1JK2A

Zif268 d20a mutant bound to the gct dna site
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*TP*G)-3'
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk2A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk2A01
2EMWA 1TN9A 4F6MA 1WJPA 2EM4A 2EMKA 2EPPA 2EOMA 3EPLA 2YTPA 2EOHA 2EP3A 2E72A 2YU5A 3EPJA 1AAYA 2MKNA 2EM6A 2YTGA 1A1KA 2EL5A 3EPHA 2EQ1A 2YTOA 2ENHA 2EPRA 1F2IG 2M9AA 1BBOA 1DGCA 2VRDA 2EQ3A 4F2JC 4R2QA 4R2RA 2EMYA 2RSIA 2EOSA 2EMIA 2EOQA 2YTIA 2ENAA 2YU8A 1X3CA 2EPAA 2LO3A 2HGHA 2EMCA 2EMGA 2YTFA 2ELYA 2EJ4A 2EMFA 2YSPA 1X5WA 2EOOA 2YTNA 4R2EA 2MDGA 5KL6A 5KL4A 2EL6A 2EOXA 2EMLA 1A1FA 2EOEA 2EQ0A 2EOYA 1YUJA 2EN4A 2I13A 2EM5A 2EN1A 2YRKA 2EMAA 2EM2A 2JP9A 1JK1A 2J7JA 1ZAAC 4R2CA 2BB8A 2EOIA 4FK5C 2WBUA 3M99B 1P47A 2EN6A 2EM9A 2LT7A 4R2DA 2ENCA 2DGCA 2EMZA 2CTDA 1UBDC 1TF3A 1X6HA 2EM8A 2YSOA 2EMBA 1NCSA 1UN6B 2EPZA 2GHFA 1A1LA 2DLQA 1ZU1A 4R2PA 1RMDA 2EOZA 2EMXA 2YRHA 1ZR9A 2EN3A 1A1IA 2EL4A 2EPCA 2WBSA 5KL7A 2LCEA 3EPKA 4R2AA 1X6EA 2EOFA 3MHSC 2EPXA 2RPCA 4X9JA 4GZNC 1X6FA 1Z1BA 3UK3C 2EM7A 2PRTA 2EOJA 2ELZA 2D9HA 2R1FA 2YTDA 1YUIA 1A1GA 5KL5A 2YTJA 1G2FC 2EN8A 1MEYC 2EPUA 1B69A 2YTEA 2YRMA 2DLKA 2WBTA 1TF6A 1A1JA 5KL3A 4M9VC 2EN2A 5KL2A 1JK2A 4IJDA 4IS1C 1A1HA 4WSGA 2MKDA 2ADRA 2NABA 4F6NA 2CSHA 1LLMC 2EM3A 2LVHA 3VHTB 2YTQA 2DRPA 2EM0A 1BB8A 4R2SA 2CT1A 2EN7A 2EORA 2A25A 2WCC3 1YSAC 2GLIA 2LV2A 3MHHC 2EE8A 1KJKA 1G2DC 2JPAA 2EMHA 2DMIA
chains in the Genus database with same CATH superfamily
2EPKX 4BHBA 1TN9A 3H09A 2EMKA 4JI1E 5AASA 2YU5A 4DV1E 1HR0E 4DR5E 4F9BB 1SR9A 2EQ1A 2LTSA 1X47A 2M4IA 2YTOA 1STUA 4DKKA 4JV5E 3KWRA 5AE3A 2VRDA 3HPZA 2JOBA 1QNTA 4F2JC 3DF6A 2HHHE 2EWLA 2EOSA 2EMIA 2EOQA 2E1MA 1X3CA 2LO3A 3AUZA 5LLQA 4DUYE 2EMCA 2V86A 1N34E 3HXLA 2ELYA 4NXME 2N3HA 3JU0A 2EOOA 2DMYA 5KL6A 2EMLA 2NUEA 4DV0E 3VYXA 2EOYA 2JOXA 2N8XA 5ADZA 1PJSA 3DJWA 1ZBTA 2EN1A 5IV8B 1PJQA 2YRKA 2EMAA 1GQEA 3LLHA 2VF1A 3HQ1A 2F8BA 4R2CA 4LF4E 4BHCA 1I94E 4FK5C 4DR7E 4DR3E 2WBUA 2EN6A 2EM9A 5A6JA 3FIGA 1QU6A 2BBGA 4HTGA 4KHPE 2UXCE 1UN6B 3HPSA 2HC5A 1PKPA 2LUPB 1A1LA 4WYQB 3C4BA 4R2PA 3F6GA 4ZYDA 2EOZA 2B7VA 2EN3A 1GZ6A 1PDAA 2EL4A 2EPCA 2LE2A 2EOFA 2EPXA 2RPCA 4X9JA 5AC5A 4GZNC 2PRTA 2EOJA 2LJUA 2JWOA 2ZM6E 1A1GA 2GPIA 2YTJA 4RH8A 3BBGA 1G2FC 4B3TE 1N36E 1YZ9A 1MEYC 5T6JA 3ADGA 2YRMA 4K0KE 2L3CA 4LFBE 3ECRA 3EQ1A 2CSHA 2DRPA 1BB8A 2B3TB 2EN7A 4O24A 3MHHC 2FV4B 3QG5C 1KJKA 2JPAA 2EMHA 2EMWA 2JY9A 4F6MA 5A6BA 2EPPA 2EOMA 2YTPA 2E72A 2YTGA 4ZYGA 2UUAE 2E5LE 1YYOA 1O0WA 2DB2A 4R03A 2EZ6A 5LMNE 4DV7E 2M9AA 1N33E 2R76A 3J81C 1BBOA 2L92A 2Q8UA 3JTZA 4JI4E 1YYWA 2EPMX 4RHBB 3ADJA 2EMYA 2EMGA 2EJ4A 1X5WA 2IHR1 4WX9A 1IQSA 2EL6A 4DMIA 2EOEA 3C6KA 2YWQA 2VQFE 1X48A 4JI3E 1IMUA 3IWDA 3J80C 2V8QB 5AC4A 1JK1A 1WRJA 1RQ0A 5BR8E 2LTRA 2EPNA 2LUQA 4J8ZA 1RC7A 1IBME 3M99B 4B3SE 1HNWE 4R2DA 2EMZA 1UBDC 1TF3A 1NCSA 1YYKA 5CFFE 2EPZA 2GHFA 1J5EE 1L4SA 2DLQA 1IBLE 2K7IA 4DR1E 1ZR9A 1A1IA 1T4NA 2L8TA 4NXNE 4WXDA 5AE2A 2WBSA 4KZSA 4LF7E 3TQMA 5KL7A 1X6EA 4P78A 3UK3C 2EM7A 2I9IA 2JXPA 4BBYA 2YTDA 2YZTA 1XMOE 2EN8A 2YTEA 1TF6A 5KL3A 4N4RB 2NA2A 4X64E 4YY3E 4IJDA 4IS1C 2RSMA 5LMUE 2YTQA 4X66E 2MDRA 5IT9C 4F9AB 5TSEA 2EORA 5IXMB 3T1YE 2LV2A 2EPLX 4B3RE 2ODRC 4MLQA 2V89A 4TUGA 2MC6A 4O4KA 2DMIA 4LF6E 4DV5E 1X49A 1WHQA 2UU9E 1WJPA 3EPLA 2MKNA 2CPNA 3J7AG 3BGHA 4YHHE 1A1KA 2EL5A 3IWCA 2B9DA 4M0VA 1N3GA 2ENHA 5AE1A 4Q28A 1DGCA 4NZVA 2EQ3A 2YT4A 4R2QA 4R2RA 4TUIA 2M7QA 2V85A 4AQYE 2YTIA 2ENAA 2EPAA 4ZYHA 2L6MA 3K6QA 2LBSB 4LFCE 2V88A 2YSPA 3MSWA 4R2EA 2MDGA 5KL4A 5LL6R 3KZYA 4X8WA 2EOXA 1EH7A 1XNRE 3C4TA 3ADIA 2EQ0A 1AH5A 1YUJA 2LMZA 2YPNA 1KYQA 2EN4A 2I13A 1YPNA 2EM5A 3OTOE 4DUZE 4OOGC 5DNYA 2FTXB 2JVAA 4GKJE 2WZOA 4WFTA 2EM2A 2L2NA 3HTXA 4DR6E 3OMLA 2KOUA 2J7JA 1ZAAC 2NUFA 3JAMC 4M2ZA 2H36X 4F9CB 2LT7A 2RTXA 1X6HA 3THNA 4BS9A 1ZU1A 1RMDA 2F4VE 5A6BD 2V87A 2B7TA 3AV0A 4GKKE 1DI2A 2M1SA 3THOB 5A6KA 4BCAA 4WSPA 4OX9E 2LCEA 4DV2E 1Z1BA 2UXDE 1MGTA 2RS7A 5F3WA 4O43A 4LF8E 2D9HA 1YUIA 2DIXA 1WXRA 1EH8A 1B69A 2KHXA 4LF9E 1A1JA 5KL2A 4WSGA 4DR4E 5A6AA 2ADRA 1T39A 3KZZA 1XNQE 1LLMC 2LVHA 3VHTB 4ZYEA 4R2SA 2CT1A 4Q35B 2WCC3 5A2QC 1IQOA 2EE8A 3BIDA 1N32E 4JI5E 1J26A 2EPOA 1G2DC 2YSOA 2RS6A 1EKZA 2EM4A 1AAYA 2EP3A 2EOHA 3EPJA 3IWBA 2VQEE 2EM6A 3ZOQB 2V83A 3EPHA 3BF2A 2EPRA 3C6MA 1SFEA 1F2IG 4LTYA 4LU9A 2LJHA 1UILA 1XMQE 1ZBQA 5FLXC 4WPYA 2RSIA 2L2KB 4DR2E 4LF5E 2YU8A 2HGHA 2NUGA 2YTFA 2HJJA 2JR1A 2EMFA 2ODRD 2YTNA 2G7HA 4BC7A 4X62E 2UUCE 1A1FA 1T38A 4X65E 1FJGE 1T4OA 4P7DA 4HEIA 2FGGA 4JYAE 4KWYA 2L33A 4DV6E 2K4VA 2JP9A 4GEQB 3L00A 2BB8A 1GTKA 2EOIA 1BBGA 4NHRA 1P47A 4DV3E 3RMPA 3T1HE 3F6HA 3LMLA 2VE7C 4I8OA 2ENCA 2DGCA 2CTDA 2RQLA 4L5NC 2EM8A 3ADLA 2EMBA 1IBKE 2LRSA 4B3ME 4JI7E 4WXCA 2DSYA 1NEIA 2KONA 2UUBE 2EMXA 4MLVA 2YRHA 1WHNA 4JI0E 4LFAE 4BMJA 3P1XA 3EPKA 4R2AA 3MHSC 4BC9A 1X6FA 1T4LB 2ELZA 1HNXE 2R1FA 3VYYA 1PJTA 1YFHA 3J7Yp 5KL5A 2L2MA 4M30A 4F54A 2EPUA 2N3GA 2DLKA 1UHZA 4L8NA 2MC5A 2WBTA 5IWAE 4M9VC 4JI2E 2EN2A 1JK2A 1A1HA 2MKDA 4JI8E 2NABA 4F6NA 1DQ3A 2L3JA 2EM3A 1FKAE 4JI6E 5A69A 2EM0A 3VK6A 4R8OA 2JYAA 1HNZE 4DV4E 2A25A 1YSAC 2GLIA 2UXBE 4O5GA 1EH6A
chains in the Genus database with same CATH topology
2EMWA 1TN9A 4F6MA 1WJPA 2EM4A 2EMKA 2EPPA 2EOMA 3EPLA 2YTPA 2EOHA 2EP3A 2E72A 2YU5A 3EPJA 1AAYA 2MKNA 2EM6A 2YTGA 1A1KA 2EL5A 3EPHA 2EQ1A 2YTOA 2ENHA 2EPRA 1F2IG 2M9AA 1BBOA 1DGCA 2VRDA 2EQ3A 4F2JC 4R2QA 4R2RA 2EMYA 2RSIA 2EOSA 2EMIA 2EOQA 2YTIA 2ENAA 2YU8A 1X3CA 2EPAA 2LO3A 2HGHA 2EMCA 2EMGA 2YTFA 2ELYA 2EJ4A 2EMFA 2YSPA 1X5WA 2EOOA 2YTNA 4R2EA 2MDGA 5KL6A 5KL4A 2EL6A 2EOXA 2EMLA 1A1FA 2EOEA 2EQ0A 2EOYA 1YUJA 2EN4A 2I13A 2EM5A 2EN1A 2YRKA 2EMAA 2EM2A 2JP9A 1JK1A 2J7JA 1ZAAC 4R2CA 2BB8A 2EOIA 4FK5C 2WBUA 3M99B 1P47A 2EN6A 2EM9A 2LT7A 4R2DA 2ENCA 2DGCA 2EMZA 2CTDA 1UBDC 1TF3A 1X6HA 2EM8A 2YSOA 2EMBA 1NCSA 1UN6B 2EPZA 2GHFA 1A1LA 2DLQA 1ZU1A 4R2PA 1RMDA 2EOZA 2EMXA 2YRHA 1ZR9A 2EN3A 1A1IA 2EL4A 2EPCA 2WBSA 5KL7A 2LCEA 3EPKA 4R2AA 1X6EA 2EOFA 3MHSC 2EPXA 2RPCA 4X9JA 4GZNC 1X6FA 1Z1BA 3UK3C 2EM7A 2PRTA 2EOJA 2ELZA 2D9HA 2R1FA 2YTDA 1YUIA 1A1GA 5KL5A 2YTJA 1G2FC 2EN8A 1MEYC 2EPUA 1B69A 2YTEA 2YRMA 2DLKA 2WBTA 1TF6A 1A1JA 5KL3A 4M9VC 2EN2A 5KL2A 1JK2A 4IJDA 4IS1C 1A1HA 4WSGA 2MKDA 2ADRA 2NABA 4F6NA 2CSHA 1LLMC 2EM3A 2LVHA 3VHTB 2YTQA 2DRPA 2EM0A 1BB8A 4R2SA 2CT1A 2EN7A 2EORA 2A25A 2WCC3 1YSAC 2GLIA 2LV2A 3MHHC 2EE8A 1KJKA 1G2DC 2JPAA 2EMHA 2DMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMW A;  1TN9 A;  4F6M A;  1WJP A;  2EM4 A;  2EMK A;  2EPP A;  2EOM A;  3EPL A;  2YTP A;  2EOH A;  2EP3 A;  2E72 A;  2YU5 A;  3EPJ A;  1AAY A;  2MKN A;  2EM6 A;  2YTG A;  1A1K A;  2EL5 A;  3EPH A;  2EQ1 A;  2YTO A;  2ENH A;  2EPR A;  1F2I G;  2M9A A;  1BBO A;  1DGC A;  2VRD A;  2EQ3 A;  4F2J C;  4R2Q A;  4R2R A;  2EMY A;  2RSI A;  2EOS A;  2EMI A;  2EOQ A;  2YTI A;  2ENA A;  2YU8 A;  1X3C A;  2EPA A;  2LO3 A;  2HGH A;  2EMC A;  2EMG A;  2YTF A;  2ELY A;  2EJ4 A;  2EMF A;  2YSP A;  1X5W A;  2EOO A;  2YTN A;  4R2E A;  2MDG A;  5KL6 A;  5KL4 A;  2EL6 A;  2EOX A;  2EML A;  1A1F A;  2EOE A;  2EQ0 A;  2EOY A;  1YUJ A;  2EN4 A;  2I13 A;  2EM5 A;  2EN1 A;  2YRK A;  2EMA A;  2EM2 A;  2JP9 A;  1JK1 A;  2J7J A;  1ZAA C;  4R2C A;  2BB8 A;  2EOI A;  4FK5 C;  2WBU A;  3M99 B;  1P47 A;  2EN6 A;  2EM9 A;  2LT7 A;  4R2D A;  2ENC A;  2DGC A;  2EMZ A;  2CTD A;  1UBD C;  1TF3 A;  1X6H A;  2EM8 A;  2YSO A;  2EMB A;  1NCS A;  1UN6 B;  2EPZ A;  2GHF A;  1A1L A;  2DLQ A;  1ZU1 A;  4R2P A;  1RMD A;  2EOZ A;  2EMX A;  2YRH A;  1ZR9 A;  2EN3 A;  1A1I A;  2EL4 A;  2EPC A;  2WBS A;  5KL7 A;  2LCE A;  3EPK A;  4R2A A;  1X6E A;  2EOF A;  3MHS C;  2EPX A;  2RPC A;  4X9J A;  4GZN C;  1X6F A;  1Z1B A;  3UK3 C;  2EM7 A;  2PRT A;  2EOJ A;  2ELZ A;  2D9H A;  2R1F A;  2YTD A;  1YUI A;  1A1G A;  5KL5 A;  2YTJ A;  1G2F C;  2EN8 A;  1MEY C;  2EPU A;  1B69 A;  2YTE A;  2YRM A;  2DLK A;  2WBT A;  1TF6 A;  1A1J A;  5KL3 A;  4M9V C;  2EN2 A;  5KL2 A;  1JK2 A;  4IJD A;  4IS1 C;  1A1H A;  4WSG A;  2MKD A;  2ADR A;  2NAB A;  4F6N A;  2CSH A;  1LLM C;  2EM3 A;  2LVH A;  3VHT B;  2YTQ A;  2DRP A;  2EM0 A;  1BB8 A;  4R2S A;  2CT1 A;  2EN7 A;  2EOR A;  2A25 A;  2WCC 3;  1YSA C;  2GLI A;  2LV2 A;  3MHH C;  2EE8 A;  1KJK A;  1G2D C;  2JPA A;  2EMH A;  2DMI A; 
#chains in the Genus database with same CATH topology
 2EPK X;  4BHB A;  1TN9 A;  3H09 A;  2EMK A;  4JI1 E;  5AAS A;  2YU5 A;  4DV1 E;  1HR0 E;  4DR5 E;  4F9B B;  1SR9 A;  2EQ1 A;  2LTS A;  1X47 A;  2M4I A;  2YTO A;  1STU A;  4DKK A;  4JV5 E;  3KWR A;  5AE3 A;  2VRD A;  3HPZ A;  2JOB A;  1QNT A;  4F2J C;  3DF6 A;  2HHH E;  2EWL A;  2EOS A;  2EMI A;  2EOQ A;  2E1M A;  1X3C A;  2LO3 A;  3AUZ A;  5LLQ A;  4DUY E;  2EMC A;  2V86 A;  1N34 E;  3HXL A;  2ELY A;  4NXM E;  2N3H A;  3JU0 A;  2EOO A;  2DMY A;  5KL6 A;  2EML A;  2NUE A;  4DV0 E;  3VYX A;  2EOY A;  2JOX A;  2N8X A;  5ADZ A;  1PJS A;  3DJW A;  1ZBT A;  2EN1 A;  5IV8 B;  1PJQ A;  2YRK A;  2EMA A;  1GQE A;  3LLH A;  2VF1 A;  3HQ1 A;  2F8B A;  4R2C A;  4LF4 E;  4BHC A;  1I94 E;  4FK5 C;  4DR7 E;  4DR3 E;  2WBU A;  2EN6 A;  2EM9 A;  5A6J A;  3FIG A;  1QU6 A;  2BBG A;  4HTG A;  4KHP E;  2UXC E;  1UN6 B;  3HPS A;  2HC5 A;  1PKP A;  2LUP B;  1A1L A;  4WYQ B;  3C4B A;  4R2P A;  3F6G A;  4ZYD A;  2EOZ A;  2B7V A;  2EN3 A;  1GZ6 A;  1PDA A;  2EL4 A;  2EPC A;  2LE2 A;  2EOF A;  2EPX A;  2RPC A;  4X9J A;  5AC5 A;  4GZN C;  2PRT A;  2EOJ A;  2LJU A;  2JWO A;  2ZM6 E;  1A1G A;  2GPI A;  2YTJ A;  4RH8 A;  3BBG A;  1G2F C;  4B3T E;  1N36 E;  1YZ9 A;  1MEY C;  5T6J A;  3ADG A;  2YRM A;  4K0K E;  2L3C A;  4LFB E;  3ECR A;  3EQ1 A;  2CSH A;  2DRP A;  1BB8 A;  2B3T B;  2EN7 A;  4O24 A;  3MHH C;  2FV4 B;  3QG5 C;  1KJK A;  2JPA A;  2EMH A;  2EMW A;  2JY9 A;  4F6M A;  5A6B A;  2EPP A;  2EOM A;  2YTP A;  2E72 A;  2YTG A;  4ZYG A;  2UUA E;  2E5L E;  1YYO A;  1O0W A;  2DB2 A;  4R03 A;  2EZ6 A;  5LMN E;  4DV7 E;  2M9A A;  1N33 E;  2R76 A;  3J81 C;  1BBO A;  2L92 A;  2Q8U A;  3JTZ A;  4JI4 E;  1YYW A;  2EPM X;  4RHB B;  3ADJ A;  2EMY A;  2EMG A;  2EJ4 A;  1X5W A;  2IHR 1;  4WX9 A;  1IQS A;  2EL6 A;  4DMI A;  2EOE A;  3C6K A;  2YWQ A;  2VQF E;  1X48 A;  4JI3 E;  1IMU A;  3IWD A;  3J80 C;  2V8Q B;  5AC4 A;  1JK1 A;  1WRJ A;  1RQ0 A;  5BR8 E;  2LTR A;  2EPN A;  2LUQ A;  4J8Z A;  1RC7 A;  1IBM E;  3M99 B;  4B3S E;  1HNW E;  4R2D A;  2EMZ A;  1UBD C;  1TF3 A;  1NCS A;  1YYK A;  5CFF E;  2EPZ A;  2GHF A;  1J5E E;  1L4S A;  2DLQ A;  1IBL E;  2K7I A;  4DR1 E;  1ZR9 A;  1A1I A;  1T4N A;  2L8T A;  4NXN E;  4WXD A;  5AE2 A;  2WBS A;  4KZS A;  4LF7 E;  3TQM A;  5KL7 A;  1X6E A;  4P78 A;  3UK3 C;  2EM7 A;  2I9I A;  2JXP A;  4BBY A;  2YTD A;  2YZT A;  1XMO E;  2EN8 A;  2YTE A;  1TF6 A;  5KL3 A;  4N4R B;  2NA2 A;  4X64 E;  4YY3 E;  4IJD A;  4IS1 C;  2RSM A;  5LMU E;  2YTQ A;  4X66 E;  2MDR A;  5IT9 C;  4F9A B;  5TSE A;  2EOR A;  5IXM B;  3T1Y E;  2LV2 A;  2EPL X;  4B3R E;  2ODR C;  4MLQ A;  2V89 A;  4TUG A;  2MC6 A;  4O4K A;  2DMI A;  4LF6 E;  4DV5 E;  1X49 A;  1WHQ A;  2UU9 E;  1WJP A;  3EPL A;  2MKN A;  2CPN A;  3J7A G;  3BGH A;  4YHH E;  1A1K A;  2EL5 A;  3IWC A;  2B9D A;  4M0V A;  1N3G A;  2ENH A;  5AE1 A;  4Q28 A;  1DGC A;  4NZV A;  2EQ3 A;  2YT4 A;  4R2Q A;  4R2R A;  4TUI A;  2M7Q A;  2V85 A;  4AQY E;  2YTI A;  2ENA A;  2EPA A;  4ZYH A;  2L6M A;  3K6Q A;  2LBS B;  4LFC E;  2V88 A;  2YSP A;  3MSW A;  4R2E A;  2MDG A;  5KL4 A;  5LL6 R;  3KZY A;  4X8W A;  2EOX A;  1EH7 A;  1XNR E;  3C4T A;  3ADI A;  2EQ0 A;  1AH5 A;  1YUJ A;  2LMZ A;  2YPN A;  1KYQ A;  2EN4 A;  2I13 A;  1YPN A;  2EM5 A;  3OTO E;  4DUZ E;  4OOG C;  5DNY A;  2FTX B;  2JVA A;  4GKJ E;  2WZO A;  4WFT A;  2EM2 A;  2L2N A;  3HTX A;  4DR6 E;  3OML A;  2KOU A;  2J7J A;  1ZAA C;  2NUF A;  3JAM C;  4M2Z A;  2H36 X;  4F9C B;  2LT7 A;  2RTX A;  1X6H A;  3THN A;  4BS9 A;  1ZU1 A;  1RMD A;  2F4V E;  5A6B D;  2V87 A;  2B7T A;  3AV0 A;  4GKK E;  1DI2 A;  2M1S A;  3THO B;  5A6K A;  4BCA A;  4WSP A;  4OX9 E;  2LCE A;  4DV2 E;  1Z1B A;  2UXD E;  1MGT A;  2RS7 A;  5F3W A;  4O43 A;  4LF8 E;  2D9H A;  1YUI A;  2DIX A;  1WXR A;  1EH8 A;  1B69 A;  2KHX A;  4LF9 E;  1A1J A;  5KL2 A;  4WSG A;  4DR4 E;  5A6A A;  2ADR A;  1T39 A;  3KZZ A;  1XNQ E;  1LLM C;  2LVH A;  3VHT B;  4ZYE A;  4R2S A;  2CT1 A;  4Q35 B;  2WCC 3;  5A2Q C;  1IQO A;  2EE8 A;  3BID A;  1N32 E;  4JI5 E;  1J26 A;  2EPO A;  1G2D C;  2YSO A;  2RS6 A;  1EKZ A;  2EM4 A;  1AAY A;  2EP3 A;  2EOH A;  3EPJ A;  3IWB A;  2VQE E;  2EM6 A;  3ZOQ B;  2V83 A;  3EPH A;  3BF2 A;  2EPR A;  3C6M A;  1SFE A;  1F2I G;  4LTY A;  4LU9 A;  2LJH A;  1UIL A;  1XMQ E;  1ZBQ A;  5FLX C;  4WPY A;  2RSI A;  2L2K B;  4DR2 E;  4LF5 E;  2YU8 A;  2HGH A;  2NUG A;  2YTF A;  2HJJ A;  2JR1 A;  2EMF A;  2ODR D;  2YTN A;  2G7H A;  4BC7 A;  4X62 E;  2UUC E;  1A1F A;  1T38 A;  4X65 E;  1FJG E;  1T4O A;  4P7D A;  4HEI A;  2FGG A;  4JYA E;  4KWY A;  2L33 A;  4DV6 E;  2K4V A;  2JP9 A;  4GEQ B;  3L00 A;  2BB8 A;  1GTK A;  2EOI A;  1BBG A;  4NHR A;  1P47 A;  4DV3 E;  3RMP A;  3T1H E;  3F6H A;  3LML A;  2VE7 C;  4I8O A;  2ENC A;  2DGC A;  2CTD A;  2RQL A;  4L5N C;  2EM8 A;  3ADL A;  2EMB A;  1IBK E;  2LRS A;  4B3M E;  4JI7 E;  4WXC A;  2DSY A;  1NEI A;  2KON A;  2UUB E;  2EMX A;  4MLV A;  2YRH A;  1WHN A;  4JI0 E;  4LFA E;  4BMJ A;  3P1X A;  3EPK A;  4R2A A;  3MHS C;  4BC9 A;  1X6F A;  1T4L B;  2ELZ A;  1HNX E;  2R1F A;  3VYY A;  1PJT A;  1YFH A;  3J7Y p;  5KL5 A;  2L2M A;  4M30 A;  4F54 A;  2EPU A;  2N3G A;  2DLK A;  1UHZ A;  4L8N A;  2MC5 A;  2WBT A;  5IWA E;  4M9V C;  4JI2 E;  2EN2 A;  1JK2 A;  1A1H A;  2MKD A;  4JI8 E;  2NAB A;  4F6N A;  1DQ3 A;  2L3J A;  2EM3 A;  1FKA E;  4JI6 E;  5A69 A;  2EM0 A;  3VK6 A;  4R8O A;  2JYA A;  1HNZ E;  4DV4 E;  2A25 A;  1YSA C;  2GLI A;  2UXB E;  4O5G A;  1EH6 A; 
#chains in the Genus database with same CATH homology
 2EMW A;  1TN9 A;  4F6M A;  1WJP A;  2EM4 A;  2EMK A;  2EPP A;  2EOM A;  3EPL A;  2YTP A;  2EOH A;  2EP3 A;  2E72 A;  2YU5 A;  3EPJ A;  1AAY A;  2MKN A;  2EM6 A;  2YTG A;  1A1K A;  2EL5 A;  3EPH A;  2EQ1 A;  2YTO A;  2ENH A;  2EPR A;  1F2I G;  2M9A A;  1BBO A;  1DGC A;  2VRD A;  2EQ3 A;  4F2J C;  4R2Q A;  4R2R A;  2EMY A;  2RSI A;  2EOS A;  2EMI A;  2EOQ A;  2YTI A;  2ENA A;  2YU8 A;  1X3C A;  2EPA A;  2LO3 A;  2HGH A;  2EMC A;  2EMG A;  2YTF A;  2ELY A;  2EJ4 A;  2EMF A;  2YSP A;  1X5W A;  2EOO A;  2YTN A;  4R2E A;  2MDG A;  5KL6 A;  5KL4 A;  2EL6 A;  2EOX A;  2EML A;  1A1F A;  2EOE A;  2EQ0 A;  2EOY A;  1YUJ A;  2EN4 A;  2I13 A;  2EM5 A;  2EN1 A;  2YRK A;  2EMA A;  2EM2 A;  2JP9 A;  1JK1 A;  2J7J A;  1ZAA C;  4R2C A;  2BB8 A;  2EOI A;  4FK5 C;  2WBU A;  3M99 B;  1P47 A;  2EN6 A;  2EM9 A;  2LT7 A;  4R2D A;  2ENC A;  2DGC A;  2EMZ A;  2CTD A;  1UBD C;  1TF3 A;  1X6H A;  2EM8 A;  2YSO A;  2EMB A;  1NCS A;  1UN6 B;  2EPZ A;  2GHF A;  1A1L A;  2DLQ A;  1ZU1 A;  4R2P A;  1RMD A;  2EOZ A;  2EMX A;  2YRH A;  1ZR9 A;  2EN3 A;  1A1I A;  2EL4 A;  2EPC A;  2WBS A;  5KL7 A;  2LCE A;  3EPK A;  4R2A A;  1X6E A;  2EOF A;  3MHS C;  2EPX A;  2RPC A;  4X9J A;  4GZN C;  1X6F A;  1Z1B A;  3UK3 C;  2EM7 A;  2PRT A;  2EOJ A;  2ELZ A;  2D9H A;  2R1F A;  2YTD A;  1YUI A;  1A1G A;  5KL5 A;  2YTJ A;  1G2F C;  2EN8 A;  1MEY C;  2EPU A;  1B69 A;  2YTE A;  2YRM A;  2DLK A;  2WBT A;  1TF6 A;  1A1J A;  5KL3 A;  4M9V C;  2EN2 A;  5KL2 A;  1JK2 A;  4IJD A;  4IS1 C;  1A1H A;  4WSG A;  2MKD A;  2ADR A;  2NAB A;  4F6N A;  2CSH A;  1LLM C;  2EM3 A;  2LVH A;  3VHT B;  2YTQ A;  2DRP A;  2EM0 A;  1BB8 A;  4R2S A;  2CT1 A;  2EN7 A;  2EOR A;  2A25 A;  2WCC 3;  1YSA C;  2GLI A;  2LV2 A;  3MHH C;  2EE8 A;  1KJK A;  1G2D C;  2JPA A;  2EMH A;  2DMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...