KL3 A;  5KL7 A;  4F2J C;  2YTJ A;  2ELZ A;  2EM6 A;  1TF3 A;  1A1J A;  1LLM C;  4IJD A;  4FK5 C;  3UK3 C;  2JP9 A;  5KL2 A;  2LO3 A;  2LV2 A;  2DRP A;  2D9H A;  1JK1 A;  4F6M A;  2RSI A;  2DLQ A;  2YRH A;  3M99 B;  2HGH A;  3VHT B;  2YRK A;  2EOO A;  4R2D A;  4X9J A;  2EMG A;  2MKD A;  1B69 A;  2EOJ A;  2EN6 A;  5KL6 A;  2EL6 A;  4IS1 C;  2EQ3 A;  4F6N A;  2EPZ A;  1Z1B A;  2MDG A;  2EM5 A;  2JPA A;  2EM9 A;  2E72 A;  1JK2 A;  2LVH A;  2EM7 A;  2GHF A;  4R2P A;  1P47 A;  2CSH A;  4GZN C;  2YSO A;  2PRT A;  4R2Q A;  2RPC A;  2YTQ A;  1ZU1 A;  2YSP A;  2EM8 A;  3MHH C;  1ZR9 A;  1UBD C;  2DGC A;  2EN4 A;  2EJ4 A;  1G2F C;  2EPC A;  1TF6 A;  2YTG A;  2WBS A;  4R2E A;  2ENC A;  2EOS A;  2NAB A;  1F2I G;  1TN9 A;  2EOZ A;  2EPX A;  2EMX A;  1X6H A;  2EN3 A;  1X5W A;  2YTP A;  1A1L A;  2EMC A;  2LCE A;  1A1F A;  2YTD A;  2YU8 A;  3EPJ A;  2EL4 A;  4WSG A;  4R2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...