2PRTA

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*CP*GP*CP*GP*GP*GP*GP*GP*CP*GP*TP*CP*TP*G)-3')
publication title Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA04
1ZAAC 2EL6A 1G2DC 2RSIA 2EORA 2EQ0A 4IJDA 2EN3A 2LO3A 2M9AA 3MHHC 2CSHA 2EMCA 2EN7A 2BB8A 2E72A 1RMDA 2EL5A 2EOXA 2YTNA 2NABA 3M99B 2DLKA 2WBTA 1YUJA 2GHFA 2EM9A 2JP9A 4GZNC 2EQ1A 1KJKA 1MEYC 2YTOA 1A1JA 2EMYA 3MHSC 5KL6A 4R2AA 2EPAA 1BB8A 4R2PA 4R2RA 2ENCA 2EMGA 1JK2A 2DLQA 5KL4A 2DGCA 2EOFA 2EMXA 2EOEA 2EM0A 4F2JC 2EMIA 2LVHA 2EMLA 2EN4A 1A1FA 2PRTA 2GLIA 2EMFA 2EQ3A 2EPRA 1G2FC 2D9HA 2EPCA 2EP3A 2MDGA 2EPPA 3UK3C 2LT7A 1X5WA 2EPUA 2A25A 2CT1A 1JK1A 2I13A 2EL4A 1YSAC 1WJPA 2WBSA 2YTEA 4M9VC 2LV2A 1A1GA 2EOHA 2J7JA 2EN1A 2EOOA 4R2SA 1X6FA 1ZR9A 2HGHA 4R2EA 2EM6A 4X9JA 1A1KA 2ELYA 2MKNA 1A1IA 2YTPA 4FK5C 1B69A 4R2QA 3EPJA 2EPZA 1X3CA 2EMKA 4R2CA 1BBOA 2CTDA 2WCC3 4IS1C 2EE8A 2MKDA 2EMAA 5KL2A 2YRHA 1YUIA 2YTIA 2EOSA 2EOIA 2YU8A 1DGCA 2ADRA 2EM3A 2EJ4A 1LLMC 2LCEA 2ELZA 2R1FA 2ENHA 2EM8A 1TF3A 2VRDA 3EPKA 2EPXA 2YTGA 1UBDC 4R2DA 1UN6B 2EOQA 1P47A 2EMWA 2EM7A 2YRKA 1TF6A 2EM2A 2YTFA 2EOJA 2EN2A 1AAYA 5KL5A 2YTQA 4WSGA 4F6MA 2EOYA 2RPCA 2YSOA 1X6EA 2JPAA 5KL7A 2EM4A 1F2IG 2WBUA 3EPLA 2DRPA 2EM5A 2EN8A 2EOZA 3EPHA 2YTJA 3VHTB 2YRMA 4F6NA 1TN9A 1Z1BA 2YSPA 1A1LA 2EMHA 1ZU1A 5KL3A 1NCSA 2EMZA 1A1HA 2DMIA 1X6HA 2ENAA 2EOMA 2EMBA 2EN6A 2YU5A 2YTDA
chains in the Genus database with same CATH superfamily
2V89A 2RSIA 3MHHC 2CSHA 2EMCA 3BGHA 2BB8A 4BC9A 2DLKA 3T1HE 2R76A 2GHFA 1YUJA 4HEIA 3IWBA 2EM9A 4DV1E 1KJKA 2YTOA 1A1JA 4DV7E 3MHSC 3RMPA 2L3CA 4NXNE 4R2PA 1UILA 2WZOA 5KL4A 2KHXA 2LJUA 2EM0A 2EMIA 2EN4A 1YFHA 1DQ3A 1G2FC 1XNQE 3DF6A 2EP3A 2MDGA 4ZYGA 1X5WA 1PDAA 3EQ1A 3J81C 4X65E 1ZR9A 2KONA 1IBKE 2M4IA 2HGHA 3J7AG 4RH8A 2V86A 2I9IA 1I94E 1IQOA 2JR1A 4FK5C 4F9AB 5AC4A 1N34E 2CTDA 2WCC3 4IS1C 1T39A 1WRJA 1XMOE 3C6MA 2EOIA 2JOBA 4JI8E 4JI0E 4P78A 2EM3A 2N3HA 1LLMC 2FTXB 2ODRC 3L00A 2BBGA 4LFCE 2EM8A 5LMUE 1T4LB 2VRDA 4BMJA 2FGGA 1FJGE 4LF4E 1DI2A 2ODRD 3HPZA 3ADGA 2E5LE 3IWDA 2HC5A 2YWQA 2EN2A 1AAYA 1BBGA 2YTQA 3AV0A 3HXLA 4WSGA 2IHR1 4O5GA 2EOYA 2YSOA 4OX9E 1HNXE 2DRPA 2LTSA 5AE1A 4DV6E 1XMQE 4Q35B 4BHBA 1TN9A 1RQ0A 2YSPA 4X64E 3LMLA 2E1MA 1L4SA 3P1XA 2YPNA 4X66E 4JI5E 1X6HA 2ENAA 2LTRA 4R2EA 2YTDA 2UXDE 1G2DC 4B3TE 2RTXA 2M9AA 1GQEA 2JOXA 2EL5A 3M99B 1IQSA 2EPNA 4GKJE 2LE2A 1MEYC 3KZYA 5IXMB 5KL6A 2RQLA 5A69A 1BB8A 1YYOA 5LL6R 1IBME 2JY9A 3JTZA 4BC7A 2DLQA 3J80C 3C4TA 2DGCA 2EOEA 1UHZA 5TSEA 4KHPE 2L2MA 2PRTA 3JU0A 5T6JA 2D9HA 2EPPA 2LT7A 3J7Yp 4I8OA 4F9CB 4WX9A 2CT1A 2DSYA 1WHNA 2YT4A 4HTGA 4BS9A 4L5NC 4LF9E 1YSAC 2YTEA 2B7TA 4WXCA 2EOHA 1IBLE 1X6FA 2EZ6A 2EM6A 2VQFE 1A1IA 4WPYA 5FLXC 2EPLX 2L8TA 1PKPA 5F3WA 4R2QA 3HPSA 4O43A 4DKKA 1X3CA 2EMKA 4R2CA 1BBOA 4DR2E 1HNWE 2MKDA 2EMAA 2MC6A 2YTIA 2EOSA 5A6JA 2JYAA 4GKKE 1DGCA 2ADRA 3KWRA 2R1FA 2K7IA 1TF3A 3EPKA 2EPXA 1UN6B 4R2DA 2UU9E 3ADIA 1P47A 2EMWA 2EM7A 3F6GA 2EM2A 4J8ZA 2LRSA 1FKAE 4JYAE 4LF8E 4DR4E 4YHHE 2EPMX 2WBUA 3EPLA 2EM5A 2EN8A 1J26A 1PJTA 2UXCE 2YRMA 2EMHA 5KL3A 1IMUA 4K0KE 4B3ME 1ZAAC 2EL6A 2EQ0A 4BHCA 2EPOA 2EN3A 1RMDA 2YTNA 2EOXA 2LUQA 1ZBTA 3QG5C 1SR9A 1QNTA 2UUCE 4WFTA 4R2AA 2EPAA 3BBGA 1J5EE 1EKZA 2L3JA 3C4BA 4M0VA 1X48A 2L92A 4JI6E 2EOFA 2EMXA 2H36X 4F2JC 2LVHA 1KYQA 2EMLA 2GLIA 2EMFA 2EQ3A 4P7DA 5CFFE 5A6AA 4LF5E 3BF2A 2B7VA 3VK6A 1QU6A 2EPUA 4OOGC 4DR6E 2I13A 2EL4A 1WJPA 4M9VC 2ZM6E 4WSPA 2HHHE 4R03A 2L2KB 1SFEA 2G7HA 1A1KA 2ELYA 2FV4B 4DR1E 3ECRA 4LFAE 4JV5E 4YY3E 1B69A 4MLQA 1YPNA 2EPZA 5BR8E 3EPJA 4LF6E 2DIXA 3H09A 4KZSA 2VQEE 4DR7E 2EE8A 1EH7A 2MDRA 1N32E 3VYYA 1YUIA 5A2QC 5AE2A 2YU8A 1NEIA 3BIDA 2EJ4A 4DR3E 4F9BB 4X62E 2NA2A 5AASA 2ENHA 5IWAE 2NUEA 1WHQA 3LLHA 2V88A 2EOQA 4M2ZA 4Q28A 2F4VE 2YRKA 1TF6A 2YTFA 4AQYE 2EOJA 4RHBB 5KL5A 1X49A 3OTOE 2M1SA 3T1YE 2RPCA 4DR5E 1X6EA 2JPAA 2EM4A 1F2IG 2EPKX 4B3SE 2RSMA 4LFBE 4NHRA 1N33E 3VHTB 2B3TB 4O24A 4F6NA 1YYKA 1Z1BA 3ADJA 1A1LA 5IV8B 1ZU1A 3ZOQB 1NCSA 2DMIA 4F54A 2EOMA 2N3GA 2YU5A 5A6KA 4B3RE 4N4RB 2EORA 4TUGA 4IJDA 2LO3A 4TUIA 4DUZE 2EN7A 4M30A 1MGTA 1T38A 4O4KA 2LUPB 4DV3E 2E72A 2NABA 3HTXA 1T4OA 2WBTA 1STUA 4DMIA 2JP9A 4GZNC 1XNRE 2EQ1A 5A6BA 1YYWA 3ADLA 2CPNA 2EMYA 2V83A 2UXBE 2YZTA 2M7QA 5LMNE 4R2RA 3MSWA 2EWLA 2ENCA 2EMGA 1WXRA 1JK2A 4JI2E 5IT9C 4LF7E 2VE7C 2KOUA 4MLVA 1A1FA 2EPRA 2EPCA 3KZZA 5A6BD 2LBSB 2K4VA 1HR0E 4DV0E 1ZBQA 3UK3C 2A25A 1X47A 2F8BA 1JK1A 4ZYHA 3DJWA 5AE3A 2WBSA 3F6HA 2LV2A 1A1GA 4LU9A 4L8NA 2J7JA 2B9DA 1PJQA 2EN1A 2EOOA 2JVAA 3K6QA 4R2SA 4BBYA 2LMZA 2V85A 4X9JA 2Q8UA 1AH5A 2MKNA 4NXME 2YTPA 4DV2E 4ZYEA 4DV5E 5AC5A 2HJJA 5LLQA 3THOB 4JI1E 2MC5A 4X8WA 3AUZA 3IWCA 2RS7A 2L2NA 4KWYA 1GZ6A 1O0WA 5DNYA 4WYQB 2LJHA 1HNZE 5KL2A 2YRHA 4JI7E 1YZ9A 2NUFA 1RC7A 2L6MA 1EH8A 2LCEA 2ELZA 2L33A 4ZYDA 2NUGA 1T4NA 4NZVA 4R8OA 1GTKA 4LTYA 1UBDC 2YTGA 2GPIA 4GEQB 3TQMA 2VF1A 3FIGA 2JWOA 2N8XA 1N3GA 1EH6A 2DMYA 5ADZA 4F6MA 3JAMC 2V87A 5KL7A 4JI3E 4BCAA 2V8QB 4JI4E 2EOZA 3EPHA 4WXDA 2YTJA 1PJSA 4DUYE 3OMLA 2JXPA 2UUBE 2RS6A 2EMZA 1A1HA 2UUAE 3HQ1A 2EMBA 2EN6A 3C6KA 3THNA 4DV4E 3VYXA 1N36E 2DB2A
chains in the Genus database with same CATH topology
1ZAAC 2EL6A 1G2DC 2RSIA 2EORA 2EQ0A 4IJDA 2EN3A 2LO3A 2M9AA 3MHHC 2CSHA 2EMCA 2EN7A 2BB8A 2E72A 1RMDA 2EL5A 2EOXA 2YTNA 2NABA 3M99B 2DLKA 2WBTA 1YUJA 2GHFA 2EM9A 2JP9A 4GZNC 2EQ1A 1KJKA 1MEYC 2YTOA 1A1JA 2EMYA 3MHSC 5KL6A 4R2AA 2EPAA 1BB8A 4R2PA 4R2RA 2ENCA 2EMGA 1JK2A 2DLQA 5KL4A 2DGCA 2EOFA 2EMXA 2EOEA 2EM0A 4F2JC 2EMIA 2LVHA 2EMLA 2EN4A 1A1FA 2PRTA 2GLIA 2EMFA 2EQ3A 2EPRA 1G2FC 2D9HA 2EPCA 2EP3A 2MDGA 2EPPA 3UK3C 2LT7A 1X5WA 2EPUA 2A25A 2CT1A 1JK1A 2I13A 2EL4A 1YSAC 1WJPA 2WBSA 2YTEA 4M9VC 2LV2A 1A1GA 2EOHA 2J7JA 2EN1A 2EOOA 4R2SA 1X6FA 1ZR9A 2HGHA 4R2EA 2EM6A 4X9JA 1A1KA 2ELYA 2MKNA 1A1IA 2YTPA 4FK5C 1B69A 4R2QA 3EPJA 2EPZA 1X3CA 2EMKA 4R2CA 1BBOA 2CTDA 2WCC3 4IS1C 2EE8A 2MKDA 2EMAA 5KL2A 2YRHA 1YUIA 2YTIA 2EOSA 2EOIA 2YU8A 1DGCA 2ADRA 2EM3A 2EJ4A 1LLMC 2LCEA 2ELZA 2R1FA 2ENHA 2EM8A 1TF3A 2VRDA 3EPKA 2EPXA 2YTGA 1UBDC 4R2DA 1UN6B 2EOQA 1P47A 2EMWA 2EM7A 2YRKA 1TF6A 2EM2A 2YTFA 2EOJA 2EN2A 1AAYA 5KL5A 2YTQA 4WSGA 4F6MA 2EOYA 2RPCA 2YSOA 1X6EA 2JPAA 5KL7A 2EM4A 1F2IG 2WBUA 3EPLA 2DRPA 2EM5A 2EN8A 2EOZA 3EPHA 2YTJA 3VHTB 2YRMA 4F6NA 1TN9A 1Z1BA 2YSPA 1A1LA 2EMHA 1ZU1A 5KL3A 1NCSA 2EMZA 1A1HA 2DMIA 1X6HA 2ENAA 2EOMA 2EMBA 2EN6A 2YU5A 2YTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAA C;  2EL6 A;  1G2D C;  2RSI A;  2EOR A;  2EQ0 A;  4IJD A;  2EN3 A;  2LO3 A;  2M9A A;  3MHH C;  2CSH A;  2EMC A;  2EN7 A;  2BB8 A;  2E72 A;  1RMD A;  2EL5 A;  2EOX A;  2YTN A;  2NAB A;  3M99 B;  2DLK A;  2WBT A;  1YUJ A;  2GHF A;  2EM9 A;  2JP9 A;  4GZN C;  2EQ1 A;  1KJK A;  1MEY C;  2YTO A;  1A1J A;  2EMY A;  3MHS C;  5KL6 A;  4R2A A;  2EPA A;  1BB8 A;  4R2P A;  4R2R A;  2ENC A;  2EMG A;  1JK2 A;  2DLQ A;  5KL4 A;  2DGC A;  2EOF A;  2EMX A;  2EOE A;  2EM0 A;  4F2J C;  2EMI A;  2LVH A;  2EML A;  2EN4 A;  1A1F A;  2PRT A;  2GLI A;  2EMF A;  2EQ3 A;  2EPR A;  1G2F C;  2D9H A;  2EPC A;  2EP3 A;  2MDG A;  2EPP A;  3UK3 C;  2LT7 A;  1X5W A;  2EPU A;  2A25 A;  2CT1 A;  1JK1 A;  2I13 A;  2EL4 A;  1YSA C;  1WJP A;  2WBS A;  2YTE A;  4M9V C;  2LV2 A;  1A1G A;  2EOH A;  2J7J A;  2EN1 A;  2EOO A;  4R2S A;  1X6F A;  1ZR9 A;  2HGH A;  4R2E A;  2EM6 A;  4X9J A;  1A1K A;  2ELY A;  2MKN A;  1A1I A;  2YTP A;  4FK5 C;  1B69 A;  4R2Q A;  3EPJ A;  2EPZ A;  1X3C A;  2EMK A;  4R2C A;  1BBO A;  2CTD A;  2WCC 3;  4IS1 C;  2EE8 A;  2MKD A;  2EMA A;  5KL2 A;  2YRH A;  1YUI A;  2YTI A;  2EOS A;  2EOI A;  2YU8 A;  1DGC A;  2ADR A;  2EM3 A;  2EJ4 A;  1LLM C;  2LCE A;  2ELZ A;  2R1F A;  2ENH A;  2EM8 A;  1TF3 A;  2VRD A;  3EPK A;  2EPX A;  2YTG A;  1UBD C;  4R2D A;  1UN6 B;  2EOQ A;  1P47 A;  2EMW A;  2EM7 A;  2YRK A;  1TF6 A;  2EM2 A;  2YTF A;  2EOJ A;  2EN2 A;  1AAY A;  5KL5 A;  2YTQ A;  4WSG A;  4F6M A;  2EOY A;  2RPC A;  2YSO A;  1X6E A;  2JPA A;  5KL7 A;  2EM4 A;  1F2I G;  2WBU A;  3EPL A;  2DRP A;  2EM5 A;  2EN8 A;  2EOZ A;  3EPH A;  2YTJ A;  3VHT B;  2YRM A;  4F6N A;  1TN9 A;  1Z1B A;  2YSP A;  1A1L A;  2EMH A;  1ZU1 A;  5KL3 A;  1NCS A;  2EMZ A;  1A1H A;  2DMI A;  1X6H A;  2ENA A;  2EOM A;  2EMB A;  2EN6 A;  2YU5 A;  2YTD A; 
#chains in the Genus database with same CATH topology
 2V89 A;  2RSI A;  3MHH C;  2CSH A;  2EMC A;  3BGH A;  2BB8 A;  4BC9 A;  2DLK A;  3T1H E;  2R76 A;  2GHF A;  1YUJ A;  4HEI A;  3IWB A;  2EM9 A;  4DV1 E;  1KJK A;  2YTO A;  1A1J A;  4DV7 E;  3MHS C;  3RMP A;  2L3C A;  4NXN E;  4R2P A;  1UIL A;  2WZO A;  5KL4 A;  2KHX A;  2LJU A;  2EM0 A;  2EMI A;  2EN4 A;  1YFH A;  1DQ3 A;  1G2F C;  1XNQ E;  3DF6 A;  2EP3 A;  2MDG A;  4ZYG A;  1X5W A;  1PDA A;  3EQ1 A;  3J81 C;  4X65 E;  1ZR9 A;  2KON A;  1IBK E;  2M4I A;  2HGH A;  3J7A G;  4RH8 A;  2V86 A;  2I9I A;  1I94 E;  1IQO A;  2JR1 A;  4FK5 C;  4F9A B;  5AC4 A;  1N34 E;  2CTD A;  2WCC 3;  4IS1 C;  1T39 A;  1WRJ A;  1XMO E;  3C6M A;  2EOI A;  2JOB A;  4JI8 E;  4JI0 E;  4P78 A;  2EM3 A;  2N3H A;  1LLM C;  2FTX B;  2ODR C;  3L00 A;  2BBG A;  4LFC E;  2EM8 A;  5LMU E;  1T4L B;  2VRD A;  4BMJ A;  2FGG A;  1FJG E;  4LF4 E;  1DI2 A;  2ODR D;  3HPZ A;  3ADG A;  2E5L E;  3IWD A;  2HC5 A;  2YWQ A;  2EN2 A;  1AAY A;  1BBG A;  2YTQ A;  3AV0 A;  3HXL A;  4WSG A;  2IHR 1;  4O5G A;  2EOY A;  2YSO A;  4OX9 E;  1HNX E;  2DRP A;  2LTS A;  5AE1 A;  4DV6 E;  1XMQ E;  4Q35 B;  4BHB A;  1TN9 A;  1RQ0 A;  2YSP A;  4X64 E;  3LML A;  2E1M A;  1L4S A;  3P1X A;  2YPN A;  4X66 E;  4JI5 E;  1X6H A;  2ENA A;  2LTR A;  4R2E A;  2YTD A;  2UXD E;  1G2D C;  4B3T E;  2RTX A;  2M9A A;  1GQE A;  2JOX A;  2EL5 A;  3M99 B;  1IQS A;  2EPN A;  4GKJ E;  2LE2 A;  1MEY C;  3KZY A;  5IXM B;  5KL6 A;  2RQL A;  5A69 A;  1BB8 A;  1YYO A;  5LL6 R;  1IBM E;  2JY9 A;  3JTZ A;  4BC7 A;  2DLQ A;  3J80 C;  3C4T A;  2DGC A;  2EOE A;  1UHZ A;  5TSE A;  4KHP E;  2L2M A;  2PRT A;  3JU0 A;  5T6J A;  2D9H A;  2EPP A;  2LT7 A;  3J7Y p;  4I8O A;  4F9C B;  4WX9 A;  2CT1 A;  2DSY A;  1WHN A;  2YT4 A;  4HTG A;  4BS9 A;  4L5N C;  4LF9 E;  1YSA C;  2YTE A;  2B7T A;  4WXC A;  2EOH A;  1IBL E;  1X6F A;  2EZ6 A;  2EM6 A;  2VQF E;  1A1I A;  4WPY A;  5FLX C;  2EPL X;  2L8T A;  1PKP A;  5F3W A;  4R2Q A;  3HPS A;  4O43 A;  4DKK A;  1X3C A;  2EMK A;  4R2C A;  1BBO A;  4DR2 E;  1HNW E;  2MKD A;  2EMA A;  2MC6 A;  2YTI A;  2EOS A;  5A6J A;  2JYA A;  4GKK E;  1DGC A;  2ADR A;  3KWR A;  2R1F A;  2K7I A;  1TF3 A;  3EPK A;  2EPX A;  1UN6 B;  4R2D A;  2UU9 E;  3ADI A;  1P47 A;  2EMW A;  2EM7 A;  3F6G A;  2EM2 A;  4J8Z A;  2LRS A;  1FKA E;  4JYA E;  4LF8 E;  4DR4 E;  4YHH E;  2EPM X;  2WBU A;  3EPL A;  2EM5 A;  2EN8 A;  1J26 A;  1PJT A;  2UXC E;  2YRM A;  2EMH A;  5KL3 A;  1IMU A;  4K0K E;  4B3M E;  1ZAA C;  2EL6 A;  2EQ0 A;  4BHC A;  2EPO A;  2EN3 A;  1RMD A;  2YTN A;  2EOX A;  2LUQ A;  1ZBT A;  3QG5 C;  1SR9 A;  1QNT A;  2UUC E;  4WFT A;  4R2A A;  2EPA A;  3BBG A;  1J5E E;  1EKZ A;  2L3J A;  3C4B A;  4M0V A;  1X48 A;  2L92 A;  4JI6 E;  2EOF A;  2EMX A;  2H36 X;  4F2J C;  2LVH A;  1KYQ A;  2EML A;  2GLI A;  2EMF A;  2EQ3 A;  4P7D A;  5CFF E;  5A6A A;  4LF5 E;  3BF2 A;  2B7V A;  3VK6 A;  1QU6 A;  2EPU A;  4OOG C;  4DR6 E;  2I13 A;  2EL4 A;  1WJP A;  4M9V C;  2ZM6 E;  4WSP A;  2HHH E;  4R03 A;  2L2K B;  1SFE A;  2G7H A;  1A1K A;  2ELY A;  2FV4 B;  4DR1 E;  3ECR A;  4LFA E;  4JV5 E;  4YY3 E;  1B69 A;  4MLQ A;  1YPN A;  2EPZ A;  5BR8 E;  3EPJ A;  4LF6 E;  2DIX A;  3H09 A;  4KZS A;  2VQE E;  4DR7 E;  2EE8 A;  1EH7 A;  2MDR A;  1N32 E;  3VYY A;  1YUI A;  5A2Q C;  5AE2 A;  2YU8 A;  1NEI A;  3BID A;  2EJ4 A;  4DR3 E;  4F9B B;  4X62 E;  2NA2 A;  5AAS A;  2ENH A;  5IWA E;  2NUE A;  1WHQ A;  3LLH A;  2V88 A;  2EOQ A;  4M2Z A;  4Q28 A;  2F4V E;  2YRK A;  1TF6 A;  2YTF A;  4AQY E;  2EOJ A;  4RHB B;  5KL5 A;  1X49 A;  3OTO E;  2M1S A;  3T1Y E;  2RPC A;  4DR5 E;  1X6E A;  2JPA A;  2EM4 A;  1F2I G;  2EPK X;  4B3S E;  2RSM A;  4LFB E;  4NHR A;  1N33 E;  3VHT B;  2B3T B;  4O24 A;  4F6N A;  1YYK A;  1Z1B A;  3ADJ A;  1A1L A;  5IV8 B;  1ZU1 A;  3ZOQ B;  1NCS A;  2DMI A;  4F54 A;  2EOM A;  2N3G A;  2YU5 A;  5A6K A;  4B3R E;  4N4R B;  2EOR A;  4TUG A;  4IJD A;  2LO3 A;  4TUI A;  4DUZ E;  2EN7 A;  4M30 A;  1MGT A;  1T38 A;  4O4K A;  2LUP B;  4DV3 E;  2E72 A;  2NAB A;  3HTX A;  1T4O A;  2WBT A;  1STU A;  4DMI A;  2JP9 A;  4GZN C;  1XNR E;  2EQ1 A;  5A6B A;  1YYW A;  3ADL A;  2CPN A;  2EMY A;  2V83 A;  2UXB E;  2YZT A;  2M7Q A;  5LMN E;  4R2R A;  3MSW A;  2EWL A;  2ENC A;  2EMG A;  1WXR A;  1JK2 A;  4JI2 E;  5IT9 C;  4LF7 E;  2VE7 C;  2KOU A;  4MLV A;  1A1F A;  2EPR A;  2EPC A;  3KZZ A;  5A6B D;  2LBS B;  2K4V A;  1HR0 E;  4DV0 E;  1ZBQ A;  3UK3 C;  2A25 A;  1X47 A;  2F8B A;  1JK1 A;  4ZYH A;  3DJW A;  5AE3 A;  2WBS A;  3F6H A;  2LV2 A;  1A1G A;  4LU9 A;  4L8N A;  2J7J A;  2B9D A;  1PJQ A;  2EN1 A;  2EOO A;  2JVA A;  3K6Q A;  4R2S A;  4BBY A;  2LMZ A;  2V85 A;  4X9J A;  2Q8U A;  1AH5 A;  2MKN A;  4NXM E;  2YTP A;  4DV2 E;  4ZYE A;  4DV5 E;  5AC5 A;  2HJJ A;  5LLQ A;  3THO B;  4JI1 E;  2MC5 A;  4X8W A;  3AUZ A;  3IWC A;  2RS7 A;  2L2N A;  4KWY A;  1GZ6 A;  1O0W A;  5DNY A;  4WYQ B;  2LJH A;  1HNZ E;  5KL2 A;  2YRH A;  4JI7 E;  1YZ9 A;  2NUF A;  1RC7 A;  2L6M A;  1EH8 A;  2LCE A;  2ELZ A;  2L33 A;  4ZYD A;  2NUG A;  1T4N A;  4NZV A;  4R8O A;  1GTK A;  4LTY A;  1UBD C;  2YTG A;  2GPI A;  4GEQ B;  3TQM A;  2VF1 A;  3FIG A;  2JWO A;  2N8X A;  1N3G A;  1EH6 A;  2DMY A;  5ADZ A;  4F6M A;  3JAM C;  2V87 A;  5KL7 A;  4JI3 E;  4BCA A;  2V8Q B;  4JI4 E;  2EOZ A;  3EPH A;  4WXD A;  2YTJ A;  1PJS A;  4DUY E;  3OML A;  2JXP A;  2UUB E;  2RS6 A;  2EMZ A;  1A1H A;  2UUA E;  3HQ1 A;  2EMB A;  2EN6 A;  3C6K A;  3THN A;  4DV4 E;  3VYX A;  1N36 E;  2DB2 A; 
#chains in the Genus database with same CATH homology
 1ZAA C;  2EL6 A;  1G2D C;  2RSI A;  2EOR A;  2EQ0 A;  4IJD A;  2EN3 A;  2LO3 A;  2M9A A;  3MHH C;  2CSH A;  2EMC A;  2EN7 A;  2BB8 A;  2E72 A;  1RMD A;  2EL5 A;  2EOX A;  2YTN A;  2NAB A;  3M99 B;  2DLK A;  2WBT A;  1YUJ A;  2GHF A;  2EM9 A;  2JP9 A;  4GZN C;  2EQ1 A;  1KJK A;  1MEY C;  2YTO A;  1A1J A;  2EMY A;  3MHS C;  5KL6 A;  4R2A A;  2EPA A;  1BB8 A;  4R2P A;  4R2R A;  2ENC A;  2EMG A;  1JK2 A;  2DLQ A;  5KL4 A;  2DGC A;  2EOF A;  2EMX A;  2EOE A;  2EM0 A;  4F2J C;  2EMI A;  2LVH A;  2EML A;  2EN4 A;  1A1F A;  2PRT A;  2GLI A;  2EMF A;  2EQ3 A;  2EPR A;  1G2F C;  2D9H A;  2EPC A;  2EP3 A;  2MDG A;  2EPP A;  3UK3 C;  2LT7 A;  1X5W A;  2EPU A;  2A25 A;  2CT1 A;  1JK1 A;  2I13 A;  2EL4 A;  1YSA C;  1WJP A;  2WBS A;  2YTE A;  4M9V C;  2LV2 A;  1A1G A;  2EOH A;  2J7J A;  2EN1 A;  2EOO A;  4R2S A;  1X6F A;  1ZR9 A;  2HGH A;  4R2E A;  2EM6 A;  4X9J A;  1A1K A;  2ELY A;  2MKN A;  1A1I A;  2YTP A;  4FK5 C;  1B69 A;  4R2Q A;  3EPJ A;  2EPZ A;  1X3C A;  2EMK A;  4R2C A;  1BBO A;  2CTD A;  2WCC 3;  4IS1 C;  2EE8 A;  2MKD A;  2EMA A;  5KL2 A;  2YRH A;  1YUI A;  2YTI A;  2EOS A;  2EOI A;  2YU8 A;  1DGC A;  2ADR A;  2EM3 A;  2EJ4 A;  1LLM C;  2LCE A;  2ELZ A;  2R1F A;  2ENH A;  2EM8 A;  1TF3 A;  2VRD A;  3EPK A;  2EPX A;  2YTG A;  1UBD C;  4R2D A;  1UN6 B;  2EOQ A;  1P47 A;  2EMW A;  2EM7 A;  2YRK A;  1TF6 A;  2EM2 A;  2YTF A;  2EOJ A;  2EN2 A;  1AAY A;  5KL5 A;  2YTQ A;  4WSG A;  4F6M A;  2EOY A;  2RPC A;  2YSO A;  1X6E A;  2JPA A;  5KL7 A;  2EM4 A;  1F2I G;  2WBU A;  3EPL A;  2DRP A;  2EM5 A;  2EN8 A;  2EOZ A;  3EPH A;  2YTJ A;  3VHT B;  2YRM A;  4F6N A;  1TN9 A;  1Z1B A;  2YSP A;  1A1L A;  2EMH A;  1ZU1 A;  5KL3 A;  1NCS A;  2EMZ A;  1A1H A;  2DMI A;  1X6H A;  2ENA A;  2EOM A;  2EMB A;  2EN6 A;  2YU5 A;  2YTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...