1JK2A

Zif268 d20a mutant bound to the gct dna site
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*TP*G)-3'
publication title Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk2A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk2A01
2EOSA 2EM7A 3EPLA 1X6FA 4F6MA 2EOYA 4R2CA 2EMWA 1F2IG 2EPZA 2VRDA 2YRKA 1RMDA 2EM6A 1BB8A 2EMCA 2YTJA 2EMHA 2EL6A 2YRHA 2EMIA 1NCSA 2YTNA 3UK3C 2CSHA 2ELYA 2EM0A 2WBTA 2YTGA 1YUIA 1X3CA 2YTPA 1G2FC 2MKNA 1KJKA 1JK1A 1MEYC 1YSAC 2A25A 2D9HA 2EOXA 3MHHC 1Z1BA 2WBSA 4IS1C 2YSOA 4GZNC 2EPCA 1ZU1A 2CT1A 2EPUA 2DMIA 2YTDA 5KL3A 4R2QA 1A1IA 2LO3A 2JPAA 2RPCA 4R2DA 2EN7A 1AAYA 2NABA 5KL2A 1JK2A 2EN6A 3EPHA 4R2SA 2LT7A 3EPJA 1BBOA 2EOEA 2YTEA 4WSGA 2EN4A 2MKDA 2EMAA 1WJPA 2EMZA 3M99B 1X6HA 4FK5C 2EPPA 1ZAAC 2EM2A 4X9JA 1YUJA 2EPRA 2EPXA 4M9VC 2EMKA 2ENAA 2YU5A 4R2PA 2EN1A 2YRMA 5KL5A 2J7JA 2EN8A 2DLKA 2CTDA 2EMXA 2DRPA 1B69A 2EOHA 4R2EA 1P47A 2RSIA 2E72A 2EMFA 2WCC3 2DLQA 1X6EA 2EOJA 3MHSC 3EPKA 4F6NA 2EOIA 1A1HA 2EM8A 2PRTA 4F2JC 2LCEA 2EM9A 2EQ3A 2YU8A 1A1FA 2EN2A 2ENCA 2EOFA 2MDGA 2ENHA 4R2RA 1UN6B 2EOMA 2R1FA 2EN3A 2YTFA 1UBDC 3VHTB 1TN9A 1TF6A 2WBUA 2EMBA 2EPAA 2EE8A 2BB8A 2I13A 1X5WA 2M9AA 2LV2A 1A1LA 1G2DC 1LLMC 2YTIA 2EL4A 5KL7A 2EMGA 2EJ4A 2JP9A 2LVHA 4IJDA 2EM5A 2YSPA 5KL4A 2EQ0A 2EL5A 4R2AA 2ADRA 2GHFA 2EOQA 2EORA 2EMLA 1A1KA 1ZR9A 1TF3A 2YTQA 2YTOA 2ELZA 1DGCA 5KL6A 2HGHA 2DGCA 2EP3A 2EM3A 2GLIA 2EM4A 1A1JA 2EMYA 2EQ1A 1A1GA 2EOOA 2EOZA
chains in the Genus database with same CATH superfamily
3C4TA 2EOSA 2EM7A 1XNRE 1MGTA 1J26A 2GPIA 1T4NA 4DV6E 2EPNA 4LF4E 2EPZA 4N4RB 1N34E 1RMDA 1ZBTA 2YTJA 2EMIA 1NCSA 1YUIA 3F6GA 1X3CA 3LMLA 2MKNA 1MEYC 4X65E 2R76A 1Z1BA 4IS1C 2E1MA 2DSYA 2WZOA 4M30A 2FTXB 2YPNA 1L4SA 1PJSA 5IXMB 2DMIA 2VQFE 2LO3A 4M0VA 4R2DA 3MSWA 1AAYA 2LMZA 3ECRA 3HPZA 1BBOA 2LRSA 2YTEA 2EN4A 1X6HA 2EPRA 3IWCA 3C6KA 3THOB 2YU5A 4R2PA 2EN1A 4DR7E 1T4OA 2J7JA 2EN8A 2NUFA 2NUGA 3OMLA 3ADJA 4P78A 1YPNA 1P47A 2RSIA 4BMJA 2EOJA 4O43A 1RQ0A 4JI6E 2FGGA 4JYAE 1A1HA 2EM8A 2V86A 2PRTA 2KONA 1A1FA 2ZM6E 2EOFA 2ENHA 2N3HA 1EH6A 1N33E 1DI2A 1TF6A 2EPAA 2V87A 1LLMC 1UHZA 5KL7A 2EJ4A 1XNQE 4DV1E 4DR5E 3HXLA 4LFAE 3RMPA 2YT4A 3T1YE 4ZYDA 2EORA 2EMLA 2L2NA 2ELZA 1YYOA 1DGCA 4OOGC 1YYWA 5KL6A 5LLQA 4JI0E 4MLQA 2EM3A 2GLIA 2EMYA 4TUGA 4BC9A 2EQ1A 4AQYE 3BBGA 5ADZA 1X48A 2EOYA 3HTXA 2VF1A 2L8TA 3VK6A 4GKKE 4HTGA 2EMWA 2KOUA 1F2IG 1IQSA 5AASA 4Q35B 2UU9E 4YY3E 2YRKA 3LLHA 2JOBA 2EM6A 2MC5A 3DF6A 2EMCA 3TQMA 1IMUA 2RS6A 5BR8E 1PKPA 2YRHA 4WX9A 3UK3C 1IBKE 2YTPA 1KJKA 2A25A 3MHHC 2LJUA 2M1SA 3AV0A 2WBSA 5F3WA 2UUCE 3EQ1A 4R03A 2YSOA 1IBME 2EPUA 2YTDA 4R2QA 2VQEE 1DQ3A 2B9DA 2LTSA 4DV2E 4K0KE 1RC7A 2NABA 1KYQA 1JK2A 3EPHA 2N3GA 2MKDA 4DUZE 2EMZA 4FK5C 3L00A 2EM2A 1YUJA 2EMKA 2JY9A 2YRMA 1HNZE 2EMXA 4ZYGA 2DRPA 1B69A 1O0WA 1GTKA 2ODRC 2EMFA 2WCC3 2UXDE 2F8BA 3EPKA 4F6NA 4P7DA 5AC4A 2JWOA 4DV7E 2EQ3A 2K4VA 3BF2A 4J8ZA 2V83A 4WFTA 3VHTB 2RTXA 2EMBA 4RH8A 1A1LA 1HR0E 1N32E 1WXRA 2UXBE 2YWQA 4DKKA 2L3CA 2EMGA 1YFHA 2LVHA 4IJDA 5LMUE 4B3TE 4JI4E 2EM5A 4BCAA 2EZ6A 1EH7A 4NHRA 2YSPA 4DV3E 4DR2E 4NXNE 2JR1A 3H09A 2EL5A 1STUA 4R2AA 2GHFA 2FV4B 4R8OA 4JI5E 2B7VA 1TF3A 2RS7A 2YTQA 2YTOA 4ZYHA 1XMQE 1EKZA 4LTYA 4LF6E 1X49A 2IHR1 2M4IA 3KZZA 3VYYA 1IBLE 4B3ME 1N3GA 3IWBA 1SFEA 2EOZA 5CFFE 2H36X 2JVAA 5FLXC 3EPLA 2EPOA 3KZYA 3P1XA 2G7HA 1QNTA 2DB2A 3IWDA 5AE3A 2KHXA 4NXME 5AE1A 4YHHE 1BB8A 4B3RE 5DNYA 3C6MA 2V8QB 3J7AG 4JV5E 2EL6A 3JTZA 4LF8E 5A6JA 2UUBE 2YTNA 2CSHA 2WBTA 2YTGA 4JI7E 4HEIA 1G2FC 1GQEA 1SR9A 2D9HA 2EOXA 2VE7C 1YZ9A 3J81C 5A6BA 1T38A 4GZNC 3J80C 3BIDA 1ZU1A 2EPMX 4DR4E 4M2ZA 4F9AB 1A1IA 2HC5A 2JPAA 2RPCA 3HPSA 1J5EE 2LUQA 2I9IA 4WXCA 2JYAA 2EOEA 2DIXA 4WSGA 5A6BD 5AE2A 1HNWE 3M99B 2MC6A 4WSPA 1PJTA 2EPKX 4X64E 2EPPA 2CPNA 5A69A 4X9JA 2K7IA 2L33A 2ENAA 4JI8E 2L92A 2HJJA 2JXPA 2LJHA 5LMNE 4B3SE 4ZYEA 4BHCA 4MLVA 2CTDA 4WPYA 2B7TA 4DUYE 4F54A 4LF9E 1I94E 2EWLA 4F2JC 1BBGA 2EM9A 4BS9A 3THNA 2YU8A 2EN2A 2MDGA 2JOXA 3OTOE 4R2RA 2EOMA 2R1FA 2EN3A 4L5NC 4WYQB 2YTFA 4DMIA 1FKAE 2BB8A 1X5WA 2M9AA 2LV2A 2L3JA 2LTRA 4LFBE 4LF5E 2EL4A 2EPLX 3DJWA 2JP9A 4BHBA 1WRJA 3C4BA 2EQ0A 5T6JA 4RHBB 3ADLA 1EH8A 2ADRA 2EOQA 5IWAE 1HNXE 3K6QA 2V85A 5A6AA 1A1KA 1XMOE 2Q8UA 2E5LE 2UXCE 3VYXA 3HQ1A 4DR3E 2HGHA 4L8NA 2EP3A 2BBGA 1WHQA 2L2MA 2YZTA 4X66E 2EM4A 2LE2A 3T1HE 1T39A 4NZVA 4O24A 4KHPE 1X6FA 1N36E 4LFCE 4F6MA 4R2CA 2L6MA 3QG5C 1FJGE 1YYKA 2B3TB 2VRDA 4OX9E 5IV8B 4KWYA 1ZBQA 2EMHA 3KWRA 4X8WA 5A2QC 2RSMA 2ELYA 2EM0A 3ADGA 5TSEA 5A6KA 3J7Yp 1JK1A 4O4KA 1YSAC 4DV4E 3BGHA 3FIGA 4DR1E 2EPCA 1IQOA 2UUAE 2CT1A 4DV0E 5KL3A 1NEIA 2EN7A 4F9CB 5KL2A 2EN6A 4R2SA 2LT7A 3EPJA 1WHNA 1T4LB 1X47A 1WJPA 2EMAA 1AH5A 4DR6E 1ZAAC 2EPXA 4M9VC 2M7QA 4TUIA 2N8XA 4BBYA 4X62E 5KL5A 2NA2A 2DLKA 3F6HA 2L2KB 2EOHA 4R2EA 4DV5E 2E72A 2DMYA 2DLQA 1X6EA 3AUZA 4JI1E 3MHSC 5AC5A 2EOIA 4GKJE 1PJQA 2LCEA 4GEQB 2ENCA 3JU0A 1UN6B 2V89A 1QU6A 1TN9A 1UBDC 3ADIA 2WBUA 2LUPB 1UILA 2EE8A 2I13A 2ODRD 4KZSA 1G2DC 2YTIA 5LL6R 4JI2E 4WXDA 2NUEA 5KL4A 5IT9C 3ZOQB 4Q28A 2HHHE 4I8OA 2V88A 1ZR9A 4F9BB 4JI3E 4O5GA 2F4VE 2LBSB 3JAMC 2DGCA 1A1JA 1GZ6A 4LF7E 2MDRA 1PDAA 1A1GA 4BC7A 2EOOA 2RQLA 4LU9A
chains in the Genus database with same CATH topology
2EOSA 2EM7A 3EPLA 1X6FA 4F6MA 2EOYA 4R2CA 2EMWA 1F2IG 2EPZA 2VRDA 2YRKA 1RMDA 2EM6A 1BB8A 2EMCA 2YTJA 2EMHA 2EL6A 2YRHA 2EMIA 1NCSA 2YTNA 3UK3C 2CSHA 2ELYA 2EM0A 2WBTA 2YTGA 1YUIA 1X3CA 2YTPA 1G2FC 2MKNA 1KJKA 1JK1A 1MEYC 1YSAC 2A25A 2D9HA 2EOXA 3MHHC 1Z1BA 2WBSA 4IS1C 2YSOA 4GZNC 2EPCA 1ZU1A 2CT1A 2EPUA 2DMIA 2YTDA 5KL3A 4R2QA 1A1IA 2LO3A 2JPAA 2RPCA 4R2DA 2EN7A 1AAYA 2NABA 5KL2A 1JK2A 2EN6A 3EPHA 4R2SA 2LT7A 3EPJA 1BBOA 2EOEA 2YTEA 4WSGA 2EN4A 2MKDA 2EMAA 1WJPA 2EMZA 3M99B 1X6HA 4FK5C 2EPPA 1ZAAC 2EM2A 4X9JA 1YUJA 2EPRA 2EPXA 4M9VC 2EMKA 2ENAA 2YU5A 4R2PA 2EN1A 2YRMA 5KL5A 2J7JA 2EN8A 2DLKA 2CTDA 2EMXA 2DRPA 1B69A 2EOHA 4R2EA 1P47A 2RSIA 2E72A 2EMFA 2WCC3 2DLQA 1X6EA 2EOJA 3MHSC 3EPKA 4F6NA 2EOIA 1A1HA 2EM8A 2PRTA 4F2JC 2LCEA 2EM9A 2EQ3A 2YU8A 1A1FA 2EN2A 2ENCA 2EOFA 2MDGA 2ENHA 4R2RA 1UN6B 2EOMA 2R1FA 2EN3A 2YTFA 1UBDC 3VHTB 1TN9A 1TF6A 2WBUA 2EMBA 2EPAA 2EE8A 2BB8A 2I13A 1X5WA 2M9AA 2LV2A 1A1LA 1G2DC 1LLMC 2YTIA 2EL4A 5KL7A 2EMGA 2EJ4A 2JP9A 2LVHA 4IJDA 2EM5A 2YSPA 5KL4A 2EQ0A 2EL5A 4R2AA 2ADRA 2GHFA 2EOQA 2EORA 2EMLA 1A1KA 1ZR9A 1TF3A 2YTQA 2YTOA 2ELZA 1DGCA 5KL6A 2HGHA 2DGCA 2EP3A 2EM3A 2GLIA 2EM4A 1A1JA 2EMYA 2EQ1A 1A1GA 2EOOA 2EOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOS A;  2EM7 A;  3EPL A;  1X6F A;  4F6M A;  2EOY A;  4R2C A;  2EMW A;  1F2I G;  2EPZ A;  2VRD A;  2YRK A;  1RMD A;  2EM6 A;  1BB8 A;  2EMC A;  2YTJ A;  2EMH A;  2EL6 A;  2YRH A;  2EMI A;  1NCS A;  2YTN A;  3UK3 C;  2CSH A;  2ELY A;  2EM0 A;  2WBT A;  2YTG A;  1YUI A;  1X3C A;  2YTP A;  1G2F C;  2MKN A;  1KJK A;  1JK1 A;  1MEY C;  1YSA C;  2A25 A;  2D9H A;  2EOX A;  3MHH C;  1Z1B A;  2WBS A;  4IS1 C;  2YSO A;  4GZN C;  2EPC A;  1ZU1 A;  2CT1 A;  2EPU A;  2DMI A;  2YTD A;  5KL3 A;  4R2Q A;  1A1I A;  2LO3 A;  2JPA A;  2RPC A;  4R2D A;  2EN7 A;  1AAY A;  2NAB A;  5KL2 A;  1JK2 A;  2EN6 A;  3EPH A;  4R2S A;  2LT7 A;  3EPJ A;  1BBO A;  2EOE A;  2YTE A;  4WSG A;  2EN4 A;  2MKD A;  2EMA A;  1WJP A;  2EMZ A;  3M99 B;  1X6H A;  4FK5 C;  2EPP A;  1ZAA C;  2EM2 A;  4X9J A;  1YUJ A;  2EPR A;  2EPX A;  4M9V C;  2EMK A;  2ENA A;  2YU5 A;  4R2P A;  2EN1 A;  2YRM A;  5KL5 A;  2J7J A;  2EN8 A;  2DLK A;  2CTD A;  2EMX A;  2DRP A;  1B69 A;  2EOH A;  4R2E A;  1P47 A;  2RSI A;  2E72 A;  2EMF A;  2WCC 3;  2DLQ A;  1X6E A;  2EOJ A;  3MHS C;  3EPK A;  4F6N A;  2EOI A;  1A1H A;  2EM8 A;  2PRT A;  4F2J C;  2LCE A;  2EM9 A;  2EQ3 A;  2YU8 A;  1A1F A;  2EN2 A;  2ENC A;  2EOF A;  2MDG A;  2ENH A;  4R2R A;  1UN6 B;  2EOM A;  2R1F A;  2EN3 A;  2YTF A;  1UBD C;  3VHT B;  1TN9 A;  1TF6 A;  2WBU A;  2EMB A;  2EPA A;  2EE8 A;  2BB8 A;  2I13 A;  1X5W A;  2M9A A;  2LV2 A;  1A1L A;  1G2D C;  1LLM C;  2YTI A;  2EL4 A;  5KL7 A;  2EMG A;  2EJ4 A;  2JP9 A;  2LVH A;  4IJD A;  2EM5 A;  2YSP A;  5KL4 A;  2EQ0 A;  2EL5 A;  4R2A A;  2ADR A;  2GHF A;  2EOQ A;  2EOR A;  2EML A;  1A1K A;  1ZR9 A;  1TF3 A;  2YTQ A;  2YTO A;  2ELZ A;  1DGC A;  5KL6 A;  2HGH A;  2DGC A;  2EP3 A;  2EM3 A;  2GLI A;  2EM4 A;  1A1J A;  2EMY A;  2EQ1 A;  1A1G A;  2EOO A;  2EOZ A; 
#chains in the Genus database with same CATH topology
 3C4T A;  2EOS A;  2EM7 A;  1XNR E;  1MGT A;  1J26 A;  2GPI A;  1T4N A;  4DV6 E;  2EPN A;  4LF4 E;  2EPZ A;  4N4R B;  1N34 E;  1RMD A;  1ZBT A;  2YTJ A;  2EMI A;  1NCS A;  1YUI A;  3F6G A;  1X3C A;  3LML A;  2MKN A;  1MEY C;  4X65 E;  2R76 A;  1Z1B A;  4IS1 C;  2E1M A;  2DSY A;  2WZO A;  4M30 A;  2FTX B;  2YPN A;  1L4S A;  1PJS A;  5IXM B;  2DMI A;  2VQF E;  2LO3 A;  4M0V A;  4R2D A;  3MSW A;  1AAY A;  2LMZ A;  3ECR A;  3HPZ A;  1BBO A;  2LRS A;  2YTE A;  2EN4 A;  1X6H A;  2EPR A;  3IWC A;  3C6K A;  3THO B;  2YU5 A;  4R2P A;  2EN1 A;  4DR7 E;  1T4O A;  2J7J A;  2EN8 A;  2NUF A;  2NUG A;  3OML A;  3ADJ A;  4P78 A;  1YPN A;  1P47 A;  2RSI A;  4BMJ A;  2EOJ A;  4O43 A;  1RQ0 A;  4JI6 E;  2FGG A;  4JYA E;  1A1H A;  2EM8 A;  2V86 A;  2PRT A;  2KON A;  1A1F A;  2ZM6 E;  2EOF A;  2ENH A;  2N3H A;  1EH6 A;  1N33 E;  1DI2 A;  1TF6 A;  2EPA A;  2V87 A;  1LLM C;  1UHZ A;  5KL7 A;  2EJ4 A;  1XNQ E;  4DV1 E;  4DR5 E;  3HXL A;  4LFA E;  3RMP A;  2YT4 A;  3T1Y E;  4ZYD A;  2EOR A;  2EML A;  2L2N A;  2ELZ A;  1YYO A;  1DGC A;  4OOG C;  1YYW A;  5KL6 A;  5LLQ A;  4JI0 E;  4MLQ A;  2EM3 A;  2GLI A;  2EMY A;  4TUG A;  4BC9 A;  2EQ1 A;  4AQY E;  3BBG A;  5ADZ A;  1X48 A;  2EOY A;  3HTX A;  2VF1 A;  2L8T A;  3VK6 A;  4GKK E;  4HTG A;  2EMW A;  2KOU A;  1F2I G;  1IQS A;  5AAS A;  4Q35 B;  2UU9 E;  4YY3 E;  2YRK A;  3LLH A;  2JOB A;  2EM6 A;  2MC5 A;  3DF6 A;  2EMC A;  3TQM A;  1IMU A;  2RS6 A;  5BR8 E;  1PKP A;  2YRH A;  4WX9 A;  3UK3 C;  1IBK E;  2YTP A;  1KJK A;  2A25 A;  3MHH C;  2LJU A;  2M1S A;  3AV0 A;  2WBS A;  5F3W A;  2UUC E;  3EQ1 A;  4R03 A;  2YSO A;  1IBM E;  2EPU A;  2YTD A;  4R2Q A;  2VQE E;  1DQ3 A;  2B9D A;  2LTS A;  4DV2 E;  4K0K E;  1RC7 A;  2NAB A;  1KYQ A;  1JK2 A;  3EPH A;  2N3G A;  2MKD A;  4DUZ E;  2EMZ A;  4FK5 C;  3L00 A;  2EM2 A;  1YUJ A;  2EMK A;  2JY9 A;  2YRM A;  1HNZ E;  2EMX A;  4ZYG A;  2DRP A;  1B69 A;  1O0W A;  1GTK A;  2ODR C;  2EMF A;  2WCC 3;  2UXD E;  2F8B A;  3EPK A;  4F6N A;  4P7D A;  5AC4 A;  2JWO A;  4DV7 E;  2EQ3 A;  2K4V A;  3BF2 A;  4J8Z A;  2V83 A;  4WFT A;  3VHT B;  2RTX A;  2EMB A;  4RH8 A;  1A1L A;  1HR0 E;  1N32 E;  1WXR A;  2UXB E;  2YWQ A;  4DKK A;  2L3C A;  2EMG A;  1YFH A;  2LVH A;  4IJD A;  5LMU E;  4B3T E;  4JI4 E;  2EM5 A;  4BCA A;  2EZ6 A;  1EH7 A;  4NHR A;  2YSP A;  4DV3 E;  4DR2 E;  4NXN E;  2JR1 A;  3H09 A;  2EL5 A;  1STU A;  4R2A A;  2GHF A;  2FV4 B;  4R8O A;  4JI5 E;  2B7V A;  1TF3 A;  2RS7 A;  2YTQ A;  2YTO A;  4ZYH A;  1XMQ E;  1EKZ A;  4LTY A;  4LF6 E;  1X49 A;  2IHR 1;  2M4I A;  3KZZ A;  3VYY A;  1IBL E;  4B3M E;  1N3G A;  3IWB A;  1SFE A;  2EOZ A;  5CFF E;  2H36 X;  2JVA A;  5FLX C;  3EPL A;  2EPO A;  3KZY A;  3P1X A;  2G7H A;  1QNT A;  2DB2 A;  3IWD A;  5AE3 A;  2KHX A;  4NXM E;  5AE1 A;  4YHH E;  1BB8 A;  4B3R E;  5DNY A;  3C6M A;  2V8Q B;  3J7A G;  4JV5 E;  2EL6 A;  3JTZ A;  4LF8 E;  5A6J A;  2UUB E;  2YTN A;  2CSH A;  2WBT A;  2YTG A;  4JI7 E;  4HEI A;  1G2F C;  1GQE A;  1SR9 A;  2D9H A;  2EOX A;  2VE7 C;  1YZ9 A;  3J81 C;  5A6B A;  1T38 A;  4GZN C;  3J80 C;  3BID A;  1ZU1 A;  2EPM X;  4DR4 E;  4M2Z A;  4F9A B;  1A1I A;  2HC5 A;  2JPA A;  2RPC A;  3HPS A;  1J5E E;  2LUQ A;  2I9I A;  4WXC A;  2JYA A;  2EOE A;  2DIX A;  4WSG A;  5A6B D;  5AE2 A;  1HNW E;  3M99 B;  2MC6 A;  4WSP A;  1PJT A;  2EPK X;  4X64 E;  2EPP A;  2CPN A;  5A69 A;  4X9J A;  2K7I A;  2L33 A;  2ENA A;  4JI8 E;  2L92 A;  2HJJ A;  2JXP A;  2LJH A;  5LMN E;  4B3S E;  4ZYE A;  4BHC A;  4MLV A;  2CTD A;  4WPY A;  2B7T A;  4DUY E;  4F54 A;  4LF9 E;  1I94 E;  2EWL A;  4F2J C;  1BBG A;  2EM9 A;  4BS9 A;  3THN A;  2YU8 A;  2EN2 A;  2MDG A;  2JOX A;  3OTO E;  4R2R A;  2EOM A;  2R1F A;  2EN3 A;  4L5N C;  4WYQ B;  2YTF A;  4DMI A;  1FKA E;  2BB8 A;  1X5W A;  2M9A A;  2LV2 A;  2L3J A;  2LTR A;  4LFB E;  4LF5 E;  2EL4 A;  2EPL X;  3DJW A;  2JP9 A;  4BHB A;  1WRJ A;  3C4B A;  2EQ0 A;  5T6J A;  4RHB B;  3ADL A;  1EH8 A;  2ADR A;  2EOQ A;  5IWA E;  1HNX E;  3K6Q A;  2V85 A;  5A6A A;  1A1K A;  1XMO E;  2Q8U A;  2E5L E;  2UXC E;  3VYX A;  3HQ1 A;  4DR3 E;  2HGH A;  4L8N A;  2EP3 A;  2BBG A;  1WHQ A;  2L2M A;  2YZT A;  4X66 E;  2EM4 A;  2LE2 A;  3T1H E;  1T39 A;  4NZV A;  4O24 A;  4KHP E;  1X6F A;  1N36 E;  4LFC E;  4F6M A;  4R2C A;  2L6M A;  3QG5 C;  1FJG E;  1YYK A;  2B3T B;  2VRD A;  4OX9 E;  5IV8 B;  4KWY A;  1ZBQ A;  2EMH A;  3KWR A;  4X8W A;  5A2Q C;  2RSM A;  2ELY A;  2EM0 A;  3ADG A;  5TSE A;  5A6K A;  3J7Y p;  1JK1 A;  4O4K A;  1YSA C;  4DV4 E;  3BGH A;  3FIG A;  4DR1 E;  2EPC A;  1IQO A;  2UUA E;  2CT1 A;  4DV0 E;  5KL3 A;  1NEI A;  2EN7 A;  4F9C B;  5KL2 A;  2EN6 A;  4R2S A;  2LT7 A;  3EPJ A;  1WHN A;  1T4L B;  1X47 A;  1WJP A;  2EMA A;  1AH5 A;  4DR6 E;  1ZAA C;  2EPX A;  4M9V C;  2M7Q A;  4TUI A;  2N8X A;  4BBY A;  4X62 E;  5KL5 A;  2NA2 A;  2DLK A;  3F6H A;  2L2K B;  2EOH A;  4R2E A;  4DV5 E;  2E72 A;  2DMY A;  2DLQ A;  1X6E A;  3AUZ A;  4JI1 E;  3MHS C;  5AC5 A;  2EOI A;  4GKJ E;  1PJQ A;  2LCE A;  4GEQ B;  2ENC A;  3JU0 A;  1UN6 B;  2V89 A;  1QU6 A;  1TN9 A;  1UBD C;  3ADI A;  2WBU A;  2LUP B;  1UIL A;  2EE8 A;  2I13 A;  2ODR D;  4KZS A;  1G2D C;  2YTI A;  5LL6 R;  4JI2 E;  4WXD A;  2NUE A;  5KL4 A;  5IT9 C;  3ZOQ B;  4Q28 A;  2HHH E;  4I8O A;  2V88 A;  1ZR9 A;  4F9B B;  4JI3 E;  4O5G A;  2F4V E;  2LBS B;  3JAM C;  2DGC A;  1A1J A;  1GZ6 A;  4LF7 E;  2MDR A;  1PDA A;  1A1G A;  4BC7 A;  2EOO A;  2RQL A;  4LU9 A; 
#chains in the Genus database with same CATH homology
 2EOS A;  2EM7 A;  3EPL A;  1X6F A;  4F6M A;  2EOY A;  4R2C A;  2EMW A;  1F2I G;  2EPZ A;  2VRD A;  2YRK A;  1RMD A;  2EM6 A;  1BB8 A;  2EMC A;  2YTJ A;  2EMH A;  2EL6 A;  2YRH A;  2EMI A;  1NCS A;  2YTN A;  3UK3 C;  2CSH A;  2ELY A;  2EM0 A;  2WBT A;  2YTG A;  1YUI A;  1X3C A;  2YTP A;  1G2F C;  2MKN A;  1KJK A;  1JK1 A;  1MEY C;  1YSA C;  2A25 A;  2D9H A;  2EOX A;  3MHH C;  1Z1B A;  2WBS A;  4IS1 C;  2YSO A;  4GZN C;  2EPC A;  1ZU1 A;  2CT1 A;  2EPU A;  2DMI A;  2YTD A;  5KL3 A;  4R2Q A;  1A1I A;  2LO3 A;  2JPA A;  2RPC A;  4R2D A;  2EN7 A;  1AAY A;  2NAB A;  5KL2 A;  1JK2 A;  2EN6 A;  3EPH A;  4R2S A;  2LT7 A;  3EPJ A;  1BBO A;  2EOE A;  2YTE A;  4WSG A;  2EN4 A;  2MKD A;  2EMA A;  1WJP A;  2EMZ A;  3M99 B;  1X6H A;  4FK5 C;  2EPP A;  1ZAA C;  2EM2 A;  4X9J A;  1YUJ A;  2EPR A;  2EPX A;  4M9V C;  2EMK A;  2ENA A;  2YU5 A;  4R2P A;  2EN1 A;  2YRM A;  5KL5 A;  2J7J A;  2EN8 A;  2DLK A;  2CTD A;  2EMX A;  2DRP A;  1B69 A;  2EOH A;  4R2E A;  1P47 A;  2RSI A;  2E72 A;  2EMF A;  2WCC 3;  2DLQ A;  1X6E A;  2EOJ A;  3MHS C;  3EPK A;  4F6N A;  2EOI A;  1A1H A;  2EM8 A;  2PRT A;  4F2J C;  2LCE A;  2EM9 A;  2EQ3 A;  2YU8 A;  1A1F A;  2EN2 A;  2ENC A;  2EOF A;  2MDG A;  2ENH A;  4R2R A;  1UN6 B;  2EOM A;  2R1F A;  2EN3 A;  2YTF A;  1UBD C;  3VHT B;  1TN9 A;  1TF6 A;  2WBU A;  2EMB A;  2EPA A;  2EE8 A;  2BB8 A;  2I13 A;  1X5W A;  2M9A A;  2LV2 A;  1A1L A;  1G2D C;  1LLM C;  2YTI A;  2EL4 A;  5KL7 A;  2EMG A;  2EJ4 A;  2JP9 A;  2LVH A;  4IJD A;  2EM5 A;  2YSP A;  5KL4 A;  2EQ0 A;  2EL5 A;  4R2A A;  2ADR A;  2GHF A;  2EOQ A;  2EOR A;  2EML A;  1A1K A;  1ZR9 A;  1TF3 A;  2YTQ A;  2YTO A;  2ELZ A;  1DGC A;  5KL6 A;  2HGH A;  2DGC A;  2EP3 A;  2EM3 A;  2GLI A;  2EM4 A;  1A1J A;  2EMY A;  2EQ1 A;  1A1G A;  2EOO A;  2EOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...