2PRTA

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*CP*GP*CP*GP*GP*GP*GP*GP*CP*GP*TP*CP*TP*G)-3')
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA04
2I13A 2E72A 2LT7A 2WCC3 2YTIA 1G2DC 2YRKA 1BB8A 2EOFA 2YU8A 1A1FA 1UBDC 2EN3A 2MDGA 2RPCA 2EMBA 1BBOA 1TF3A 2EM4A 2ENCA 1LLMC 2EN8A 1A1LA 1WJPA 2EOMA 2YTPA 2EM7A 3VHTB 2PRTA 1MEYC 2GHFA 2YTNA 3EPHA 5KL7A 2GLIA 2WBSA 2YRHA 4R2EA 2EM5A 2ELYA 4R2SA 2EMLA 2R1FA 2EQ0A 2DLKA 1A1GA 2EN7A 2DMIA 1DGCA 2EOEA 1YSAC 2DRPA 5KL2A 2DLQA 2EOZA 2EMFA 2YU5A 5KL6A 2EQ1A 4M9VC 2JPAA 4F2JC 4X9JA 4IS1C 3MHHC 2EPXA 4R2DA 2EL6A 3EPJA 2EPZA 2EMAA 2EM0A 5KL4A 5KL5A 1ZR9A 2EM2A 1KJKA 2WBUA 2EORA 2EN4A 2EOQA 1A1JA 4R2RA 4F6NA 2LV2A 1ZU1A 1JK2A 2EMIA 2EM8A 2EPUA 2YTEA 1X6HA 2EM3A 4GZNC 2EN1A 2YTQA 2CT1A 1NCSA 2EPCA 2EQ3A 1TF6A 2EMXA 2EJ4A 2LVHA 2YTOA 3MHSC 4R2CA 2EMHA 2EMWA 2EP3A 2NABA 1YUJA 2EOYA 4R2PA 4FK5C 4F6MA 2YTJA 2EMKA 2LCEA 1RMDA 2EOJA 4R2QA 2EOIA 2EN6A 1A1HA 2CSHA 1G2FC 2EM6A 2YTDA 2YTGA 2EL5A 2CTDA 2EMGA 1A1IA 2YSPA 1AAYA 2JP9A 1X6EA 2EOSA 3EPKA 2RSIA 1X3CA 2A25A 2ADRA 2EOHA 3EPLA 2EL4A 1A1KA 1P47A 2D9HA 2EE8A 1UN6B 4R2AA 2EMYA 1X5WA 2EMCA 2ENHA 3M99B 2ENAA 4WSGA 2EMZA 1ZAAC 2DGCA 2YRMA 1YUIA 1F2IG 2EM9A 2J7JA 2EPRA 1Z1BA 2ELZA 2M9AA 3UK3C 1X6FA 2HGHA 2MKNA 2EOXA 2EPPA 1TN9A 2WBTA 2LO3A 2VRDA 1B69A 2EPAA 5KL3A 2MKDA 2YTFA 4IJDA 2BB8A 2YSOA 2EOOA 1JK1A 2EN2A
chains in the Genus database with same CATH superfamily
2JOXA 2KHXA 1N34E 2I13A 2LBSB 2YRKA 4JI7E 4BHBA 4NXME 3BBGA 3BIDA 3T1YE 2EOFA 1QU6A 4NHRA 4YY3E 1A1FA 2EN3A 3T1HE 1BBOA 2V87A 3IWDA 3QG5C 4DR2E 4M30A 4WFTA 3BGHA 2LE2A 2PRTA 3H09A 4L5NC 4F9CB 1J26A 2YRHA 3LMLA 1IMUA 2ELYA 4DR4E 2EPLX 1YYWA 3L00A 4JI1E 1X47A 5T6JA 4JI0E 4BBYA 4B3ME 4F2JC 4X9JA 5IV8B 4IS1C 2V88A 5AE1A 2E1MA 4F9AB 2V8QB 5KL4A 2F4VE 2WBUA 1WHNA 2RS7A 4R2RA 4F6NA 1PKPA 2LV2A 1WHQA 2EM3A 2EN1A 5AC5A 1STUA 2RSMA 1NCSA 2YTOA 2ZM6E 2JXPA 5A6JA 4TUIA 4FK5C 2EMKA 2LCEA 2HJJA 4MLQA 2NUGA 4JYAE 4GEQB 5ADZA 2EOIA 2L6MA 3TQMA 2UXDE 2YTGA 2EL5A 2EMGA 1X6EA 3EPKA 2A25A 1A1KA 2L2KB 2D9HA 2EE8A 1UN6B 2LTSA 1IQOA 1SR9A 2ENAA 2IHR1 3F6GA 2YRMA 1YFHA 4JI3E 2EM9A 2JR1A 4ZYGA 5LMUE 2HGHA 3C4BA 1ZBTA 4F54A 4JV5E 2WBTA 4R8OA 4DV3E 1EKZA 1B69A 4GKKE 2LMZA 4DR1E 4HTGA 2YTFA 2ODRC 4IJDA 5A6BA 3DJWA 1XMOE 4LF6E 1QNTA 4BHCA 2NA2A 2MDRA 1GQEA 2M7QA 1BB8A 3IWCA 4X65E 4AQYE 1GTKA 4NZVA 2YU8A 3JAMC 2MC6A 2EMBA 2RPCA 2ENCA 2L2NA 2EN8A 1EH7A 1T4OA 1L4SA 2B9DA 2K7IA 2FV4B 3VHTB 4DR3E 2EPKX 1RC7A 2L92A 4R2SA 2EPMX 1WRJA 2EMLA 2R1FA 2UUAE 2YT4A 3ADGA 2YPNA 4DV6E 2UUBE 3VK6A 3AV0A 1DGCA 2DRPA 2DLQA 4BC7A 2YU5A 2EQ1A 2VQFE 3J7Yp 3F6HA 3MHHC 2EL6A 2EMAA 1KJKA 1ZR9A 2UUCE 3THNA 2EORA 5LL6R 4WYQB 2JVAA 1ZU1A 1JK2A 1X6HA 4GZNC 2EPOA 2EWLA 3P1XA 4RHBB 2YWQA 1ZBQA 1TF6A 2EJ4A 2LVHA 3MHSC 2LRSA 2LJHA 1FJGE 5IWAE 2YZTA 2EOJA 4R2QA 5A6BD 2E5LE 4MLVA 1G2FC 2RS6A 2JP9A 4O24A 2RSIA 4O4KA 1X3CA 3EPLA 2EL4A 4LF7E 1P47A 4X66E 1PJSA 1PDAA 1X5WA 2ENHA 3M99B 4WSGA 1ZAAC 1DI2A 5AE3A 2KONA 3IWBA 1F2IG 4DR6E 2V86A 2LJUA 1Z1BA 2L3JA 3KZZA 1XMQE 2L3CA 4DKKA 3UK3C 4JI5E 1EH6A 3AUZA 1YYOA 2EOXA 1TN9A 3LLHA 2FTXB 2RQLA 1IBKE 3J7AG 2JOBA 1MGTA 2BB8A 1JK1A 2EN2A 2EZ6A 2N3GA 3ADLA 2YTIA 1G2DC 4KHPE 1UHZA 4OOGC 2BBGA 1UBDC 4BC9A 4O43A 1TF3A 1LLMC 3J81C 2B7TA 1AH5A 2B7VA 2EOMA 2EM7A 3EPHA 1SFEA 5KL7A 4TUGA 2GLIA 2WBSA 3OMLA 2JYAA 2VE7C 4N4RB 4WPYA 2RTXA 2EM5A 5DNYA 4X64E 4WXDA 2EQ0A 2DLKA 4ZYHA 1N32E 4BS9A 2EOEA 2HC5A 1XNRE 4ZYDA 5KL2A 2EPNA 2EMFA 5KL6A 4M9VC 2R76A 2I9IA 1X48A 4DR7E 1I94E 2HHHE 1HNXE 4Q28A 1N33E 4BMJA 1A1JA 1RQ0A 1N3GA 3HXLA 2EMIA 2EM8A 2EPUA 2YTEA 3JTZA 3HQ1A 3ADIA 5A6AA 2EPCA 2EQ3A 4LF9E 4WX9A 2EMXA 2Q8UA 1YPNA 3THOB 4R2CA 3ECRA 1UILA 1X49A 2EOYA 4K0KE 2YTJA 2M4IA 1NEIA 1PJTA 4I8OA 4LTYA 1T39A 1RMDA 4O5GA 3DF6A 2DMYA 4P78A 2GPIA 2YTDA 4LFBE 2CTDA 1A1IA 1AAYA 2EOSA 2JWOA 4ZYEA 4B3RE 4X62E 4JI6E 3FIGA 3C4TA 1O0WA 2V83A 2N8XA 2EOHA 2G7HA 4B3TE 2DIXA 4KZSA 4R2AA 2EMYA 4DV7E 4LF8E 2DB2A 2L33A 4BCAA 1YUIA 2WZOA 4B3SE 1PJQA 4GKJE 3OTOE 4NXNE 4LFCE 2ELZA 1X6FA 2LUQA 4F9BB 2EPPA 5BR8E 2VRDA 4YHHE 4DUZE 2KOUA 4M2ZA 2ODRD 2V85A 2YSPA 4LF4E 2E72A 2LT7A 4DV4E 2WCC3 2F8BA 2N3HA 3ADJA 4L8NA 3KZYA 1J5EE 1FKAE 1IBME 2L2MA 2MDGA 2L8TA 2EM4A 3C6MA 1A1LA 2VQEE 1T4NA 1WJPA 4Q35B 2YTPA 4LU9A 1MEYC 2GHFA 2YTNA 1T4LB 4M0VA 2MC5A 4R2EA 5LLQA 1N36E 2CPNA 1IQSA 5A2QC 3VYYA 4DV5E 4WXCA 3K6QA 2V89A 5CFFE 1A1GA 2EN7A 2DMIA 1EH8A 3VYXA 1YSAC 4R03A 2EOZA 4DV2E 2VF1A 4LF5E 5F3WA 2JPAA 1DQ3A 3MSWA 2H36X 2UU9E 5LMNE 2EPXA 5AASA 4R2DA 4LFAE 4JI2E 3BF2A 3EPJA 1KYQA 2EM0A 2EPZA 3EQ1A 4J8ZA 4RH8A 5KL5A 2EM2A 5AC4A 1XNQE 2EN4A 2EOQA 1HNZE 3J80C 4P7DA 5FLXC 4DMIA 4DV1E 4JI4E 2YTQA 2CT1A 2LTRA 4JI8E 2EMHA 2NUEA 2EMWA 2EP3A 2NABA 1YUJA 2UXBE 4R2PA 3HPZA 4F6MA 1YYKA 3ZOQB 4DUYE 4WSPA 3RMPA 4KWYA 2EN6A 1A1HA 2CSHA 2K4VA 5TSEA 2EM6A 2JY9A 1IBLE 1HR0E 3HTXA 2LUPB 3HPSA 2NUFA 2ADRA 4DR5E 5A69A 2B3TB 5IT9C 1HNWE 3C6KA 2EMCA 1WXRA 2UXCE 4OX9E 2DGCA 2EMZA 3JU0A 4X8WA 5A6KA 2DSYA 2J7JA 4HEIA 2EPRA 1YZ9A 2M1SA 2M9AA 1GZ6A 1T38A 2MKNA 2LO3A 5IXMB 5AE2A 4DV0E 2EPAA 5KL3A 2MKDA 1BBGA 2YSOA 2EOOA 2FGGA 3KWRA
chains in the Genus database with same CATH topology
2I13A 2E72A 2LT7A 2WCC3 2YTIA 1G2DC 2YRKA 1BB8A 2EOFA 2YU8A 1A1FA 1UBDC 2EN3A 2MDGA 2RPCA 2EMBA 1BBOA 1TF3A 2EM4A 2ENCA 1LLMC 2EN8A 1A1LA 1WJPA 2EOMA 2YTPA 2EM7A 3VHTB 2PRTA 1MEYC 2GHFA 2YTNA 3EPHA 5KL7A 2GLIA 2WBSA 2YRHA 4R2EA 2EM5A 2ELYA 4R2SA 2EMLA 2R1FA 2EQ0A 2DLKA 1A1GA 2EN7A 2DMIA 1DGCA 2EOEA 1YSAC 2DRPA 5KL2A 2DLQA 2EOZA 2EMFA 2YU5A 5KL6A 2EQ1A 4M9VC 2JPAA 4F2JC 4X9JA 4IS1C 3MHHC 2EPXA 4R2DA 2EL6A 3EPJA 2EPZA 2EMAA 2EM0A 5KL4A 5KL5A 1ZR9A 2EM2A 1KJKA 2WBUA 2EORA 2EN4A 2EOQA 1A1JA 4R2RA 4F6NA 2LV2A 1ZU1A 1JK2A 2EMIA 2EM8A 2EPUA 2YTEA 1X6HA 2EM3A 4GZNC 2EN1A 2YTQA 2CT1A 1NCSA 2EPCA 2EQ3A 1TF6A 2EMXA 2EJ4A 2LVHA 2YTOA 3MHSC 4R2CA 2EMHA 2EMWA 2EP3A 2NABA 1YUJA 2EOYA 4R2PA 4FK5C 4F6MA 2YTJA 2EMKA 2LCEA 1RMDA 2EOJA 4R2QA 2EOIA 2EN6A 1A1HA 2CSHA 1G2FC 2EM6A 2YTDA 2YTGA 2EL5A 2CTDA 2EMGA 1A1IA 2YSPA 1AAYA 2JP9A 1X6EA 2EOSA 3EPKA 2RSIA 1X3CA 2A25A 2ADRA 2EOHA 3EPLA 2EL4A 1A1KA 1P47A 2D9HA 2EE8A 1UN6B 4R2AA 2EMYA 1X5WA 2EMCA 2ENHA 3M99B 2ENAA 4WSGA 2EMZA 1ZAAC 2DGCA 2YRMA 1YUIA 1F2IG 2EM9A 2J7JA 2EPRA 1Z1BA 2ELZA 2M9AA 3UK3C 1X6FA 2HGHA 2MKNA 2EOXA 2EPPA 1TN9A 2WBTA 2LO3A 2VRDA 1B69A 2EPAA 5KL3A 2MKDA 2YTFA 4IJDA 2BB8A 2YSOA 2EOOA 1JK1A 2EN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I13 A;  2E72 A;  2LT7 A;  2WCC 3;  2YTI A;  1G2D C;  2YRK A;  1BB8 A;  2EOF A;  2YU8 A;  1A1F A;  1UBD C;  2EN3 A;  2MDG A;  2RPC A;  2EMB A;  1BBO A;  1TF3 A;  2EM4 A;  2ENC A;  1LLM C;  2EN8 A;  1A1L A;  1WJP A;  2EOM A;  2YTP A;  2EM7 A;  3VHT B;  2PRT A;  1MEY C;  2GHF A;  2YTN A;  3EPH A;  5KL7 A;  2GLI A;  2WBS A;  2YRH A;  4R2E A;  2EM5 A;  2ELY A;  4R2S A;  2EML A;  2R1F A;  2EQ0 A;  2DLK A;  1A1G A;  2EN7 A;  2DMI A;  1DGC A;  2EOE A;  1YSA C;  2DRP A;  5KL2 A;  2DLQ A;  2EOZ A;  2EMF A;  2YU5 A;  5KL6 A;  2EQ1 A;  4M9V C;  2JPA A;  4F2J C;  4X9J A;  4IS1 C;  3MHH C;  2EPX A;  4R2D A;  2EL6 A;  3EPJ A;  2EPZ A;  2EMA A;  2EM0 A;  5KL4 A;  5KL5 A;  1ZR9 A;  2EM2 A;  1KJK A;  2WBU A;  2EOR A;  2EN4 A;  2EOQ A;  1A1J A;  4R2R A;  4F6N A;  2LV2 A;  1ZU1 A;  1JK2 A;  2EMI A;  2EM8 A;  2EPU A;  2YTE A;  1X6H A;  2EM3 A;  4GZN C;  2EN1 A;  2YTQ A;  2CT1 A;  1NCS A;  2EPC A;  2EQ3 A;  1TF6 A;  2EMX A;  2EJ4 A;  2LVH A;  2YTO A;  3MHS C;  4R2C A;  2EMH A;  2EMW A;  2EP3 A;  2NAB A;  1YUJ A;  2EOY A;  4R2P A;  4FK5 C;  4F6M A;  2YTJ A;  2EMK A;  2LCE A;  1RMD A;  2EOJ A;  4R2Q A;  2EOI A;  2EN6 A;  1A1H A;  2CSH A;  1G2F C;  2EM6 A;  2YTD A;  2YTG A;  2EL5 A;  2CTD A;  2EMG A;  1A1I A;  2YSP A;  1AAY A;  2JP9 A;  1X6E A;  2EOS A;  3EPK A;  2RSI A;  1X3C A;  2A25 A;  2ADR A;  2EOH A;  3EPL A;  2EL4 A;  1A1K A;  1P47 A;  2D9H A;  2EE8 A;  1UN6 B;  4R2A A;  2EMY A;  1X5W A;  2EMC A;  2ENH A;  3M99 B;  2ENA A;  4WSG A;  2EMZ A;  1ZAA C;  2DGC A;  2YRM A;  1YUI A;  1F2I G;  2EM9 A;  2J7J A;  2EPR A;  1Z1B A;  2ELZ A;  2M9A A;  3UK3 C;  1X6F A;  2HGH A;  2MKN A;  2EOX A;  2EPP A;  1TN9 A;  2WBT A;  2LO3 A;  2VRD A;  1B69 A;  2EPA A;  5KL3 A;  2MKD A;  2YTF A;  4IJD A;  2BB8 A;  2YSO A;  2EOO A;  1JK1 A;  2EN2 A; 
#chains in the Genus database with same CATH topology
 2JOX A;  2KHX A;  1N34 E;  2I13 A;  2LBS B;  2YRK A;  4JI7 E;  4BHB A;  4NXM E;  3BBG A;  3BID A;  3T1Y E;  2EOF A;  1QU6 A;  4NHR A;  4YY3 E;  1A1F A;  2EN3 A;  3T1H E;  1BBO A;  2V87 A;  3IWD A;  3QG5 C;  4DR2 E;  4M30 A;  4WFT A;  3BGH A;  2LE2 A;  2PRT A;  3H09 A;  4L5N C;  4F9C B;  1J26 A;  2YRH A;  3LML A;  1IMU A;  2ELY A;  4DR4 E;  2EPL X;  1YYW A;  3L00 A;  4JI1 E;  1X47 A;  5T6J A;  4JI0 E;  4BBY A;  4B3M E;  4F2J C;  4X9J A;  5IV8 B;  4IS1 C;  2V88 A;  5AE1 A;  2E1M A;  4F9A B;  2V8Q B;  5KL4 A;  2F4V E;  2WBU A;  1WHN A;  2RS7 A;  4R2R A;  4F6N A;  1PKP A;  2LV2 A;  1WHQ A;  2EM3 A;  2EN1 A;  5AC5 A;  1STU A;  2RSM A;  1NCS A;  2YTO A;  2ZM6 E;  2JXP A;  5A6J A;  4TUI A;  4FK5 C;  2EMK A;  2LCE A;  2HJJ A;  4MLQ A;  2NUG A;  4JYA E;  4GEQ B;  5ADZ A;  2EOI A;  2L6M A;  3TQM A;  2UXD E;  2YTG A;  2EL5 A;  2EMG A;  1X6E A;  3EPK A;  2A25 A;  1A1K A;  2L2K B;  2D9H A;  2EE8 A;  1UN6 B;  2LTS A;  1IQO A;  1SR9 A;  2ENA A;  2IHR 1;  3F6G A;  2YRM A;  1YFH A;  4JI3 E;  2EM9 A;  2JR1 A;  4ZYG A;  5LMU E;  2HGH A;  3C4B A;  1ZBT A;  4F54 A;  4JV5 E;  2WBT A;  4R8O A;  4DV3 E;  1EKZ A;  1B69 A;  4GKK E;  2LMZ A;  4DR1 E;  4HTG A;  2YTF A;  2ODR C;  4IJD A;  5A6B A;  3DJW A;  1XMO E;  4LF6 E;  1QNT A;  4BHC A;  2NA2 A;  2MDR A;  1GQE A;  2M7Q A;  1BB8 A;  3IWC A;  4X65 E;  4AQY E;  1GTK A;  4NZV A;  2YU8 A;  3JAM C;  2MC6 A;  2EMB A;  2RPC A;  2ENC A;  2L2N A;  2EN8 A;  1EH7 A;  1T4O A;  1L4S A;  2B9D A;  2K7I A;  2FV4 B;  3VHT B;  4DR3 E;  2EPK X;  1RC7 A;  2L92 A;  4R2S A;  2EPM X;  1WRJ A;  2EML A;  2R1F A;  2UUA E;  2YT4 A;  3ADG A;  2YPN A;  4DV6 E;  2UUB E;  3VK6 A;  3AV0 A;  1DGC A;  2DRP A;  2DLQ A;  4BC7 A;  2YU5 A;  2EQ1 A;  2VQF E;  3J7Y p;  3F6H A;  3MHH C;  2EL6 A;  2EMA A;  1KJK A;  1ZR9 A;  2UUC E;  3THN A;  2EOR A;  5LL6 R;  4WYQ B;  2JVA A;  1ZU1 A;  1JK2 A;  1X6H A;  4GZN C;  2EPO A;  2EWL A;  3P1X A;  4RHB B;  2YWQ A;  1ZBQ A;  1TF6 A;  2EJ4 A;  2LVH A;  3MHS C;  2LRS A;  2LJH A;  1FJG E;  5IWA E;  2YZT A;  2EOJ A;  4R2Q A;  5A6B D;  2E5L E;  4MLV A;  1G2F C;  2RS6 A;  2JP9 A;  4O24 A;  2RSI A;  4O4K A;  1X3C A;  3EPL A;  2EL4 A;  4LF7 E;  1P47 A;  4X66 E;  1PJS A;  1PDA A;  1X5W A;  2ENH A;  3M99 B;  4WSG A;  1ZAA C;  1DI2 A;  5AE3 A;  2KON A;  3IWB A;  1F2I G;  4DR6 E;  2V86 A;  2LJU A;  1Z1B A;  2L3J A;  3KZZ A;  1XMQ E;  2L3C A;  4DKK A;  3UK3 C;  4JI5 E;  1EH6 A;  3AUZ A;  1YYO A;  2EOX A;  1TN9 A;  3LLH A;  2FTX B;  2RQL A;  1IBK E;  3J7A G;  2JOB A;  1MGT A;  2BB8 A;  1JK1 A;  2EN2 A;  2EZ6 A;  2N3G A;  3ADL A;  2YTI A;  1G2D C;  4KHP E;  1UHZ A;  4OOG C;  2BBG A;  1UBD C;  4BC9 A;  4O43 A;  1TF3 A;  1LLM C;  3J81 C;  2B7T A;  1AH5 A;  2B7V A;  2EOM A;  2EM7 A;  3EPH A;  1SFE A;  5KL7 A;  4TUG A;  2GLI A;  2WBS A;  3OML A;  2JYA A;  2VE7 C;  4N4R B;  4WPY A;  2RTX A;  2EM5 A;  5DNY A;  4X64 E;  4WXD A;  2EQ0 A;  2DLK A;  4ZYH A;  1N32 E;  4BS9 A;  2EOE A;  2HC5 A;  1XNR E;  4ZYD A;  5KL2 A;  2EPN A;  2EMF A;  5KL6 A;  4M9V C;  2R76 A;  2I9I A;  1X48 A;  4DR7 E;  1I94 E;  2HHH E;  1HNX E;  4Q28 A;  1N33 E;  4BMJ A;  1A1J A;  1RQ0 A;  1N3G A;  3HXL A;  2EMI A;  2EM8 A;  2EPU A;  2YTE A;  3JTZ A;  3HQ1 A;  3ADI A;  5A6A A;  2EPC A;  2EQ3 A;  4LF9 E;  4WX9 A;  2EMX A;  2Q8U A;  1YPN A;  3THO B;  4R2C A;  3ECR A;  1UIL A;  1X49 A;  2EOY A;  4K0K E;  2YTJ A;  2M4I A;  1NEI A;  1PJT A;  4I8O A;  4LTY A;  1T39 A;  1RMD A;  4O5G A;  3DF6 A;  2DMY A;  4P78 A;  2GPI A;  2YTD A;  4LFB E;  2CTD A;  1A1I A;  1AAY A;  2EOS A;  2JWO A;  4ZYE A;  4B3R E;  4X62 E;  4JI6 E;  3FIG A;  3C4T A;  1O0W A;  2V83 A;  2N8X A;  2EOH A;  2G7H A;  4B3T E;  2DIX A;  4KZS A;  4R2A A;  2EMY A;  4DV7 E;  4LF8 E;  2DB2 A;  2L33 A;  4BCA A;  1YUI A;  2WZO A;  4B3S E;  1PJQ A;  4GKJ E;  3OTO E;  4NXN E;  4LFC E;  2ELZ A;  1X6F A;  2LUQ A;  4F9B B;  2EPP A;  5BR8 E;  2VRD A;  4YHH E;  4DUZ E;  2KOU A;  4M2Z A;  2ODR D;  2V85 A;  2YSP A;  4LF4 E;  2E72 A;  2LT7 A;  4DV4 E;  2WCC 3;  2F8B A;  2N3H A;  3ADJ A;  4L8N A;  3KZY A;  1J5E E;  1FKA E;  1IBM E;  2L2M A;  2MDG A;  2L8T A;  2EM4 A;  3C6M A;  1A1L A;  2VQE E;  1T4N A;  1WJP A;  4Q35 B;  2YTP A;  4LU9 A;  1MEY C;  2GHF A;  2YTN A;  1T4L B;  4M0V A;  2MC5 A;  4R2E A;  5LLQ A;  1N36 E;  2CPN A;  1IQS A;  5A2Q C;  3VYY A;  4DV5 E;  4WXC A;  3K6Q A;  2V89 A;  5CFF E;  1A1G A;  2EN7 A;  2DMI A;  1EH8 A;  3VYX A;  1YSA C;  4R03 A;  2EOZ A;  4DV2 E;  2VF1 A;  4LF5 E;  5F3W A;  2JPA A;  1DQ3 A;  3MSW A;  2H36 X;  2UU9 E;  5LMN E;  2EPX A;  5AAS A;  4R2D A;  4LFA E;  4JI2 E;  3BF2 A;  3EPJ A;  1KYQ A;  2EM0 A;  2EPZ A;  3EQ1 A;  4J8Z A;  4RH8 A;  5KL5 A;  2EM2 A;  5AC4 A;  1XNQ E;  2EN4 A;  2EOQ A;  1HNZ E;  3J80 C;  4P7D A;  5FLX C;  4DMI A;  4DV1 E;  4JI4 E;  2YTQ A;  2CT1 A;  2LTR A;  4JI8 E;  2EMH A;  2NUE A;  2EMW A;  2EP3 A;  2NAB A;  1YUJ A;  2UXB E;  4R2P A;  3HPZ A;  4F6M A;  1YYK A;  3ZOQ B;  4DUY E;  4WSP A;  3RMP A;  4KWY A;  2EN6 A;  1A1H A;  2CSH A;  2K4V A;  5TSE A;  2EM6 A;  2JY9 A;  1IBL E;  1HR0 E;  3HTX A;  2LUP B;  3HPS A;  2NUF A;  2ADR A;  4DR5 E;  5A69 A;  2B3T B;  5IT9 C;  1HNW E;  3C6K A;  2EMC A;  1WXR A;  2UXC E;  4OX9 E;  2DGC A;  2EMZ A;  3JU0 A;  4X8W A;  5A6K A;  2DSY A;  2J7J A;  4HEI A;  2EPR A;  1YZ9 A;  2M1S A;  2M9A A;  1GZ6 A;  1T38 A;  2MKN A;  2LO3 A;  5IXM B;  5AE2 A;  4DV0 E;  2EPA A;  5KL3 A;  2MKD A;  1BBG A;  2YSO A;  2EOO A;  2FGG A;  3KWR A; 
#chains in the Genus database with same CATH homology
 2I13 A;  2E72 A;  2LT7 A;  2WCC 3;  2YTI A;  1G2D C;  2YRK A;  1BB8 A;  2EOF A;  2YU8 A;  1A1F A;  1UBD C;  2EN3 A;  2MDG A;  2RPC A;  2EMB A;  1BBO A;  1TF3 A;  2EM4 A;  2ENC A;  1LLM C;  2EN8 A;  1A1L A;  1WJP A;  2EOM A;  2YTP A;  2EM7 A;  3VHT B;  2PRT A;  1MEY C;  2GHF A;  2YTN A;  3EPH A;  5KL7 A;  2GLI A;  2WBS A;  2YRH A;  4R2E A;  2EM5 A;  2ELY A;  4R2S A;  2EML A;  2R1F A;  2EQ0 A;  2DLK A;  1A1G A;  2EN7 A;  2DMI A;  1DGC A;  2EOE A;  1YSA C;  2DRP A;  5KL2 A;  2DLQ A;  2EOZ A;  2EMF A;  2YU5 A;  5KL6 A;  2EQ1 A;  4M9V C;  2JPA A;  4F2J C;  4X9J A;  4IS1 C;  3MHH C;  2EPX A;  4R2D A;  2EL6 A;  3EPJ A;  2EPZ A;  2EMA A;  2EM0 A;  5KL4 A;  5KL5 A;  1ZR9 A;  2EM2 A;  1KJK A;  2WBU A;  2EOR A;  2EN4 A;  2EOQ A;  1A1J A;  4R2R A;  4F6N A;  2LV2 A;  1ZU1 A;  1JK2 A;  2EMI A;  2EM8 A;  2EPU A;  2YTE A;  1X6H A;  2EM3 A;  4GZN C;  2EN1 A;  2YTQ A;  2CT1 A;  1NCS A;  2EPC A;  2EQ3 A;  1TF6 A;  2EMX A;  2EJ4 A;  2LVH A;  2YTO A;  3MHS C;  4R2C A;  2EMH A;  2EMW A;  2EP3 A;  2NAB A;  1YUJ A;  2EOY A;  4R2P A;  4FK5 C;  4F6M A;  2YTJ A;  2EMK A;  2LCE A;  1RMD A;  2EOJ A;  4R2Q A;  2EOI A;  2EN6 A;  1A1H A;  2CSH A;  1G2F C;  2EM6 A;  2YTD A;  2YTG A;  2EL5 A;  2CTD A;  2EMG A;  1A1I A;  2YSP A;  1AAY A;  2JP9 A;  1X6E A;  2EOS A;  3EPK A;  2RSI A;  1X3C A;  2A25 A;  2ADR A;  2EOH A;  3EPL A;  2EL4 A;  1A1K A;  1P47 A;  2D9H A;  2EE8 A;  1UN6 B;  4R2A A;  2EMY A;  1X5W A;  2EMC A;  2ENH A;  3M99 B;  2ENA A;  4WSG A;  2EMZ A;  1ZAA C;  2DGC A;  2YRM A;  1YUI A;  1F2I G;  2EM9 A;  2J7J A;  2EPR A;  1Z1B A;  2ELZ A;  2M9A A;  3UK3 C;  1X6F A;  2HGH A;  2MKN A;  2EOX A;  2EPP A;  1TN9 A;  2WBT A;  2LO3 A;  2VRD A;  1B69 A;  2EPA A;  5KL3 A;  2MKD A;  2YTF A;  4IJD A;  2BB8 A;  2YSO A;  2EOO A;  1JK1 A;  2EN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...