2PRTA

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
b'RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*CP*GP*CP*GP*GP*GP*GP*GP*CP*GP*TP*CP*TP*G)-3')
publication title Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA04
2CSHA 2EMFA 1A1LA 1ZU1A 2EM4A 2GLIA 2WBSA 2YU5A 3MHSC 1RMDA 1YSAC 4X9JA 5KL3A 4IS1C 1UN6B 2YTOA 1TN9A 2M9AA 4WSGA 1WJPA 2YTIA 4R2AA 2EOMA 2JPAA 2LO3A 2EOEA 2YTGA 1X6FA 2EMXA 2EPRA 2EM7A 2GHFA 2DLKA 1A1HA 2EOXA 1G2DC 2YTJA 2A25A 2YTQA 2YTDA 2EN1A 2EOZA 2EL6A 5KL6A 2JP9A 2EMCA 2EORA 2YU8A 4R2RA 4F2JC 1P47A 2BB8A 2EMYA 2LT7A 2EMLA 3EPKA 2CTDA 2EM8A 2EOHA 4F6NA 2EPAA 1YUIA 1Z1BA 2YTFA 3UK3C 2EN4A 2ADRA 2YSOA 2EQ3A 2ENAA 1TF3A 4M9VC 2YTEA 1BB8A 2YTNA 1G2FC 2WBTA 2DGCA 3EPJA 2RPCA 4FK5C 2EOOA 1ZAAC 4GZNC 4R2PA 3EPHA 1B69A 1BBOA 2LVHA 2YSPA 2MKDA 2VRDA 2J7JA 3EPLA 2ELZA 2EMKA 2EM6A 4R2QA 1ZR9A 4IJDA 2DMIA 2WCC3 2EM0A 2E72A 2YTPA 2I13A 1X3CA 1TF6A 2ELYA 2HGHA 2EOSA 2EE8A 1AAYA 1X6HA 2EOYA 2D9HA 5KL2A 2EOFA 2ENCA 2EQ1A 2YRMA 1A1KA 2R1FA 4R2CA 2RSIA 2CT1A 5KL7A 2PRTA 2YRKA 1X6EA 2EN3A 2EMZA 4R2EA 2EQ0A 2EP3A 2EPPA 1F2IG 2EPUA 2YRHA 1JK1A 1A1FA 1YUJA 1MEYC 2WBUA 2EN7A 2DLQA 1A1IA 2EMGA 1KJKA 1NCSA 4R2DA 2ENHA 1A1JA 1UBDC 2EN8A 2EPCA 2EN6A 3MHHC 2LV2A 4F6MA 2EPZA 2EMBA 2EM5A 2EOJA 1X5WA 2EN2A 2EMAA 1LLMC 5KL5A 2EMHA 2NABA 5KL4A 3M99B 2MDGA 2EM2A 3VHTB 2EL5A 2EM9A 2EMWA 2LCEA 2MKNA 2EOQA 1DGCA 2EOIA 2EL4A 2EM3A 2EMIA 1JK2A 2EJ4A 2EPXA 1A1GA 2DRPA 4R2SA
chains in the Genus database with same CATH superfamily
3VYYA 1A1LA 1ZU1A 2GLIA 5IV8B 2YU5A 4ZYEA 4X9JA 1T39A 2K7IA 1WJPA 3QG5C 1YZ9A 4F9AB 1GZ6A 2JPAA 1MGTA 3ZOQB 2LTSA 4LF8E 4NXNE 4B3TE 4O43A 4JI3E 2H36X 1IBME 2YTJA 4M0VA 1SR9A 4KHPE 3EQ1A 5TSEA 3ECRA 1UILA 2V83A 2YU8A 1P47A 3F6HA 1X47A 2N3HA 3BF2A 4JV5E 4AQYE 3KZZA 2CTDA 4TUGA 5IWAE 1UHZA 4LTYA 4JI7E 3C4BA 2KONA 1TF3A 4WYQB 2EPKX 1N36E 2NUFA 2LE2A 2V8QB 2DGCA 3EPJA 4WX9A 3RMPA 4LFAE 2ZM6E 2UUCE 2V87A 4R2PA 1PJSA 1WRJA 2YSPA 2LJHA 4R03A 2EMKA 2EM6A 1YYOA 2DMIA 2WCC3 5LMUE 4GKJE 2YTPA 2WZOA 1QU6A 2RS6A 2EOSA 1SFEA 2V85A 2EOYA 5KL2A 1X48A 2HHHE 2LUPB 4R2CA 2IHR1 2PRTA 3IWBA 4Q28A 3P1XA 1NEIA 2EP3A 1A1FA 4JI1E 1MEYC 3ADGA 1KJKA 2DLQA 4O4KA 2L3JA 1PJTA 4B3SE 1HNXE 3C6MA 2HC5A 2EN6A 3MHHC 2LV2A 4RHBB 2EM5A 3MSWA 1IBKE 2EMAA 3K6QA 2LRSA 1IQSA 3VHTB 1EKZA 1PKPA 2EM9A 2B7VA 2LCEA 5ADZA 2EOQA 2K4VA 4BMJA 2EPMX 5A2QC 1JK2A 2DRPA 1N3GA 4Q35B 2RTXA 2G7HA 4K0KE 1YSAC 3OMLA 4BBYA 1XMOE 2NUGA 1TN9A 4WFTA 2N3GA 4DV0E 3JU0A 2YTIA 2EOEA 3J80C 1XMQE 2EM7A 2YPNA 5AC4A 2EOXA 2GPIA 2YTQA 2YTDA 1DQ3A 2EL6A 4R2RA 5AASA 4WXDA 1HR0E 4DR2E 4OOGC 2JY9A 2NA2A 2LT7A 3ADLA 3HPZA 2DIXA 2L8TA 3HXLA 1T4LB 1Z1BA 2EN4A 4LU9A 1IQOA 1J5EE 2M4IA 2ENAA 2YTEA 4M2ZA 4YHHE 1BB8A 2DSYA 1G2FC 1XNRE 3C6KA 4X64E 2FGGA 2VQEE 4BC7A 4FK5C 2N8XA 2UXCE 4KZSA 1B69A 3VK6A 4X65E 2MKDA 3EPLA 2E5LE 2B7TA 4DV3E 4OX9E 1ZR9A 3THOB 4ZYHA 4RH8A 2L6MA 1XNQE 4L8NA 2I13A 2UU9E 5DNYA 2DB2A 4O24A 4BS9A 2ELYA 1WHNA 2MC5A 1ZBTA 5CFFE 2EOFA 3DF6A 4F9CB 2YRMA 3H09A 4DR3E 2RSIA 2CT1A 4LFBE 5KL7A 4LF5E 2EMZA 5AE1A 4JI6E 1T4NA 4R2EA 5IXMB 2EPUA 1F2IG 3ADIA 4MLVA 1T38A 2EN7A 1A1IA 2EMGA 4X66E 4R2DA 3ADJA 4BHBA 4WSPA 3F6GA 1GTKA 3J81C 1L4SA 2EPCA 5A6BD 1WXRA 4F6MA 1N32E 2EPZA 5AE2A 1YYWA 4JI0E 2EN2A 2V88A 2NABA 5KL4A 1IBLE 2EM2A 1DGCA 1PJQA 2EL4A 1HNWE 5AE3A 2RQLA 4R2SA 1N34E 2B3TB 2R76A 2EMFA 5LMNE 3MHSC 4DV1E 3HQ1A 4IS1C 2YTOA 4F9BB 2M9AA 2LTRA 2UUAE 2EOMA 5LL6R 3BGHA 2EMXA 2EPRA 2EPNA 1A1HA 4DR1E 5A6KA 2DMYA 1RQ0A 2L33A 4J8ZA 3DJWA 5KL6A 1T4OA 5F3WA 2EORA 4BCAA 4NXME 2B9DA 2EM8A 4F6NA 3LMLA 4L5NC 2YTFA 1N33E 3T1YE 1FKAE 2YT4A 2EQ3A 4LFCE 4HTGA 4M9VC 5A6BA 3JAMC 4DKKA 2WBTA 3HPSA 4DR6E 3J7AG 4NZVA 4DR5E 4KWYA 2EOOA 4GZNC 3EPHA 5AC5A 2L3CA 4GEQB 2LVHA 4I8OA 2VRDA 2J7JA 3FIGA 2ELZA 3BBGA 4R2QA 3T1HE 4JI8E 2KOUA 4JI5E 2E72A 4DV5E 2F4VE 1TF6A 4DV6E 1FJGE 1I94E 2EE8A 4B3ME 2JYAA 2EQ1A 3AUZA 1YFHA 2V89A 4LF9E 2YRKA 1X6EA 2EN3A 4M30A 4R8OA 3AV0A 1PDAA 4JYAE 2EQ0A 2KHXA 1JK1A 1NCSA 2JOBA 4DV2E 1YYKA 2JVAA 1A1JA 2JOXA 1UBDC 2EN8A 1STUA 2LBSB 2M7QA 2EOJA 3OTOE 2JR1A 2V86A 2UXBE 3M99B 2JWOA 2MDGA 3BIDA 3THNA 2M1SA 4DMIA 2EOIA 3KWRA 1X49A 2EM3A 4DR4E 2L2KB 2FTXB 4NHRA 2CSHA 2EM4A 2WBSA 4F54A 1RMDA 1ZBQA 5KL3A 1EH7A 1UN6B 5A6JA 4N4RB 2Q8UA 4DR7E 4WSGA 3TQMA 1HNZE 3JTZA 4R2AA 2I9IA 3L00A 4HEIA 2LO3A 2YTGA 4MLQA 4JI2E 1X6FA 2GHFA 2DLKA 5T6JA 1G2DC 2ODRC 2A25A 2EN1A 2EOZA 4ZYGA 2L92A 2JP9A 2EMCA 4F2JC 2YZTA 1DI2A 2BB8A 2EMYA 2EMLA 2HJJA 3EPKA 2EOHA 2EPAA 1YUIA 2EPOA 3UK3C 4YY3E 2ADRA 2CPNA 2YSOA 2RSMA 1EH6A 2LUQA 5LLQA 4X62E 4BHCA 4LF6E 2YTNA 2LMZA 2MDRA 2F8BA 2RPCA 4DUYE 2RS7A 2EPLX 1QNTA 5A6AA 1ZAAC 1AH5A 1BBOA 2LJUA 2UUBE 3IWCA 2L2NA 4IJDA 4GKKE 4JI4E 2YWQA 4ZYDA 2EM0A 3VYXA 2EWLA 5BR8E 1IMUA 2NUEA 4LF7E 1RC7A 1X3CA 4P78A 1YPNA 3LLHA 2HGHA 3C4TA 1AAYA 1X6HA 2D9HA 4B3RE 1BBGA 2ENCA 1A1KA 2R1FA 3KZYA 4P7DA 3J7Yp 4TUIA 1J26A 3HTXA 4O5GA 2ODRD 5A69A 3IWDA 2EPPA 4DV7E 4X8WA 2YRHA 1YUJA 4WPYA 2WBUA 2VF1A 5FLXC 4DV4E 2L2MA 2BBGA 1WHQA 2ENHA 2VE7C 5IT9C 4DUZE 2VQFE 1EH8A 1GQEA 2EMBA 1O0WA 4BC9A 1X5WA 1LLMC 2UXDE 2JXPA 5KL5A 2EMHA 4LF4E 2EL5A 2EMWA 2MKNA 4WXCA 1KYQA 2FV4B 2EMIA 2EJ4A 2EPXA 1A1GA 2MC6A 2E1MA 2EZ6A
chains in the Genus database with same CATH topology
2CSHA 2EMFA 1A1LA 1ZU1A 2EM4A 2GLIA 2WBSA 2YU5A 3MHSC 1RMDA 1YSAC 4X9JA 5KL3A 4IS1C 1UN6B 2YTOA 1TN9A 2M9AA 4WSGA 1WJPA 2YTIA 4R2AA 2EOMA 2JPAA 2LO3A 2EOEA 2YTGA 1X6FA 2EMXA 2EPRA 2EM7A 2GHFA 2DLKA 1A1HA 2EOXA 1G2DC 2YTJA 2A25A 2YTQA 2YTDA 2EN1A 2EOZA 2EL6A 5KL6A 2JP9A 2EMCA 2EORA 2YU8A 4R2RA 4F2JC 1P47A 2BB8A 2EMYA 2LT7A 2EMLA 3EPKA 2CTDA 2EM8A 2EOHA 4F6NA 2EPAA 1YUIA 1Z1BA 2YTFA 3UK3C 2EN4A 2ADRA 2YSOA 2EQ3A 2ENAA 1TF3A 4M9VC 2YTEA 1BB8A 2YTNA 1G2FC 2WBTA 2DGCA 3EPJA 2RPCA 4FK5C 2EOOA 1ZAAC 4GZNC 4R2PA 3EPHA 1B69A 1BBOA 2LVHA 2YSPA 2MKDA 2VRDA 2J7JA 3EPLA 2ELZA 2EMKA 2EM6A 4R2QA 1ZR9A 4IJDA 2DMIA 2WCC3 2EM0A 2E72A 2YTPA 2I13A 1X3CA 1TF6A 2ELYA 2HGHA 2EOSA 2EE8A 1AAYA 1X6HA 2EOYA 2D9HA 5KL2A 2EOFA 2ENCA 2EQ1A 2YRMA 1A1KA 2R1FA 4R2CA 2RSIA 2CT1A 5KL7A 2PRTA 2YRKA 1X6EA 2EN3A 2EMZA 4R2EA 2EQ0A 2EP3A 2EPPA 1F2IG 2EPUA 2YRHA 1JK1A 1A1FA 1YUJA 1MEYC 2WBUA 2EN7A 2DLQA 1A1IA 2EMGA 1KJKA 1NCSA 4R2DA 2ENHA 1A1JA 1UBDC 2EN8A 2EPCA 2EN6A 3MHHC 2LV2A 4F6MA 2EPZA 2EMBA 2EM5A 2EOJA 1X5WA 2EN2A 2EMAA 1LLMC 5KL5A 2EMHA 2NABA 5KL4A 3M99B 2MDGA 2EM2A 3VHTB 2EL5A 2EM9A 2EMWA 2LCEA 2MKNA 2EOQA 1DGCA 2EOIA 2EL4A 2EM3A 2EMIA 1JK2A 2EJ4A 2EPXA 1A1GA 2DRPA 4R2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSH A;  2EMF A;  1A1L A;  1ZU1 A;  2EM4 A;  2GLI A;  2WBS A;  2YU5 A;  3MHS C;  1RMD A;  1YSA C;  4X9J A;  5KL3 A;  4IS1 C;  1UN6 B;  2YTO A;  1TN9 A;  2M9A A;  4WSG A;  1WJP A;  2YTI A;  4R2A A;  2EOM A;  2JPA A;  2LO3 A;  2EOE A;  2YTG A;  1X6F A;  2EMX A;  2EPR A;  2EM7 A;  2GHF A;  2DLK A;  1A1H A;  2EOX A;  1G2D C;  2YTJ A;  2A25 A;  2YTQ A;  2YTD A;  2EN1 A;  2EOZ A;  2EL6 A;  5KL6 A;  2JP9 A;  2EMC A;  2EOR A;  2YU8 A;  4R2R A;  4F2J C;  1P47 A;  2BB8 A;  2EMY A;  2LT7 A;  2EML A;  3EPK A;  2CTD A;  2EM8 A;  2EOH A;  4F6N A;  2EPA A;  1YUI A;  1Z1B A;  2YTF A;  3UK3 C;  2EN4 A;  2ADR A;  2YSO A;  2EQ3 A;  2ENA A;  1TF3 A;  4M9V C;  2YTE A;  1BB8 A;  2YTN A;  1G2F C;  2WBT A;  2DGC A;  3EPJ A;  2RPC A;  4FK5 C;  2EOO A;  1ZAA C;  4GZN C;  4R2P A;  3EPH A;  1B69 A;  1BBO A;  2LVH A;  2YSP A;  2MKD A;  2VRD A;  2J7J A;  3EPL A;  2ELZ A;  2EMK A;  2EM6 A;  4R2Q A;  1ZR9 A;  4IJD A;  2DMI A;  2WCC 3;  2EM0 A;  2E72 A;  2YTP A;  2I13 A;  1X3C A;  1TF6 A;  2ELY A;  2HGH A;  2EOS A;  2EE8 A;  1AAY A;  1X6H A;  2EOY A;  2D9H A;  5KL2 A;  2EOF A;  2ENC A;  2EQ1 A;  2YRM A;  1A1K A;  2R1F A;  4R2C A;  2RSI A;  2CT1 A;  5KL7 A;  2PRT A;  2YRK A;  1X6E A;  2EN3 A;  2EMZ A;  4R2E A;  2EQ0 A;  2EP3 A;  2EPP A;  1F2I G;  2EPU A;  2YRH A;  1JK1 A;  1A1F A;  1YUJ A;  1MEY C;  2WBU A;  2EN7 A;  2DLQ A;  1A1I A;  2EMG A;  1KJK A;  1NCS A;  4R2D A;  2ENH A;  1A1J A;  1UBD C;  2EN8 A;  2EPC A;  2EN6 A;  3MHH C;  2LV2 A;  4F6M A;  2EPZ A;  2EMB A;  2EM5 A;  2EOJ A;  1X5W A;  2EN2 A;  2EMA A;  1LLM C;  5KL5 A;  2EMH A;  2NAB A;  5KL4 A;  3M99 B;  2MDG A;  2EM2 A;  3VHT B;  2EL5 A;  2EM9 A;  2EMW A;  2LCE A;  2MKN A;  2EOQ A;  1DGC A;  2EOI A;  2EL4 A;  2EM3 A;  2EMI A;  1JK2 A;  2EJ4 A;  2EPX A;  1A1G A;  2DRP A;  4R2S A; 
#chains in the Genus database with same CATH topology
 3VYY A;  1A1L A;  1ZU1 A;  2GLI A;  5IV8 B;  2YU5 A;  4ZYE A;  4X9J A;  1T39 A;  2K7I A;  1WJP A;  3QG5 C;  1YZ9 A;  4F9A B;  1GZ6 A;  2JPA A;  1MGT A;  3ZOQ B;  2LTS A;  4LF8 E;  4NXN E;  4B3T E;  4O43 A;  4JI3 E;  2H36 X;  1IBM E;  2YTJ A;  4M0V A;  1SR9 A;  4KHP E;  3EQ1 A;  5TSE A;  3ECR A;  1UIL A;  2V83 A;  2YU8 A;  1P47 A;  3F6H A;  1X47 A;  2N3H A;  3BF2 A;  4JV5 E;  4AQY E;  3KZZ A;  2CTD A;  4TUG A;  5IWA E;  1UHZ A;  4LTY A;  4JI7 E;  3C4B A;  2KON A;  1TF3 A;  4WYQ B;  2EPK X;  1N36 E;  2NUF A;  2LE2 A;  2V8Q B;  2DGC A;  3EPJ A;  4WX9 A;  3RMP A;  4LFA E;  2ZM6 E;  2UUC E;  2V87 A;  4R2P A;  1PJS A;  1WRJ A;  2YSP A;  2LJH A;  4R03 A;  2EMK A;  2EM6 A;  1YYO A;  2DMI A;  2WCC 3;  5LMU E;  4GKJ E;  2YTP A;  2WZO A;  1QU6 A;  2RS6 A;  2EOS A;  1SFE A;  2V85 A;  2EOY A;  5KL2 A;  1X48 A;  2HHH E;  2LUP B;  4R2C A;  2IHR 1;  2PRT A;  3IWB A;  4Q28 A;  3P1X A;  1NEI A;  2EP3 A;  1A1F A;  4JI1 E;  1MEY C;  3ADG A;  1KJK A;  2DLQ A;  4O4K A;  2L3J A;  1PJT A;  4B3S E;  1HNX E;  3C6M A;  2HC5 A;  2EN6 A;  3MHH C;  2LV2 A;  4RHB B;  2EM5 A;  3MSW A;  1IBK E;  2EMA A;  3K6Q A;  2LRS A;  1IQS A;  3VHT B;  1EKZ A;  1PKP A;  2EM9 A;  2B7V A;  2LCE A;  5ADZ A;  2EOQ A;  2K4V A;  4BMJ A;  2EPM X;  5A2Q C;  1JK2 A;  2DRP A;  1N3G A;  4Q35 B;  2RTX A;  2G7H A;  4K0K E;  1YSA C;  3OML A;  4BBY A;  1XMO E;  2NUG A;  1TN9 A;  4WFT A;  2N3G A;  4DV0 E;  3JU0 A;  2YTI A;  2EOE A;  3J80 C;  1XMQ E;  2EM7 A;  2YPN A;  5AC4 A;  2EOX A;  2GPI A;  2YTQ A;  2YTD A;  1DQ3 A;  2EL6 A;  4R2R A;  5AAS A;  4WXD A;  1HR0 E;  4DR2 E;  4OOG C;  2JY9 A;  2NA2 A;  2LT7 A;  3ADL A;  3HPZ A;  2DIX A;  2L8T A;  3HXL A;  1T4L B;  1Z1B A;  2EN4 A;  4LU9 A;  1IQO A;  1J5E E;  2M4I A;  2ENA A;  2YTE A;  4M2Z A;  4YHH E;  1BB8 A;  2DSY A;  1G2F C;  1XNR E;  3C6K A;  4X64 E;  2FGG A;  2VQE E;  4BC7 A;  4FK5 C;  2N8X A;  2UXC E;  4KZS A;  1B69 A;  3VK6 A;  4X65 E;  2MKD A;  3EPL A;  2E5L E;  2B7T A;  4DV3 E;  4OX9 E;  1ZR9 A;  3THO B;  4ZYH A;  4RH8 A;  2L6M A;  1XNQ E;  4L8N A;  2I13 A;  2UU9 E;  5DNY A;  2DB2 A;  4O24 A;  4BS9 A;  2ELY A;  1WHN A;  2MC5 A;  1ZBT A;  5CFF E;  2EOF A;  3DF6 A;  4F9C B;  2YRM A;  3H09 A;  4DR3 E;  2RSI A;  2CT1 A;  4LFB E;  5KL7 A;  4LF5 E;  2EMZ A;  5AE1 A;  4JI6 E;  1T4N A;  4R2E A;  5IXM B;  2EPU A;  1F2I G;  3ADI A;  4MLV A;  1T38 A;  2EN7 A;  1A1I A;  2EMG A;  4X66 E;  4R2D A;  3ADJ A;  4BHB A;  4WSP A;  3F6G A;  1GTK A;  3J81 C;  1L4S A;  2EPC A;  5A6B D;  1WXR A;  4F6M A;  1N32 E;  2EPZ A;  5AE2 A;  1YYW A;  4JI0 E;  2EN2 A;  2V88 A;  2NAB A;  5KL4 A;  1IBL E;  2EM2 A;  1DGC A;  1PJQ A;  2EL4 A;  1HNW E;  5AE3 A;  2RQL A;  4R2S A;  1N34 E;  2B3T B;  2R76 A;  2EMF A;  5LMN E;  3MHS C;  4DV1 E;  3HQ1 A;  4IS1 C;  2YTO A;  4F9B B;  2M9A A;  2LTR A;  2UUA E;  2EOM A;  5LL6 R;  3BGH A;  2EMX A;  2EPR A;  2EPN A;  1A1H A;  4DR1 E;  5A6K A;  2DMY A;  1RQ0 A;  2L33 A;  4J8Z A;  3DJW A;  5KL6 A;  1T4O A;  5F3W A;  2EOR A;  4BCA A;  4NXM E;  2B9D A;  2EM8 A;  4F6N A;  3LML A;  4L5N C;  2YTF A;  1N33 E;  3T1Y E;  1FKA E;  2YT4 A;  2EQ3 A;  4LFC E;  4HTG A;  4M9V C;  5A6B A;  3JAM C;  4DKK A;  2WBT A;  3HPS A;  4DR6 E;  3J7A G;  4NZV A;  4DR5 E;  4KWY A;  2EOO A;  4GZN C;  3EPH A;  5AC5 A;  2L3C A;  4GEQ B;  2LVH A;  4I8O A;  2VRD A;  2J7J A;  3FIG A;  2ELZ A;  3BBG A;  4R2Q A;  3T1H E;  4JI8 E;  2KOU A;  4JI5 E;  2E72 A;  4DV5 E;  2F4V E;  1TF6 A;  4DV6 E;  1FJG E;  1I94 E;  2EE8 A;  4B3M E;  2JYA A;  2EQ1 A;  3AUZ A;  1YFH A;  2V89 A;  4LF9 E;  2YRK A;  1X6E A;  2EN3 A;  4M30 A;  4R8O A;  3AV0 A;  1PDA A;  4JYA E;  2EQ0 A;  2KHX A;  1JK1 A;  1NCS A;  2JOB A;  4DV2 E;  1YYK A;  2JVA A;  1A1J A;  2JOX A;  1UBD C;  2EN8 A;  1STU A;  2LBS B;  2M7Q A;  2EOJ A;  3OTO E;  2JR1 A;  2V86 A;  2UXB E;  3M99 B;  2JWO A;  2MDG A;  3BID A;  3THN A;  2M1S A;  4DMI A;  2EOI A;  3KWR A;  1X49 A;  2EM3 A;  4DR4 E;  2L2K B;  2FTX B;  4NHR A;  2CSH A;  2EM4 A;  2WBS A;  4F54 A;  1RMD A;  1ZBQ A;  5KL3 A;  1EH7 A;  1UN6 B;  5A6J A;  4N4R B;  2Q8U A;  4DR7 E;  4WSG A;  3TQM A;  1HNZ E;  3JTZ A;  4R2A A;  2I9I A;  3L00 A;  4HEI A;  2LO3 A;  2YTG A;  4MLQ A;  4JI2 E;  1X6F A;  2GHF A;  2DLK A;  5T6J A;  1G2D C;  2ODR C;  2A25 A;  2EN1 A;  2EOZ A;  4ZYG A;  2L92 A;  2JP9 A;  2EMC A;  4F2J C;  2YZT A;  1DI2 A;  2BB8 A;  2EMY A;  2EML A;  2HJJ A;  3EPK A;  2EOH A;  2EPA A;  1YUI A;  2EPO A;  3UK3 C;  4YY3 E;  2ADR A;  2CPN A;  2YSO A;  2RSM A;  1EH6 A;  2LUQ A;  5LLQ A;  4X62 E;  4BHC A;  4LF6 E;  2YTN A;  2LMZ A;  2MDR A;  2F8B A;  2RPC A;  4DUY E;  2RS7 A;  2EPL X;  1QNT A;  5A6A A;  1ZAA C;  1AH5 A;  1BBO A;  2LJU A;  2UUB E;  3IWC A;  2L2N A;  4IJD A;  4GKK E;  4JI4 E;  2YWQ A;  4ZYD A;  2EM0 A;  3VYX A;  2EWL A;  5BR8 E;  1IMU A;  2NUE A;  4LF7 E;  1RC7 A;  1X3C A;  4P78 A;  1YPN A;  3LLH A;  2HGH A;  3C4T A;  1AAY A;  1X6H A;  2D9H A;  4B3R E;  1BBG A;  2ENC A;  1A1K A;  2R1F A;  3KZY A;  4P7D A;  3J7Y p;  4TUI A;  1J26 A;  3HTX A;  4O5G A;  2ODR D;  5A69 A;  3IWD A;  2EPP A;  4DV7 E;  4X8W A;  2YRH A;  1YUJ A;  4WPY A;  2WBU A;  2VF1 A;  5FLX C;  4DV4 E;  2L2M A;  2BBG A;  1WHQ A;  2ENH A;  2VE7 C;  5IT9 C;  4DUZ E;  2VQF E;  1EH8 A;  1GQE A;  2EMB A;  1O0W A;  4BC9 A;  1X5W A;  1LLM C;  2UXD E;  2JXP A;  5KL5 A;  2EMH A;  4LF4 E;  2EL5 A;  2EMW A;  2MKN A;  4WXC A;  1KYQ A;  2FV4 B;  2EMI A;  2EJ4 A;  2EPX A;  1A1G A;  2MC6 A;  2E1M A;  2EZ6 A; 
#chains in the Genus database with same CATH homology
 2CSH A;  2EMF A;  1A1L A;  1ZU1 A;  2EM4 A;  2GLI A;  2WBS A;  2YU5 A;  3MHS C;  1RMD A;  1YSA C;  4X9J A;  5KL3 A;  4IS1 C;  1UN6 B;  2YTO A;  1TN9 A;  2M9A A;  4WSG A;  1WJP A;  2YTI A;  4R2A A;  2EOM A;  2JPA A;  2LO3 A;  2EOE A;  2YTG A;  1X6F A;  2EMX A;  2EPR A;  2EM7 A;  2GHF A;  2DLK A;  1A1H A;  2EOX A;  1G2D C;  2YTJ A;  2A25 A;  2YTQ A;  2YTD A;  2EN1 A;  2EOZ A;  2EL6 A;  5KL6 A;  2JP9 A;  2EMC A;  2EOR A;  2YU8 A;  4R2R A;  4F2J C;  1P47 A;  2BB8 A;  2EMY A;  2LT7 A;  2EML A;  3EPK A;  2CTD A;  2EM8 A;  2EOH A;  4F6N A;  2EPA A;  1YUI A;  1Z1B A;  2YTF A;  3UK3 C;  2EN4 A;  2ADR A;  2YSO A;  2EQ3 A;  2ENA A;  1TF3 A;  4M9V C;  2YTE A;  1BB8 A;  2YTN A;  1G2F C;  2WBT A;  2DGC A;  3EPJ A;  2RPC A;  4FK5 C;  2EOO A;  1ZAA C;  4GZN C;  4R2P A;  3EPH A;  1B69 A;  1BBO A;  2LVH A;  2YSP A;  2MKD A;  2VRD A;  2J7J A;  3EPL A;  2ELZ A;  2EMK A;  2EM6 A;  4R2Q A;  1ZR9 A;  4IJD A;  2DMI A;  2WCC 3;  2EM0 A;  2E72 A;  2YTP A;  2I13 A;  1X3C A;  1TF6 A;  2ELY A;  2HGH A;  2EOS A;  2EE8 A;  1AAY A;  1X6H A;  2EOY A;  2D9H A;  5KL2 A;  2EOF A;  2ENC A;  2EQ1 A;  2YRM A;  1A1K A;  2R1F A;  4R2C A;  2RSI A;  2CT1 A;  5KL7 A;  2PRT A;  2YRK A;  1X6E A;  2EN3 A;  2EMZ A;  4R2E A;  2EQ0 A;  2EP3 A;  2EPP A;  1F2I G;  2EPU A;  2YRH A;  1JK1 A;  1A1F A;  1YUJ A;  1MEY C;  2WBU A;  2EN7 A;  2DLQ A;  1A1I A;  2EMG A;  1KJK A;  1NCS A;  4R2D A;  2ENH A;  1A1J A;  1UBD C;  2EN8 A;  2EPC A;  2EN6 A;  3MHH C;  2LV2 A;  4F6M A;  2EPZ A;  2EMB A;  2EM5 A;  2EOJ A;  1X5W A;  2EN2 A;  2EMA A;  1LLM C;  5KL5 A;  2EMH A;  2NAB A;  5KL4 A;  3M99 B;  2MDG A;  2EM2 A;  3VHT B;  2EL5 A;  2EM9 A;  2EMW A;  2LCE A;  2MKN A;  2EOQ A;  1DGC A;  2EOI A;  2EL4 A;  2EM3 A;  2EMI A;  1JK2 A;  2EJ4 A;  2EPX A;  1A1G A;  2DRP A;  4R2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...