1JK2A

Zif268 d20a mutant bound to the gct dna site
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
b'RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*TP*G)-3'
publication title Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk2A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk2A01
2ADRA 2J7JA 2EMCA 2YTNA 2YTQA 2EOEA 2EPXA 2M9AA 2EPAA 2EM2A 1TN9A 2I13A 2ELZA 1G2DC 2EN4A 2LO3A 1YSAC 2EOZA 2EOMA 2EMWA 1UBDC 1Z1BA 4R2AA 2EN6A 1NCSA 2EM0A 2EMLA 1TF6A 2MKNA 2EN1A 2EOOA 4R2PA 1G2FC 1RMDA 2EOQA 4R2SA 1YUIA 2EPUA 2YTPA 1KJKA 2LVHA 2EMGA 2JPAA 2VRDA 2A25A 1X5WA 5KL2A 2LV2A 2EMFA 4GZNC 2EL6A 2GLIA 2EMXA 2EPPA 4R2QA 2EL5A 2EPCA 2R1FA 2YRMA 1X3CA 5KL6A 1ZAAC 2EMBA 2JP9A 2ELYA 2EL4A 2EORA 1BB8A 1A1GA 3EPLA 3EPHA 1F2IG 2EOXA 1P47A 2EOIA 2EMYA 2EN7A 2YU8A 4F2JC 2DLKA 2EM9A 2DLQA 2WBTA 2EMKA 2EN3A 1A1KA 4IJDA 2YRKA 2ENCA 2EM8A 4R2EA 4X9JA 4IS1C 1MEYC 2WBSA 2YTOA 1JK2A 2YTEA 2ENHA 2EQ1A 2ENAA 1ZU1A 4M9VC 2EOSA 5KL3A 2EQ0A 5KL5A 2WBUA 2D9HA 2WCC3 3M99B 2EMIA 2BB8A 1AAYA 2EOFA 4F6MA 2EMAA 5KL7A 2EOHA 4F6NA 1BBOA 1DGCA 2LCEA 2YRHA 2YTFA 2PRTA 2YTJA 2YTDA 2EM5A 2MKDA 2EPZA 1LLMC 2DRPA 1X6HA 2YSOA 2EJ4A 1YUJA 2RPCA 2YTIA 2YU5A 4R2RA 2DGCA 2DMIA 1X6EA 1ZR9A 4R2CA 1B69A 1UN6B 2EOJA 3MHHC 1A1LA 2YTGA 1JK1A 3EPKA 2YSPA 2RSIA 3EPJA 1A1HA 1X6FA 1TF3A 2MDGA 2EM3A 2EMHA 2GHFA 3VHTB 2EN8A 2EQ3A 4FK5C 2CSHA 4WSGA 2EOYA 1A1IA 2E72A 1A1FA 2EN2A 2CT1A 2HGHA 2LT7A 1A1JA 2EM4A 2EE8A 2EPRA 2CTDA 3MHSC 2NABA 3UK3C 1WJPA 2EMZA 2EP3A 2EM7A 4R2DA 2EM6A 5KL4A
chains in the Genus database with same CATH superfamily
2JWOA 2J7JA 5IT9C 2LE2A 2MC6A 2M9AA 4KWYA 2EPMX 2RS7A 1L4SA 5TSEA 2ZM6E 1DQ3A 1STUA 4WXDA 4X65E 4Q28A 4JI3E 3BIDA 4I8OA 2B3TB 1QNTA 1UBDC 4MLVA 2GPIA 3J81C 4BMJA 4R2AA 2EN6A 2NUEA 3BBGA 4R2SA 2EPUA 5ADZA 4LF9E 1PJSA 4TUGA 2FTXB 2A25A 1X5WA 2LV2A 2EMXA 2JOXA 1HR0E 4L8NA 3H09A 5KL6A 1XNRE 2E1MA 2JP9A 2I9IA 2EZ6A 2DIXA 5A6BD 4YY3E 4LF5E 2CPNA 1F2IG 3BF2A 2EMYA 5AC4A 4F2JC 2EM9A 2DLQA 1RC7A 4F9BB 1T38A 2N8XA 2YRKA 2ENCA 2EM8A 4R2EA 2UUCE 2WBSA 2YTEA 2EQ1A 4M9VC 1J26A 2EOSA 5KL3A 4JI5E 2IHR1 5KL5A 1HNWE 2DB2A 4WX9A 1YPNA 2BB8A 3F6GA 3KZZA 4LU9A 2EOFA 2M1SA 1ZBTA 4HEIA 4BS9A 4P7DA 1DGCA 2R76A 2RSMA 2PRTA 1DI2A 2B7TA 2YTJA 1XNQE 4JI0E 2G7HA 1X6HA 3DJWA 4F9AB 1YUJA 2RPCA 2JYAA 3KWRA 1T39A 4O24A 4ZYHA 2YWQA 2EOJA 3MHHC 4R8OA 1JK1A 2JY9A 1TF3A 3IWDA 2UUBE 2MDGA 2EM3A 1BBGA 4JYAE 2GHFA 2V87A 1EH6A 2V89A 2EN8A 1GTKA 2E72A 1A1FA 4NXNE 2EPRA 5BR8E 3QG5C 2V8QB 5KL4A 2EOEA 2N3GA 2EM2A 1TN9A 3F6HA 2HHHE 2I13A 2ELZA 1YYOA 2LO3A 1YSAC 4X64E 2EOMA 4BC9A 4DUZE 3OMLA 1YZ9A 1Z1BA 1EH8A 1NCSA 4JI1E 1J5EE 1N32E 1TF6A 1RMDA 1WXRA 4O5GA 2L33A 2EMGA 3L00A 4DMIA 3C4BA 2HC5A 4GZNC 3VK6A 1UHZA 2EL6A 4R2QA 2V88A 2RQLA 3ADIA 3DF6A 3J7Yp 2EPNA 2YT4A 1BB8A 3EPLA 2V85A 3EPHA 4NXME 2EOIA 2YU8A 2DLKA 1ZBQA 3K6QA 2VQEE 3FIGA 4JI6E 4DR3E 3C4TA 4IJDA 4DV0E 4LF8E 1NEIA 4WYQB 4WXCA 4LFBE 2LTSA 5AE3A 1ZU1A 2EQ0A 2B9DA 3HPZA 4WFTA 3M99B 1GQEA 2EMIA 4DKKA 2LUPB 2EMAA 4M30A 2EOHA 5A6KA 3ADLA 2UUAE 3THNA 2LCEA 4DV7E 1EKZA 2YTDA 5IWAE 2E5LE 4F54A 2EM5A 2YZTA 2EPZA 2DRPA 1WRJA 2EJ4A 2BBGA 2YTIA 2LUQA 2UU9E 4B3RE 1EH7A 2L2MA 4R2CA 3VYXA 1A1LA 2YTGA 3EPKA 1IQSA 3EPJA 2H36X 2FGGA 3LLHA 3ECRA 3HPSA 5F3WA 4WSGA 5CFFE 2EN2A 2CT1A 2V83A 4ZYEA 2LT7A 1A1JA 2Q8UA 1PKPA 2UXDE 2JXPA 2NABA 2L3CA 3UK3C 1X47A 1A1HA 4J8ZA 1MGTA 2EM6A 2ADRA 1XMOE 2EMCA 2YTNA 1AH5A 2ODRC 2EPAA 1N36E 4NZVA 5LLQA 2EOZA 4DV3E 5AE2A 1IBME 2RS6A 1X49A 2L8TA 2EM0A 2EMLA 4JI7E 4OOGC 2EN1A 2EOOA 2MKNA 1G2FC 4LF4E 2EOQA 1UILA 2M7QA 5DNYA 4X62E 4O4KA 2LVHA 5A6AA 2JPAA 2VRDA 4R03A 4N4RB 4BC7A 1WHQA 4O43A 2YPNA 3OTOE 2EL5A 3LMLA 2KOUA 2DMYA 4X8WA 1ZAAC 3EQ1A 2ELYA 2VQFE 3P1XA 2EORA 4MLQA 4GEQB 2HJJA 4JI4E 1P47A 3KZYA 1QU6A 4OX9E 2EN7A 2EPOA 2WBTA 2JOBA 2EMKA 2LRSA 3TQMA 1T4OA 4DR1E 4IS1C 1MEYC 4DR2E 4ZYGA 1IBKE 2L92A 4DR4E 2ENHA 4GKJE 1SFEA 2ENAA 1IBLE 2FV4B 3ZOQB 1T4NA 2D9HA 4DR6E 4JI2E 1HNXE 1AAYA 2JVAA 2MC5A 1GZ6A 4BHBA 4ZYDA 2YRHA 2YTFA 1X48A 5A69A 3IWBA 2NUGA 4WSPA 5IV8B 5A2QC 4X66E 3VYYA 2L2KB 1X6EA 1B69A 2F8BA 1T4LB 2DSYA 1FKAE 2YSPA 2RSIA 3RMPA 4DR7E 1X6FA 2KONA 2ODRD 5LMUE 2EMHA 1YYKA 3HTXA 2L6MA 2VF1A 3VHTB 2EQ3A 4FK5C 3J80C 2CSHA 2MDRA 4RHBB 1A1IA 5AE1A 2LJHA 3JAMC 4YHHE 2LMZA 4B3ME 2EM4A 2EE8A 4DUYE 1WJPA 5A6JA 2EP3A 5LL6R 4R2DA 2YTQA 4DV6E 3ADGA 2EPXA 2K7IA 4P78A 4LFCE 4Q35B 2N3HA 1G2DC 2EN4A 2KHXA 4B3TE 1WHNA 1PJQA 2EMWA 5A6BA 3ADJA 4JI8E 1FJGE 2UXBE 1PJTA 5AC5A 3BGHA 2NUFA 4R2PA 1SR9A 1YUIA 2WZOA 4KHPE 2YTPA 1KJKA 4K0KE 1IMUA 5T6JA 3HQ1A 2EPLX 1N33E 5KL2A 2LBSB 2UXCE 2EMFA 2GLIA 2EPPA 3T1HE 2EPCA 4HTGA 2R1FA 4BBYA 2YRMA 1X3CA 1YFHA 5IXMB 3C6KA 4B3SE 2EMBA 4DR5E 2EL4A 4WPYA 4LF7E 1A1GA 4M0VA 3MSWA 2EOXA 4RH8A 3IWCA 4TUIA 4LF6E 2LJUA 2EN3A 2JR1A 1A1KA 2K4VA 4BCAA 1O0WA 4X9JA 2V86A 2YTOA 1JK2A 4DV5E 4KZSA 3HXLA 3JU0A 4DV2E 1N3GA 4JV5E 2EWLA 2WBUA 4DV1E 2WCC3 5AASA 2VE7C 4LTYA 4LFAE 4F6MA 5KL7A 4F6NA 1N34E 4M2ZA 1BBOA 4F9CB 1IQOA 2L2NA 4L5NC 3AV0A 1KYQA 5FLXC 2LTRA 3JTZA 2MKDA 1LLMC 2EPKX 2YSOA 1RQ0A 3J7AG 3T1YE 1HNZE 2YU5A 4R2RA 2DGCA 2DMIA 1ZR9A 1UN6B 4GKKE 2L3JA 3THOB 4BHCA 2B7VA 4AQYE 2NA2A 3AUZA 1PDAA 2EOYA 2RTXA 2HGHA 3C6MA 5LMNE 4DV4E 1I94E 2CTDA 3MHSC 1YYWA 1XMQE 2EMZA 2M4IA 4NHRA 2EM7A 2F4VE
chains in the Genus database with same CATH topology
2ADRA 2J7JA 2EMCA 2YTNA 2YTQA 2EOEA 2EPXA 2M9AA 2EPAA 2EM2A 1TN9A 2I13A 2ELZA 1G2DC 2EN4A 2LO3A 1YSAC 2EOZA 2EOMA 2EMWA 1UBDC 1Z1BA 4R2AA 2EN6A 1NCSA 2EM0A 2EMLA 1TF6A 2MKNA 2EN1A 2EOOA 4R2PA 1G2FC 1RMDA 2EOQA 4R2SA 1YUIA 2EPUA 2YTPA 1KJKA 2LVHA 2EMGA 2JPAA 2VRDA 2A25A 1X5WA 5KL2A 2LV2A 2EMFA 4GZNC 2EL6A 2GLIA 2EMXA 2EPPA 4R2QA 2EL5A 2EPCA 2R1FA 2YRMA 1X3CA 5KL6A 1ZAAC 2EMBA 2JP9A 2ELYA 2EL4A 2EORA 1BB8A 1A1GA 3EPLA 3EPHA 1F2IG 2EOXA 1P47A 2EOIA 2EMYA 2EN7A 2YU8A 4F2JC 2DLKA 2EM9A 2DLQA 2WBTA 2EMKA 2EN3A 1A1KA 4IJDA 2YRKA 2ENCA 2EM8A 4R2EA 4X9JA 4IS1C 1MEYC 2WBSA 2YTOA 1JK2A 2YTEA 2ENHA 2EQ1A 2ENAA 1ZU1A 4M9VC 2EOSA 5KL3A 2EQ0A 5KL5A 2WBUA 2D9HA 2WCC3 3M99B 2EMIA 2BB8A 1AAYA 2EOFA 4F6MA 2EMAA 5KL7A 2EOHA 4F6NA 1BBOA 1DGCA 2LCEA 2YRHA 2YTFA 2PRTA 2YTJA 2YTDA 2EM5A 2MKDA 2EPZA 1LLMC 2DRPA 1X6HA 2YSOA 2EJ4A 1YUJA 2RPCA 2YTIA 2YU5A 4R2RA 2DGCA 2DMIA 1X6EA 1ZR9A 4R2CA 1B69A 1UN6B 2EOJA 3MHHC 1A1LA 2YTGA 1JK1A 3EPKA 2YSPA 2RSIA 3EPJA 1A1HA 1X6FA 1TF3A 2MDGA 2EM3A 2EMHA 2GHFA 3VHTB 2EN8A 2EQ3A 4FK5C 2CSHA 4WSGA 2EOYA 1A1IA 2E72A 1A1FA 2EN2A 2CT1A 2HGHA 2LT7A 1A1JA 2EM4A 2EE8A 2EPRA 2CTDA 3MHSC 2NABA 3UK3C 1WJPA 2EMZA 2EP3A 2EM7A 4R2DA 2EM6A 5KL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADR A;  2J7J A;  2EMC A;  2YTN A;  2YTQ A;  2EOE A;  2EPX A;  2M9A A;  2EPA A;  2EM2 A;  1TN9 A;  2I13 A;  2ELZ A;  1G2D C;  2EN4 A;  2LO3 A;  1YSA C;  2EOZ A;  2EOM A;  2EMW A;  1UBD C;  1Z1B A;  4R2A A;  2EN6 A;  1NCS A;  2EM0 A;  2EML A;  1TF6 A;  2MKN A;  2EN1 A;  2EOO A;  4R2P A;  1G2F C;  1RMD A;  2EOQ A;  4R2S A;  1YUI A;  2EPU A;  2YTP A;  1KJK A;  2LVH A;  2EMG A;  2JPA A;  2VRD A;  2A25 A;  1X5W A;  5KL2 A;  2LV2 A;  2EMF A;  4GZN C;  2EL6 A;  2GLI A;  2EMX A;  2EPP A;  4R2Q A;  2EL5 A;  2EPC A;  2R1F A;  2YRM A;  1X3C A;  5KL6 A;  1ZAA C;  2EMB A;  2JP9 A;  2ELY A;  2EL4 A;  2EOR A;  1BB8 A;  1A1G A;  3EPL A;  3EPH A;  1F2I G;  2EOX A;  1P47 A;  2EOI A;  2EMY A;  2EN7 A;  2YU8 A;  4F2J C;  2DLK A;  2EM9 A;  2DLQ A;  2WBT A;  2EMK A;  2EN3 A;  1A1K A;  4IJD A;  2YRK A;  2ENC A;  2EM8 A;  4R2E A;  4X9J A;  4IS1 C;  1MEY C;  2WBS A;  2YTO A;  1JK2 A;  2YTE A;  2ENH A;  2EQ1 A;  2ENA A;  1ZU1 A;  4M9V C;  2EOS A;  5KL3 A;  2EQ0 A;  5KL5 A;  2WBU A;  2D9H A;  2WCC 3;  3M99 B;  2EMI A;  2BB8 A;  1AAY A;  2EOF A;  4F6M A;  2EMA A;  5KL7 A;  2EOH A;  4F6N A;  1BBO A;  1DGC A;  2LCE A;  2YRH A;  2YTF A;  2PRT A;  2YTJ A;  2YTD A;  2EM5 A;  2MKD A;  2EPZ A;  1LLM C;  2DRP A;  1X6H A;  2YSO A;  2EJ4 A;  1YUJ A;  2RPC A;  2YTI A;  2YU5 A;  4R2R A;  2DGC A;  2DMI A;  1X6E A;  1ZR9 A;  4R2C A;  1B69 A;  1UN6 B;  2EOJ A;  3MHH C;  1A1L A;  2YTG A;  1JK1 A;  3EPK A;  2YSP A;  2RSI A;  3EPJ A;  1A1H A;  1X6F A;  1TF3 A;  2MDG A;  2EM3 A;  2EMH A;  2GHF A;  3VHT B;  2EN8 A;  2EQ3 A;  4FK5 C;  2CSH A;  4WSG A;  2EOY A;  1A1I A;  2E72 A;  1A1F A;  2EN2 A;  2CT1 A;  2HGH A;  2LT7 A;  1A1J A;  2EM4 A;  2EE8 A;  2EPR A;  2CTD A;  3MHS C;  2NAB A;  3UK3 C;  1WJP A;  2EMZ A;  2EP3 A;  2EM7 A;  4R2D A;  2EM6 A;  5KL4 A; 
#chains in the Genus database with same CATH topology
 2JWO A;  2J7J A;  5IT9 C;  2LE2 A;  2MC6 A;  2M9A A;  4KWY A;  2EPM X;  2RS7 A;  1L4S A;  5TSE A;  2ZM6 E;  1DQ3 A;  1STU A;  4WXD A;  4X65 E;  4Q28 A;  4JI3 E;  3BID A;  4I8O A;  2B3T B;  1QNT A;  1UBD C;  4MLV A;  2GPI A;  3J81 C;  4BMJ A;  4R2A A;  2EN6 A;  2NUE A;  3BBG A;  4R2S A;  2EPU A;  5ADZ A;  4LF9 E;  1PJS A;  4TUG A;  2FTX B;  2A25 A;  1X5W A;  2LV2 A;  2EMX A;  2JOX A;  1HR0 E;  4L8N A;  3H09 A;  5KL6 A;  1XNR E;  2E1M A;  2JP9 A;  2I9I A;  2EZ6 A;  2DIX A;  5A6B D;  4YY3 E;  4LF5 E;  2CPN A;  1F2I G;  3BF2 A;  2EMY A;  5AC4 A;  4F2J C;  2EM9 A;  2DLQ A;  1RC7 A;  4F9B B;  1T38 A;  2N8X A;  2YRK A;  2ENC A;  2EM8 A;  4R2E A;  2UUC E;  2WBS A;  2YTE A;  2EQ1 A;  4M9V C;  1J26 A;  2EOS A;  5KL3 A;  4JI5 E;  2IHR 1;  5KL5 A;  1HNW E;  2DB2 A;  4WX9 A;  1YPN A;  2BB8 A;  3F6G A;  3KZZ A;  4LU9 A;  2EOF A;  2M1S A;  1ZBT A;  4HEI A;  4BS9 A;  4P7D A;  1DGC A;  2R76 A;  2RSM A;  2PRT A;  1DI2 A;  2B7T A;  2YTJ A;  1XNQ E;  4JI0 E;  2G7H A;  1X6H A;  3DJW A;  4F9A B;  1YUJ A;  2RPC A;  2JYA A;  3KWR A;  1T39 A;  4O24 A;  4ZYH A;  2YWQ A;  2EOJ A;  3MHH C;  4R8O A;  1JK1 A;  2JY9 A;  1TF3 A;  3IWD A;  2UUB E;  2MDG A;  2EM3 A;  1BBG A;  4JYA E;  2GHF A;  2V87 A;  1EH6 A;  2V89 A;  2EN8 A;  1GTK A;  2E72 A;  1A1F A;  4NXN E;  2EPR A;  5BR8 E;  3QG5 C;  2V8Q B;  5KL4 A;  2EOE A;  2N3G A;  2EM2 A;  1TN9 A;  3F6H A;  2HHH E;  2I13 A;  2ELZ A;  1YYO A;  2LO3 A;  1YSA C;  4X64 E;  2EOM A;  4BC9 A;  4DUZ E;  3OML A;  1YZ9 A;  1Z1B A;  1EH8 A;  1NCS A;  4JI1 E;  1J5E E;  1N32 E;  1TF6 A;  1RMD A;  1WXR A;  4O5G A;  2L33 A;  2EMG A;  3L00 A;  4DMI A;  3C4B A;  2HC5 A;  4GZN C;  3VK6 A;  1UHZ A;  2EL6 A;  4R2Q A;  2V88 A;  2RQL A;  3ADI A;  3DF6 A;  3J7Y p;  2EPN A;  2YT4 A;  1BB8 A;  3EPL A;  2V85 A;  3EPH A;  4NXM E;  2EOI A;  2YU8 A;  2DLK A;  1ZBQ A;  3K6Q A;  2VQE E;  3FIG A;  4JI6 E;  4DR3 E;  3C4T A;  4IJD A;  4DV0 E;  4LF8 E;  1NEI A;  4WYQ B;  4WXC A;  4LFB E;  2LTS A;  5AE3 A;  1ZU1 A;  2EQ0 A;  2B9D A;  3HPZ A;  4WFT A;  3M99 B;  1GQE A;  2EMI A;  4DKK A;  2LUP B;  2EMA A;  4M30 A;  2EOH A;  5A6K A;  3ADL A;  2UUA E;  3THN A;  2LCE A;  4DV7 E;  1EKZ A;  2YTD A;  5IWA E;  2E5L E;  4F54 A;  2EM5 A;  2YZT A;  2EPZ A;  2DRP A;  1WRJ A;  2EJ4 A;  2BBG A;  2YTI A;  2LUQ A;  2UU9 E;  4B3R E;  1EH7 A;  2L2M A;  4R2C A;  3VYX A;  1A1L A;  2YTG A;  3EPK A;  1IQS A;  3EPJ A;  2H36 X;  2FGG A;  3LLH A;  3ECR A;  3HPS A;  5F3W A;  4WSG A;  5CFF E;  2EN2 A;  2CT1 A;  2V83 A;  4ZYE A;  2LT7 A;  1A1J A;  2Q8U A;  1PKP A;  2UXD E;  2JXP A;  2NAB A;  2L3C A;  3UK3 C;  1X47 A;  1A1H A;  4J8Z A;  1MGT A;  2EM6 A;  2ADR A;  1XMO E;  2EMC A;  2YTN A;  1AH5 A;  2ODR C;  2EPA A;  1N36 E;  4NZV A;  5LLQ A;  2EOZ A;  4DV3 E;  5AE2 A;  1IBM E;  2RS6 A;  1X49 A;  2L8T A;  2EM0 A;  2EML A;  4JI7 E;  4OOG C;  2EN1 A;  2EOO A;  2MKN A;  1G2F C;  4LF4 E;  2EOQ A;  1UIL A;  2M7Q A;  5DNY A;  4X62 E;  4O4K A;  2LVH A;  5A6A A;  2JPA A;  2VRD A;  4R03 A;  4N4R B;  4BC7 A;  1WHQ A;  4O43 A;  2YPN A;  3OTO E;  2EL5 A;  3LML A;  2KOU A;  2DMY A;  4X8W A;  1ZAA C;  3EQ1 A;  2ELY A;  2VQF E;  3P1X A;  2EOR A;  4MLQ A;  4GEQ B;  2HJJ A;  4JI4 E;  1P47 A;  3KZY A;  1QU6 A;  4OX9 E;  2EN7 A;  2EPO A;  2WBT A;  2JOB A;  2EMK A;  2LRS A;  3TQM A;  1T4O A;  4DR1 E;  4IS1 C;  1MEY C;  4DR2 E;  4ZYG A;  1IBK E;  2L92 A;  4DR4 E;  2ENH A;  4GKJ E;  1SFE A;  2ENA A;  1IBL E;  2FV4 B;  3ZOQ B;  1T4N A;  2D9H A;  4DR6 E;  4JI2 E;  1HNX E;  1AAY A;  2JVA A;  2MC5 A;  1GZ6 A;  4BHB A;  4ZYD A;  2YRH A;  2YTF A;  1X48 A;  5A69 A;  3IWB A;  2NUG A;  4WSP A;  5IV8 B;  5A2Q C;  4X66 E;  3VYY A;  2L2K B;  1X6E A;  1B69 A;  2F8B A;  1T4L B;  2DSY A;  1FKA E;  2YSP A;  2RSI A;  3RMP A;  4DR7 E;  1X6F A;  2KON A;  2ODR D;  5LMU E;  2EMH A;  1YYK A;  3HTX A;  2L6M A;  2VF1 A;  3VHT B;  2EQ3 A;  4FK5 C;  3J80 C;  2CSH A;  2MDR A;  4RHB B;  1A1I A;  5AE1 A;  2LJH A;  3JAM C;  4YHH E;  2LMZ A;  4B3M E;  2EM4 A;  2EE8 A;  4DUY E;  1WJP A;  5A6J A;  2EP3 A;  5LL6 R;  4R2D A;  2YTQ A;  4DV6 E;  3ADG A;  2EPX A;  2K7I A;  4P78 A;  4LFC E;  4Q35 B;  2N3H A;  1G2D C;  2EN4 A;  2KHX A;  4B3T E;  1WHN A;  1PJQ A;  2EMW A;  5A6B A;  3ADJ A;  4JI8 E;  1FJG E;  2UXB E;  1PJT A;  5AC5 A;  3BGH A;  2NUF A;  4R2P A;  1SR9 A;  1YUI A;  2WZO A;  4KHP E;  2YTP A;  1KJK A;  4K0K E;  1IMU A;  5T6J A;  3HQ1 A;  2EPL X;  1N33 E;  5KL2 A;  2LBS B;  2UXC E;  2EMF A;  2GLI A;  2EPP A;  3T1H E;  2EPC A;  4HTG A;  2R1F A;  4BBY A;  2YRM A;  1X3C A;  1YFH A;  5IXM B;  3C6K A;  4B3S E;  2EMB A;  4DR5 E;  2EL4 A;  4WPY A;  4LF7 E;  1A1G A;  4M0V A;  3MSW A;  2EOX A;  4RH8 A;  3IWC A;  4TUI A;  4LF6 E;  2LJU A;  2EN3 A;  2JR1 A;  1A1K A;  2K4V A;  4BCA A;  1O0W A;  4X9J A;  2V86 A;  2YTO A;  1JK2 A;  4DV5 E;  4KZS A;  3HXL A;  3JU0 A;  4DV2 E;  1N3G A;  4JV5 E;  2EWL A;  2WBU A;  4DV1 E;  2WCC 3;  5AAS A;  2VE7 C;  4LTY A;  4LFA E;  4F6M A;  5KL7 A;  4F6N A;  1N34 E;  4M2Z A;  1BBO A;  4F9C B;  1IQO A;  2L2N A;  4L5N C;  3AV0 A;  1KYQ A;  5FLX C;  2LTR A;  3JTZ A;  2MKD A;  1LLM C;  2EPK X;  2YSO A;  1RQ0 A;  3J7A G;  3T1Y E;  1HNZ E;  2YU5 A;  4R2R A;  2DGC A;  2DMI A;  1ZR9 A;  1UN6 B;  4GKK E;  2L3J A;  3THO B;  4BHC A;  2B7V A;  4AQY E;  2NA2 A;  3AUZ A;  1PDA A;  2EOY A;  2RTX A;  2HGH A;  3C6M A;  5LMN E;  4DV4 E;  1I94 E;  2CTD A;  3MHS C;  1YYW A;  1XMQ E;  2EMZ A;  2M4I A;  4NHR A;  2EM7 A;  2F4V E; 
#chains in the Genus database with same CATH homology
 2ADR A;  2J7J A;  2EMC A;  2YTN A;  2YTQ A;  2EOE A;  2EPX A;  2M9A A;  2EPA A;  2EM2 A;  1TN9 A;  2I13 A;  2ELZ A;  1G2D C;  2EN4 A;  2LO3 A;  1YSA C;  2EOZ A;  2EOM A;  2EMW A;  1UBD C;  1Z1B A;  4R2A A;  2EN6 A;  1NCS A;  2EM0 A;  2EML A;  1TF6 A;  2MKN A;  2EN1 A;  2EOO A;  4R2P A;  1G2F C;  1RMD A;  2EOQ A;  4R2S A;  1YUI A;  2EPU A;  2YTP A;  1KJK A;  2LVH A;  2EMG A;  2JPA A;  2VRD A;  2A25 A;  1X5W A;  5KL2 A;  2LV2 A;  2EMF A;  4GZN C;  2EL6 A;  2GLI A;  2EMX A;  2EPP A;  4R2Q A;  2EL5 A;  2EPC A;  2R1F A;  2YRM A;  1X3C A;  5KL6 A;  1ZAA C;  2EMB A;  2JP9 A;  2ELY A;  2EL4 A;  2EOR A;  1BB8 A;  1A1G A;  3EPL A;  3EPH A;  1F2I G;  2EOX A;  1P47 A;  2EOI A;  2EMY A;  2EN7 A;  2YU8 A;  4F2J C;  2DLK A;  2EM9 A;  2DLQ A;  2WBT A;  2EMK A;  2EN3 A;  1A1K A;  4IJD A;  2YRK A;  2ENC A;  2EM8 A;  4R2E A;  4X9J A;  4IS1 C;  1MEY C;  2WBS A;  2YTO A;  1JK2 A;  2YTE A;  2ENH A;  2EQ1 A;  2ENA A;  1ZU1 A;  4M9V C;  2EOS A;  5KL3 A;  2EQ0 A;  5KL5 A;  2WBU A;  2D9H A;  2WCC 3;  3M99 B;  2EMI A;  2BB8 A;  1AAY A;  2EOF A;  4F6M A;  2EMA A;  5KL7 A;  2EOH A;  4F6N A;  1BBO A;  1DGC A;  2LCE A;  2YRH A;  2YTF A;  2PRT A;  2YTJ A;  2YTD A;  2EM5 A;  2MKD A;  2EPZ A;  1LLM C;  2DRP A;  1X6H A;  2YSO A;  2EJ4 A;  1YUJ A;  2RPC A;  2YTI A;  2YU5 A;  4R2R A;  2DGC A;  2DMI A;  1X6E A;  1ZR9 A;  4R2C A;  1B69 A;  1UN6 B;  2EOJ A;  3MHH C;  1A1L A;  2YTG A;  1JK1 A;  3EPK A;  2YSP A;  2RSI A;  3EPJ A;  1A1H A;  1X6F A;  1TF3 A;  2MDG A;  2EM3 A;  2EMH A;  2GHF A;  3VHT B;  2EN8 A;  2EQ3 A;  4FK5 C;  2CSH A;  4WSG A;  2EOY A;  1A1I A;  2E72 A;  1A1F A;  2EN2 A;  2CT1 A;  2HGH A;  2LT7 A;  1A1J A;  2EM4 A;  2EE8 A;  2EPR A;  2CTD A;  3MHS C;  2NAB A;  3UK3 C;  1WJP A;  2EMZ A;  2EP3 A;  2EM7 A;  4R2D A;  2EM6 A;  5KL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...