2PRTA

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*CP*GP*CP*GP*GP*GP*GP*GP*CP*GP*TP*CP*TP*G)-3')
publication title Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA04
3EPKA 4F6NA 5KL7A 3VHTB 2YTDA 2YTFA 1KJKA 1Z1BA 1ZR9A 2EOIA 4WSGA 2EPRA 2EMKA 4F6MA 2EN2A 2CTDA 2EMXA 3EPLA 1X5WA 2GHFA 1A1FA 2EORA 5KL5A 4R2SA 2YTEA 2HGHA 2EOFA 2MDGA 2LV2A 2EM3A 1X6FA 2ELYA 2LVHA 3MHHC 1ZU1A 2YTGA 2VRDA 2E72A 1TF6A 2YTOA 1A1GA 2M9AA 2WBUA 2EPXA 1YUIA 1X3CA 1A1KA 1A1LA 2EOXA 2EOYA 4R2QA 2LCEA 2DGCA 2EMYA 2EMLA 1G2DC 1YSAC 2EL5A 2YTQA 1UBDC 2EE8A 2EM6A 3EPJA 1BB8A 1YUJA 1UN6B 3M99B 2R1FA 1A1IA 2EPZA 1X6EA 3EPHA 2EM0A 2EOJA 2YTJA 2YRKA 2D9HA 3UK3C 2EN3A 2J7JA 1LLMC 2MKDA 2EPCA 1ZAAC 2EM5A 2EP3A 4R2RA 4R2CA 2WCC3 2CSHA 4F2JC 4R2DA 2EOEA 2EQ3A 2EJ4A 4M9VC 2EOSA 2EM9A 4IS1C 2CT1A 2EMHA 2ENAA 2EPAA 2DLQA 1DGCA 2MKNA 2EL6A 2WBTA 2YTIA 1TN9A 1G2FC 2YTPA 2I13A 2DLKA 1WJPA 2YU8A 2EPUA 2EMZA 2A25A 2LO3A 2YSOA 1A1HA 2YRHA 2EM4A 2JP9A 2YRMA 1F2IG 1B69A 2EM2A 1RMDA 2EMGA 2RPCA 2PRTA 3MHSC 2LT7A 2EOOA 2EPPA 4R2EA 4R2PA 1TF3A 2ELZA 2EL4A 2ENCA 4X9JA 4IJDA 4GZNC 1NCSA 2DRPA 2WBSA 2EMWA 2BB8A 5KL4A 2EN8A 2NABA 2JPAA 2EOZA 2EM7A 2EOQA 1BBOA 1AAYA 4R2AA 1JK2A 2EMBA 2ADRA 2EOMA 2EMIA 2EMAA 2YSPA 2EN4A 1X6HA 5KL3A 1JK1A 5KL6A 2EN7A 2EN6A 1MEYC 4FK5C 2EQ1A 2RSIA 2YU5A 2EOHA 2ENHA 2EMFA 1P47A 2YTNA 1A1JA 5KL2A 2DMIA 2EMCA 2EN1A 2EQ0A 2GLIA 2EM8A
chains in the Genus database with same CATH superfamily
2YT4A 4NZVA 4N4RB 2E1MA 4R8OA 3VHTB 2YTFA 4BBYA 4LFCE 4F9BB 1PJQA 3DJWA 5IV8B 2CTDA 2VE7C 2EMXA 3EQ1A 3ADGA 2GHFA 2LUPB 2YTEA 2EM3A 4X8WA 1QU6A 2ELYA 1ZU1A 2N3HA 1L4SA 2HC5A 2LBSB 2YTOA 5F3WA 1X3CA 3TQMA 2JOBA 2I9IA 4DV3E 2V88A 2EOYA 3BBGA 4O4KA 4O5GA 4OOGC 1YSAC 2EL5A 2YTQA 1WHQA 1RC7A 2EPMX 1N33E 2DB2A 4WYQB 4YHHE 3M99B 5CFFE 2EPLX 2HJJA 2K7IA 2RTXA 2J7JA 1LLMC 4DMIA 2EQ3A 4IS1C 2CT1A 4JYAE 4MLQA 2EL6A 1TN9A 5A6BD 2DLKA 3C6KA 1STUA 1ZBQA 2ODRC 2GPIA 2LO3A 3C6MA 1NEIA 3ADIA 2LTSA 2JVAA 2MC6A 4ZYEA 2EMGA 1YZ9A 2LT7A 1BBGA 2EPPA 4R2EA 1TF3A 4LFBE 3MSWA 4B3SE 4GZNC 2VF1A 4DR1E 2DRPA 2WBSA 2EMWA 2UU9E 5KL4A 4DR6E 4WXCA 3JAMC 1N36E 1IBLE 3FIGA 2E5LE 1N3GA 3ECRA 2ADRA 2EOMA 2EMIA 2JOXA 5KL3A 2M7QA 1PJTA 2EPNA 2JR1A 3KZYA 2L3JA 4B3ME 1MEYC 1YYWA 3HTXA 1SFEA 4Q35B 2M1SA 4DUZE 1IBME 4X62E 1X49A 4NXME 5AASA 3VK6A 2UUBE 3C4BA 2VQFE 1A1JA 3OMLA 2DMIA 4DR3E 2GLIA 1T4OA 2L6MA 2L8TA 4R03A 3OTOE 3QG5C 1Z1BA 2EOIA 2N8XA 4JI5E 3KWRA 2EZ6A 3LLHA 2YZTA 4X65E 3EPLA 1X5WA 4KWYA 1A1FA 2EORA 2MDRA 2HGHA 4HEIA 3HQ1A 1HR0E 2UUCE 3MHHC 2E72A 2F4VE 2B7VA 1WRJA 1A1GA 2EPXA 1YUIA 4LF6E 3L00A 2NUGA 1A1LA 5A6AA 5AE3A 1QNTA 4BS9A 4LTYA 1SR9A 2EE8A 5IXMB 2EM6A 5FLXC 1YUJA 3IWDA 4P78A 4BCAA 2ZM6E 1N34E 1UN6B 1YYKA 1A1IA 3F6HA 1X6EA 4DR2E 3EPHA 2EM0A 2EOJA 3UK3C 2EPCA 4RHBB 2EM5A 2EP3A 2FTXB 4F2JC 1ZBTA 2DSYA 4R2DA 4M9VC 2F8BA 2EOSA 4L8NA 4WXDA 3JU0A 1MGTA 1UHZA 2EPAA 2ENAA 2DLQA 2WBTA 4GKKE 2K4VA 4O43A 4JI1E 2KHXA 2I13A 4JV5E 1WJPA 1XMOE 5LL6R 1DQ3A 4K0KE 4X66E 1T4LB 5LMUE 1PJSA 5BR8E 2RPCA 3MHSC 2L2MA 2EL4A 2V89A 3F6GA 4IJDA 5IWAE 4NHRA 2EOZA 4WFTA 1BBOA 2KONA 1JK2A 5A6JA 4BC7A 4ZYDA 4TUIA 5KL6A 2HHHE 2L2KB 4LF7E 2L92A 5AC5A 3HXLA 2JY9A 1IBKE 4M30A 2RSIA 4M0VA 1EKZA 4NXNE 4OX9E 5KL2A 1HNWE 3HPZA 3H09A 1YPNA 2EN1A 2EQ0A 4P7DA 3EPKA 4BHCA 4F6NA 3BIDA 2YTDA 3T1YE 4HTGA 1ZR9A 1N32E 4R2SA 2MDGA 1X6FA 2LVHA 1YYOA 2YTGA 2VRDA 2KOUA 2L33A 4ZYGA 4LF8E 5ADZA 5AE2A 2L3CA 2M9AA 2JYAA 2WBUA 2DMYA 2B9DA 2EPOA 4DKKA 4DV4E 2LCEA 4GEQB 2DGCA 2EMYA 2UXCE 2M4IA 5LLQA 1G2DC 3J7AG 4JI8E 3P1XA 2WZOA 1XNQE 4B3TE 1IQSA 2B3TB 1O0WA 4RH8A 3ZOQB 1EH7A 2EPZA 2LTRA 2EWLA 2RQLA 4YY3E 1RQ0A 2MC5A 2D9HA 2EN3A 2MKDA 1X48A 1FKAE 1ZAAC 1KYQA 3IWCA 4F9AB 2WCC3 2EM9A 4LU9A 2EMHA 2MKNA 2YTIA 1G2FC 5LMNE 4DR7E 4L5NC 2VQEE 5A2QC 4GKJE 2EPUA 4DV2E 4DV7E 5T6JA 2EMZA 1A1HA 2UXBE 2YRHA 2EM4A 2EPKX 2RS6A 4Q28A 3THNA 1XMQE 2UUAE 1GZ6A 1PDAA 1F2IG 1RMDA 2PRTA 2EOOA 2ELZA 4WPYA 1NCSA 2BB8A 2JPAA 2EN8A 2FGGA 4WX9A 2EM7A 1I94E 4R2AA 2NUEA 1PKPA 1EH8A 2R76A 5A69A 2EMAA 1X6HA 1JK1A 5AC4A 2EN6A 4FK5C 2BBGA 2EQ1A 3RMPA 2H36X 4LF9E 4DV0E 2EMFA 2YTNA 5DNYA 3IWBA 3ADLA 2EMCA 4BC9A 2EM8A 4ZYHA 3VYYA 2RS7A 4M2ZA 5KL7A 1KJKA 3C4TA 3LMLA 4WSGA 2EPRA 2EMKA 4F6MA 1IMUA 2EN2A 2V87A 3BGHA 5A6KA 5AE1A 3THOB 4DV5E 4AQYE 5KL5A 2EOFA 2LV2A 2CPNA 1WXRA 2YWQA 2RSMA 3DF6A 1TF6A 3J80C 3T1HE 4JI3E 1A1KA 2G7HA 4F9CB 2EOXA 4R2QA 4LFAE 2ODRD 1AH5A 2N3GA 1T4NA 2UXDE 2EMLA 4DR5E 4DUYE 4X64E 2V86A 1HNXE 1UBDC 5A6BA 2LJUA 3EPJA 1HNZE 2V8QB 4DR4E 1BB8A 5IT9C 2V85A 4BMJA 2R1FA 2YTJA 4MLVA 2YRKA 4B3RE 4I8OA 2FV4B 3AV0A 2NA2A 4JI6E 2B7TA 5TSEA 4R2RA 1J26A 4R2CA 2DIXA 2CSHA 2EOEA 1XNRE 2EJ4A 2LRSA 3K6QA 1X47A 2L2NA 3AUZA 3HPSA 1DGCA 2LMZA 1YFHA 1FJGE 3BF2A 2YTPA 2Q8UA 1GQEA 2V83A 1T39A 1T38A 4BHBA 2A25A 4JI7E 2YSOA 1GTKA 2NUFA 2JP9A 4JI2E 2YRMA 2LE2A 1B69A 4TUGA 2EM2A 4JI0E 4KHPE 4R2PA 3J81C 4DV1E 2ENCA 4X9JA 1EH6A 4WSPA 3ADJA 2NABA 2EOQA 1AAYA 2YPNA 1WHNA 1J5EE 2EMBA 2YSPA 4KZSA 2EN4A 2LUQA 2EN7A 1DI2A 2LJHA 4LF4E 3VYXA 4DV6E 2IHR1 3J7Yp 2JWOA 2JXPA 2YU5A 2EOHA 2ENHA 4J8ZA 4F54A 4JI4E 1P47A 1UILA 1IQOA 3KZZA 2YU8A 4O24A 4LF5E 3JTZA
chains in the Genus database with same CATH topology
3EPKA 4F6NA 5KL7A 3VHTB 2YTDA 2YTFA 1KJKA 1Z1BA 1ZR9A 2EOIA 4WSGA 2EPRA 2EMKA 4F6MA 2EN2A 2CTDA 2EMXA 3EPLA 1X5WA 2GHFA 1A1FA 2EORA 5KL5A 4R2SA 2YTEA 2HGHA 2EOFA 2MDGA 2LV2A 2EM3A 1X6FA 2ELYA 2LVHA 3MHHC 1ZU1A 2YTGA 2VRDA 2E72A 1TF6A 2YTOA 1A1GA 2M9AA 2WBUA 2EPXA 1YUIA 1X3CA 1A1KA 1A1LA 2EOXA 2EOYA 4R2QA 2LCEA 2DGCA 2EMYA 2EMLA 1G2DC 1YSAC 2EL5A 2YTQA 1UBDC 2EE8A 2EM6A 3EPJA 1BB8A 1YUJA 1UN6B 3M99B 2R1FA 1A1IA 2EPZA 1X6EA 3EPHA 2EM0A 2EOJA 2YTJA 2YRKA 2D9HA 3UK3C 2EN3A 2J7JA 1LLMC 2MKDA 2EPCA 1ZAAC 2EM5A 2EP3A 4R2RA 4R2CA 2WCC3 2CSHA 4F2JC 4R2DA 2EOEA 2EQ3A 2EJ4A 4M9VC 2EOSA 2EM9A 4IS1C 2CT1A 2EMHA 2ENAA 2EPAA 2DLQA 1DGCA 2MKNA 2EL6A 2WBTA 2YTIA 1TN9A 1G2FC 2YTPA 2I13A 2DLKA 1WJPA 2YU8A 2EPUA 2EMZA 2A25A 2LO3A 2YSOA 1A1HA 2YRHA 2EM4A 2JP9A 2YRMA 1F2IG 1B69A 2EM2A 1RMDA 2EMGA 2RPCA 2PRTA 3MHSC 2LT7A 2EOOA 2EPPA 4R2EA 4R2PA 1TF3A 2ELZA 2EL4A 2ENCA 4X9JA 4IJDA 4GZNC 1NCSA 2DRPA 2WBSA 2EMWA 2BB8A 5KL4A 2EN8A 2NABA 2JPAA 2EOZA 2EM7A 2EOQA 1BBOA 1AAYA 4R2AA 1JK2A 2EMBA 2ADRA 2EOMA 2EMIA 2EMAA 2YSPA 2EN4A 1X6HA 5KL3A 1JK1A 5KL6A 2EN7A 2EN6A 1MEYC 4FK5C 2EQ1A 2RSIA 2YU5A 2EOHA 2ENHA 2EMFA 1P47A 2YTNA 1A1JA 5KL2A 2DMIA 2EMCA 2EN1A 2EQ0A 2GLIA 2EM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPK A;  4F6N A;  5KL7 A;  3VHT B;  2YTD A;  2YTF A;  1KJK A;  1Z1B A;  1ZR9 A;  2EOI A;  4WSG A;  2EPR A;  2EMK A;  4F6M A;  2EN2 A;  2CTD A;  2EMX A;  3EPL A;  1X5W A;  2GHF A;  1A1F A;  2EOR A;  5KL5 A;  4R2S A;  2YTE A;  2HGH A;  2EOF A;  2MDG A;  2LV2 A;  2EM3 A;  1X6F A;  2ELY A;  2LVH A;  3MHH C;  1ZU1 A;  2YTG A;  2VRD A;  2E72 A;  1TF6 A;  2YTO A;  1A1G A;  2M9A A;  2WBU A;  2EPX A;  1YUI A;  1X3C A;  1A1K A;  1A1L A;  2EOX A;  2EOY A;  4R2Q A;  2LCE A;  2DGC A;  2EMY A;  2EML A;  1G2D C;  1YSA C;  2EL5 A;  2YTQ A;  1UBD C;  2EE8 A;  2EM6 A;  3EPJ A;  1BB8 A;  1YUJ A;  1UN6 B;  3M99 B;  2R1F A;  1A1I A;  2EPZ A;  1X6E A;  3EPH A;  2EM0 A;  2EOJ A;  2YTJ A;  2YRK A;  2D9H A;  3UK3 C;  2EN3 A;  2J7J A;  1LLM C;  2MKD A;  2EPC A;  1ZAA C;  2EM5 A;  2EP3 A;  4R2R A;  4R2C A;  2WCC 3;  2CSH A;  4F2J C;  4R2D A;  2EOE A;  2EQ3 A;  2EJ4 A;  4M9V C;  2EOS A;  2EM9 A;  4IS1 C;  2CT1 A;  2EMH A;  2ENA A;  2EPA A;  2DLQ A;  1DGC A;  2MKN A;  2EL6 A;  2WBT A;  2YTI A;  1TN9 A;  1G2F C;  2YTP A;  2I13 A;  2DLK A;  1WJP A;  2YU8 A;  2EPU A;  2EMZ A;  2A25 A;  2LO3 A;  2YSO A;  1A1H A;  2YRH A;  2EM4 A;  2JP9 A;  2YRM A;  1F2I G;  1B69 A;  2EM2 A;  1RMD A;  2EMG A;  2RPC A;  2PRT A;  3MHS C;  2LT7 A;  2EOO A;  2EPP A;  4R2E A;  4R2P A;  1TF3 A;  2ELZ A;  2EL4 A;  2ENC A;  4X9J A;  4IJD A;  4GZN C;  1NCS A;  2DRP A;  2WBS A;  2EMW A;  2BB8 A;  5KL4 A;  2EN8 A;  2NAB A;  2JPA A;  2EOZ A;  2EM7 A;  2EOQ A;  1BBO A;  1AAY A;  4R2A A;  1JK2 A;  2EMB A;  2ADR A;  2EOM A;  2EMI A;  2EMA A;  2YSP A;  2EN4 A;  1X6H A;  5KL3 A;  1JK1 A;  5KL6 A;  2EN7 A;  2EN6 A;  1MEY C;  4FK5 C;  2EQ1 A;  2RSI A;  2YU5 A;  2EOH A;  2ENH A;  2EMF A;  1P47 A;  2YTN A;  1A1J A;  5KL2 A;  2DMI A;  2EMC A;  2EN1 A;  2EQ0 A;  2GLI A;  2EM8 A; 
#chains in the Genus database with same CATH topology
 2YT4 A;  4NZV A;  4N4R B;  2E1M A;  4R8O A;  3VHT B;  2YTF A;  4BBY A;  4LFC E;  4F9B B;  1PJQ A;  3DJW A;  5IV8 B;  2CTD A;  2VE7 C;  2EMX A;  3EQ1 A;  3ADG A;  2GHF A;  2LUP B;  2YTE A;  2EM3 A;  4X8W A;  1QU6 A;  2ELY A;  1ZU1 A;  2N3H A;  1L4S A;  2HC5 A;  2LBS B;  2YTO A;  5F3W A;  1X3C A;  3TQM A;  2JOB A;  2I9I A;  4DV3 E;  2V88 A;  2EOY A;  3BBG A;  4O4K A;  4O5G A;  4OOG C;  1YSA C;  2EL5 A;  2YTQ A;  1WHQ A;  1RC7 A;  2EPM X;  1N33 E;  2DB2 A;  4WYQ B;  4YHH E;  3M99 B;  5CFF E;  2EPL X;  2HJJ A;  2K7I A;  2RTX A;  2J7J A;  1LLM C;  4DMI A;  2EQ3 A;  4IS1 C;  2CT1 A;  4JYA E;  4MLQ A;  2EL6 A;  1TN9 A;  5A6B D;  2DLK A;  3C6K A;  1STU A;  1ZBQ A;  2ODR C;  2GPI A;  2LO3 A;  3C6M A;  1NEI A;  3ADI A;  2LTS A;  2JVA A;  2MC6 A;  4ZYE A;  2EMG A;  1YZ9 A;  2LT7 A;  1BBG A;  2EPP A;  4R2E A;  1TF3 A;  4LFB E;  3MSW A;  4B3S E;  4GZN C;  2VF1 A;  4DR1 E;  2DRP A;  2WBS A;  2EMW A;  2UU9 E;  5KL4 A;  4DR6 E;  4WXC A;  3JAM C;  1N36 E;  1IBL E;  3FIG A;  2E5L E;  1N3G A;  3ECR A;  2ADR A;  2EOM A;  2EMI A;  2JOX A;  5KL3 A;  2M7Q A;  1PJT A;  2EPN A;  2JR1 A;  3KZY A;  2L3J A;  4B3M E;  1MEY C;  1YYW A;  3HTX A;  1SFE A;  4Q35 B;  2M1S A;  4DUZ E;  1IBM E;  4X62 E;  1X49 A;  4NXM E;  5AAS A;  3VK6 A;  2UUB E;  3C4B A;  2VQF E;  1A1J A;  3OML A;  2DMI A;  4DR3 E;  2GLI A;  1T4O A;  2L6M A;  2L8T A;  4R03 A;  3OTO E;  3QG5 C;  1Z1B A;  2EOI A;  2N8X A;  4JI5 E;  3KWR A;  2EZ6 A;  3LLH A;  2YZT A;  4X65 E;  3EPL A;  1X5W A;  4KWY A;  1A1F A;  2EOR A;  2MDR A;  2HGH A;  4HEI A;  3HQ1 A;  1HR0 E;  2UUC E;  3MHH C;  2E72 A;  2F4V E;  2B7V A;  1WRJ A;  1A1G A;  2EPX A;  1YUI A;  4LF6 E;  3L00 A;  2NUG A;  1A1L A;  5A6A A;  5AE3 A;  1QNT A;  4BS9 A;  4LTY A;  1SR9 A;  2EE8 A;  5IXM B;  2EM6 A;  5FLX C;  1YUJ A;  3IWD A;  4P78 A;  4BCA A;  2ZM6 E;  1N34 E;  1UN6 B;  1YYK A;  1A1I A;  3F6H A;  1X6E A;  4DR2 E;  3EPH A;  2EM0 A;  2EOJ A;  3UK3 C;  2EPC A;  4RHB B;  2EM5 A;  2EP3 A;  2FTX B;  4F2J C;  1ZBT A;  2DSY A;  4R2D A;  4M9V C;  2F8B A;  2EOS A;  4L8N A;  4WXD A;  3JU0 A;  1MGT A;  1UHZ A;  2EPA A;  2ENA A;  2DLQ A;  2WBT A;  4GKK E;  2K4V A;  4O43 A;  4JI1 E;  2KHX A;  2I13 A;  4JV5 E;  1WJP A;  1XMO E;  5LL6 R;  1DQ3 A;  4K0K E;  4X66 E;  1T4L B;  5LMU E;  1PJS A;  5BR8 E;  2RPC A;  3MHS C;  2L2M A;  2EL4 A;  2V89 A;  3F6G A;  4IJD A;  5IWA E;  4NHR A;  2EOZ A;  4WFT A;  1BBO A;  2KON A;  1JK2 A;  5A6J A;  4BC7 A;  4ZYD A;  4TUI A;  5KL6 A;  2HHH E;  2L2K B;  4LF7 E;  2L92 A;  5AC5 A;  3HXL A;  2JY9 A;  1IBK E;  4M30 A;  2RSI A;  4M0V A;  1EKZ A;  4NXN E;  4OX9 E;  5KL2 A;  1HNW E;  3HPZ A;  3H09 A;  1YPN A;  2EN1 A;  2EQ0 A;  4P7D A;  3EPK A;  4BHC A;  4F6N A;  3BID A;  2YTD A;  3T1Y E;  4HTG A;  1ZR9 A;  1N32 E;  4R2S A;  2MDG A;  1X6F A;  2LVH A;  1YYO A;  2YTG A;  2VRD A;  2KOU A;  2L33 A;  4ZYG A;  4LF8 E;  5ADZ A;  5AE2 A;  2L3C A;  2M9A A;  2JYA A;  2WBU A;  2DMY A;  2B9D A;  2EPO A;  4DKK A;  4DV4 E;  2LCE A;  4GEQ B;  2DGC A;  2EMY A;  2UXC E;  2M4I A;  5LLQ A;  1G2D C;  3J7A G;  4JI8 E;  3P1X A;  2WZO A;  1XNQ E;  4B3T E;  1IQS A;  2B3T B;  1O0W A;  4RH8 A;  3ZOQ B;  1EH7 A;  2EPZ A;  2LTR A;  2EWL A;  2RQL A;  4YY3 E;  1RQ0 A;  2MC5 A;  2D9H A;  2EN3 A;  2MKD A;  1X48 A;  1FKA E;  1ZAA C;  1KYQ A;  3IWC A;  4F9A B;  2WCC 3;  2EM9 A;  4LU9 A;  2EMH A;  2MKN A;  2YTI A;  1G2F C;  5LMN E;  4DR7 E;  4L5N C;  2VQE E;  5A2Q C;  4GKJ E;  2EPU A;  4DV2 E;  4DV7 E;  5T6J A;  2EMZ A;  1A1H A;  2UXB E;  2YRH A;  2EM4 A;  2EPK X;  2RS6 A;  4Q28 A;  3THN A;  1XMQ E;  2UUA E;  1GZ6 A;  1PDA A;  1F2I G;  1RMD A;  2PRT A;  2EOO A;  2ELZ A;  4WPY A;  1NCS A;  2BB8 A;  2JPA A;  2EN8 A;  2FGG A;  4WX9 A;  2EM7 A;  1I94 E;  4R2A A;  2NUE A;  1PKP A;  1EH8 A;  2R76 A;  5A69 A;  2EMA A;  1X6H A;  1JK1 A;  5AC4 A;  2EN6 A;  4FK5 C;  2BBG A;  2EQ1 A;  3RMP A;  2H36 X;  4LF9 E;  4DV0 E;  2EMF A;  2YTN A;  5DNY A;  3IWB A;  3ADL A;  2EMC A;  4BC9 A;  2EM8 A;  4ZYH A;  3VYY A;  2RS7 A;  4M2Z A;  5KL7 A;  1KJK A;  3C4T A;  3LML A;  4WSG A;  2EPR A;  2EMK A;  4F6M A;  1IMU A;  2EN2 A;  2V87 A;  3BGH A;  5A6K A;  5AE1 A;  3THO B;  4DV5 E;  4AQY E;  5KL5 A;  2EOF A;  2LV2 A;  2CPN A;  1WXR A;  2YWQ A;  2RSM A;  3DF6 A;  1TF6 A;  3J80 C;  3T1H E;  4JI3 E;  1A1K A;  2G7H A;  4F9C B;  2EOX A;  4R2Q A;  4LFA E;  2ODR D;  1AH5 A;  2N3G A;  1T4N A;  2UXD E;  2EML A;  4DR5 E;  4DUY E;  4X64 E;  2V86 A;  1HNX E;  1UBD C;  5A6B A;  2LJU A;  3EPJ A;  1HNZ E;  2V8Q B;  4DR4 E;  1BB8 A;  5IT9 C;  2V85 A;  4BMJ A;  2R1F A;  2YTJ A;  4MLV A;  2YRK A;  4B3R E;  4I8O A;  2FV4 B;  3AV0 A;  2NA2 A;  4JI6 E;  2B7T A;  5TSE A;  4R2R A;  1J26 A;  4R2C A;  2DIX A;  2CSH A;  2EOE A;  1XNR E;  2EJ4 A;  2LRS A;  3K6Q A;  1X47 A;  2L2N A;  3AUZ A;  3HPS A;  1DGC A;  2LMZ A;  1YFH A;  1FJG E;  3BF2 A;  2YTP A;  2Q8U A;  1GQE A;  2V83 A;  1T39 A;  1T38 A;  4BHB A;  2A25 A;  4JI7 E;  2YSO A;  1GTK A;  2NUF A;  2JP9 A;  4JI2 E;  2YRM A;  2LE2 A;  1B69 A;  4TUG A;  2EM2 A;  4JI0 E;  4KHP E;  4R2P A;  3J81 C;  4DV1 E;  2ENC A;  4X9J A;  1EH6 A;  4WSP A;  3ADJ A;  2NAB A;  2EOQ A;  1AAY A;  2YPN A;  1WHN A;  1J5E E;  2EMB A;  2YSP A;  4KZS A;  2EN4 A;  2LUQ A;  2EN7 A;  1DI2 A;  2LJH A;  4LF4 E;  3VYX A;  4DV6 E;  2IHR 1;  3J7Y p;  2JWO A;  2JXP A;  2YU5 A;  2EOH A;  2ENH A;  4J8Z A;  4F54 A;  4JI4 E;  1P47 A;  1UIL A;  1IQO A;  3KZZ A;  2YU8 A;  4O24 A;  4LF5 E;  3JTZ A; 
#chains in the Genus database with same CATH homology
 3EPK A;  4F6N A;  5KL7 A;  3VHT B;  2YTD A;  2YTF A;  1KJK A;  1Z1B A;  1ZR9 A;  2EOI A;  4WSG A;  2EPR A;  2EMK A;  4F6M A;  2EN2 A;  2CTD A;  2EMX A;  3EPL A;  1X5W A;  2GHF A;  1A1F A;  2EOR A;  5KL5 A;  4R2S A;  2YTE A;  2HGH A;  2EOF A;  2MDG A;  2LV2 A;  2EM3 A;  1X6F A;  2ELY A;  2LVH A;  3MHH C;  1ZU1 A;  2YTG A;  2VRD A;  2E72 A;  1TF6 A;  2YTO A;  1A1G A;  2M9A A;  2WBU A;  2EPX A;  1YUI A;  1X3C A;  1A1K A;  1A1L A;  2EOX A;  2EOY A;  4R2Q A;  2LCE A;  2DGC A;  2EMY A;  2EML A;  1G2D C;  1YSA C;  2EL5 A;  2YTQ A;  1UBD C;  2EE8 A;  2EM6 A;  3EPJ A;  1BB8 A;  1YUJ A;  1UN6 B;  3M99 B;  2R1F A;  1A1I A;  2EPZ A;  1X6E A;  3EPH A;  2EM0 A;  2EOJ A;  2YTJ A;  2YRK A;  2D9H A;  3UK3 C;  2EN3 A;  2J7J A;  1LLM C;  2MKD A;  2EPC A;  1ZAA C;  2EM5 A;  2EP3 A;  4R2R A;  4R2C A;  2WCC 3;  2CSH A;  4F2J C;  4R2D A;  2EOE A;  2EQ3 A;  2EJ4 A;  4M9V C;  2EOS A;  2EM9 A;  4IS1 C;  2CT1 A;  2EMH A;  2ENA A;  2EPA A;  2DLQ A;  1DGC A;  2MKN A;  2EL6 A;  2WBT A;  2YTI A;  1TN9 A;  1G2F C;  2YTP A;  2I13 A;  2DLK A;  1WJP A;  2YU8 A;  2EPU A;  2EMZ A;  2A25 A;  2LO3 A;  2YSO A;  1A1H A;  2YRH A;  2EM4 A;  2JP9 A;  2YRM A;  1F2I G;  1B69 A;  2EM2 A;  1RMD A;  2EMG A;  2RPC A;  2PRT A;  3MHS C;  2LT7 A;  2EOO A;  2EPP A;  4R2E A;  4R2P A;  1TF3 A;  2ELZ A;  2EL4 A;  2ENC A;  4X9J A;  4IJD A;  4GZN C;  1NCS A;  2DRP A;  2WBS A;  2EMW A;  2BB8 A;  5KL4 A;  2EN8 A;  2NAB A;  2JPA A;  2EOZ A;  2EM7 A;  2EOQ A;  1BBO A;  1AAY A;  4R2A A;  1JK2 A;  2EMB A;  2ADR A;  2EOM A;  2EMI A;  2EMA A;  2YSP A;  2EN4 A;  1X6H A;  5KL3 A;  1JK1 A;  5KL6 A;  2EN7 A;  2EN6 A;  1MEY C;  4FK5 C;  2EQ1 A;  2RSI A;  2YU5 A;  2EOH A;  2ENH A;  2EMF A;  1P47 A;  2YTN A;  1A1J A;  5KL2 A;  2DMI A;  2EMC A;  2EN1 A;  2EQ0 A;  2GLI A;  2EM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...