2PRTA

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*CP*GP*CP*GP*GP*GP*GP*GP*CP*GP*TP*CP*TP*G)-3')
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2prtA04
2EMLA 2YSPA 2EMCA 2ELYA 2YU5A 2DMIA 3MHHC 5KL5A 1A1JA 2PRTA 2MDGA 1RMDA 2R1FA 1YSAC 2EMYA 2EMGA 2MKDA 1MEYC 2EMXA 1P47A 2EOEA 2EOJA 1UN6B 2CTDA 4R2QA 4R2AA 2EMIA 1WJPA 4IS1C 4F2JC 2YU8A 1B69A 4R2PA 2EM5A 2EOFA 1AAYA 1BB8A 2EPAA 2YSOA 2EN4A 2EMWA 2YTJA 2CT1A 2EPZA 1X6EA 2J7JA 2NABA 2WCC3 2EN7A 3EPKA 2DGCA 2EMZA 4GZNC 2YTPA 2EMBA 1G2DC 2EOSA 1X6HA 2M9AA 2RPCA 4R2EA 1KJKA 2EP3A 1X3CA 5KL7A 2YRHA 2YTFA 2HGHA 3UK3C 2EN3A 1A1IA 4M9VC 1DGCA 1NCSA 1F2IG 2EN8A 4IJDA 2EM9A 2LO3A 3EPLA 2DLKA 2EPPA 2EORA 4FK5C 4R2SA 2EM7A 1A1HA 1A1LA 2EOHA 1A1GA 2YTIA 1Z1BA 3EPJA 3MHSC 1ZAAC 2EQ3A 2EPUA 3VHTB 2EM2A 1A1KA 1ZU1A 2EOQA 2ENHA 4WSGA 2LT7A 2ENAA 2EE8A 2EM4A 1A1FA 2GHFA 2EL4A 2EM3A 2YTNA 2YTQA 2WBSA 2EMAA 2EMHA 2EN1A 5KL2A 2EMKA 1UBDC 2DRPA 2RSIA 2ELZA 2WBTA 1LLMC 2EPXA 2JPAA 2YTGA 2YRMA 2GLIA 2EPCA 1YUIA 2EOXA 2YRKA 2EQ1A 2LCEA 5KL3A 1YUJA 4F6NA 2EN2A 1JK1A 2EOMA 4R2DA 2EMFA 2EL5A 2MKNA 5KL6A 2EN6A 2VRDA 2YTDA 2YTOA 2EOZA 2EM0A 2D9HA 2EM6A 3M99B 2I13A 2LV2A 4R2RA 2EM8A 1X6FA 2DLQA 2ENCA 2EPRA 2E72A 1TF3A 1TF6A 4R2CA 1G2FC 1TN9A 2JP9A 2EQ0A 3EPHA 1X5WA 2LVHA 2CSHA 5KL4A 2A25A 4F6MA 1JK2A 2EL6A 2YTEA 2EOOA 4X9JA 2EJ4A 2EOYA 1ZR9A 2ADRA 2EOIA 1BBOA 2WBUA 2BB8A
chains in the Genus database with same CATH superfamily
1AH5A 2EMCA 2N3GA 5KL5A 4RHBB 4I8OA 1N33E 3BF2A 1YSAC 3C4BA 2N8XA 3HTXA 2EMXA 3VYXA 1T4OA 4N4RB 2CPNA 2CTDA 1UN6B 1X49A 2EPKX 2EMIA 1WJPA 1X47A 1SR9A 4IS1C 2LTRA 4R2PA 2EOFA 1AAYA 1HNWE 5ADZA 1BB8A 2EPAA 2YSOA 4LF9E 1GZ6A 3DF6A 3IWDA 1PJQA 2B3TB 2JXPA 2NABA 2NA2A 2DGCA 1UHZA 2YTPA 4F54A 1G2DC 2RPCA 1ZBTA 4JI7E 3C4TA 2L33A 1IBKE 5T6JA 1DGCA 4O24A 2EM9A 4KHPE 2LO3A 3EPLA 2UUCE 2DLKA 2EPPA 4GKKE 1I94E 4DR4E 4LU9A 4L5NC 3F6HA 1Z1BA 5A6KA 3KZYA 2EPLX 2LT7A 5IWAE 2V83A 1A1FA 5CFFE 2LE2A 2VE7C 2EM3A 1UILA 3IWCA 4M0VA 4F9BB 2EN1A 5KL2A 3THNA 2M7QA 3AUZA 2ODRC 4O5GA 1YUIA 4NXME 3J7AG 2YRKA 3OTOE 4JI0E 2LCEA 2JOBA 4JI1E 5AC4A 1YYOA 4DR7E 2V8QB 2MKNA 5LMUE 2F8BA 2WZOA 3M99B 4ZYHA 3L00A 1T38A 1HNXE 2LV2A 2LUQA 2RTXA 1HR0E 5AC5A 1X6FA 1TF3A 4J8ZA 2JP9A 3EPHA 2LVHA 1J5EE 2JVAA 4NHRA 4B3TE 2NUEA 2E1MA 1EH7A 2EL6A 3FIGA 4DMIA 1L4SA 5TSEA 2BB8A 2ODRD 1RQ0A 1A1JA 1GQEA 2DMIA 3ADGA 2PRTA 2H36X 2MDGA 1N3GA 5IXMB 1YZ9A 1IMUA 4X64E 1IQOA 2LBSB 1DI2A 1QU6A 2L6MA 1NEIA 1IQSA 4F2JC 2EWLA 2B7VA 1QNTA 1FJGE 3BIDA 2L3CA 4O43A 4MLVA 4R03A 2EMWA 2YTJA 4BHBA 3MSWA 4GZNC 4JI2E 1X6HA 4Q35B 1X3CA 1ZBQA 3JU0A 2YRHA 5KL7A 2YTFA 3UK3C 1A1IA 4OOGC 1F2IG 4IJDA 2M4IA 4DUZE 1HNZE 4JI4E 2EORA 1WHQA 2YTIA 4BC9A 2EQ3A 4B3ME 1ZU1A 2EOQA 4WSGA 5AE3A 5IV8B 1XNQE 2GHFA 1T39A 5AE1A 2K7IA 4X65E 4LF5E 2EMKA 1UBDC 2IHR1 2ELZA 5AE2A 1LLMC 5A6BA 4TUGA 2VQFE 2GLIA 4JI5E 2KHXA 3KWRA 3EQ1A 4LTYA 4X66E 4BS9A 4ZYEA 2L92A 2V89A 2EOMA 2LMZA 2UUBE 4DR6E 3OMLA 3J80C 1IBME 3TQMA 1X48A 4NZVA 2YTDA 1EH8A 4DV6E 2EOZA 2EM0A 2EPNA 4WX9A 2D9HA 2I13A 2RS6A 5LLQA 2EPRA 5A6JA 2E72A 5AASA 1G2FC 1O0WA 2V85A 2CSHA 1YYWA 4BMJA 4F6MA 2UUAE 1JK2A 4Q28A 1T4NA 2RS7A 1N32E 3ADJA 2HHHE 2NUGA 1T4LB 2EJ4A 2LJUA 4JV5E 4JI8E 2ADRA 2EOIA 2YZTA 3KZZA 3P1XA 2WBUA 2DIXA 3DJWA 1PJTA 1PKPA 2EMLA 2YSPA 2FGGA 2HC5A 2V88A 3ECRA 5A69A 2VQEE 4DV4E 5LMNE 1MEYC 2MKDA 2EOJA 2I9IA 4KZSA 4R2QA 4ZYDA 4R2AA 3T1YE 2YU8A 4DKKA 2EM5A 4M30A 1IBLE 2EN4A 4JI3E 2UXCE 2UXDE 2J7JA 2WCC3 3EPKA 2EN7A 1YYKA 2E5LE 2EMZA 2LJHA 2EMBA 3J81C 4TUIA 2L2NA 4R2EA 1KJKA 2EP3A 2HGHA 3K6QA 4P78A 1NCSA 2EN8A 3C6MA 4R8OA 2NUFA 1KYQA 3LLHA 4X8WA 4LF6E 4HEIA 2F4VE 2LUPB 4DUYE 4FK5C 4R2SA 2EM7A 2JYAA 1A1LA 3BGHA 2EOHA 2UXBE 2Q8UA 5F3WA 4ZYGA 2UU9E 4B3RE 4DV5E 1ZAAC 2YPNA 4HTGA 2ENAA 1GTKA 4BHCA 2EM4A 2L3JA 4DR5E 2EL4A 2YTNA 4BCAA 2KOUA 2EMHA 1XMQE 2DRPA 2JPAA 2YTGA 2LRSA 2G7HA 2DB2A 4F9CB 1WHNA 4NXNE 3IWBA 4DV7E 3ADIA 4WPYA 1PDAA 3HXLA 2EN2A 4LFAE 4LF8E 2EMFA 2EL5A 2MC5A 5KL6A 2EN6A 2VRDA 2YTOA 2EM6A 2JY9A 1J26A 2DMYA 2EPMX 4R2RA 2RQLA 3VYYA 3AV0A 2EPOA 2BBGA 1WXRA 3HPZA 1YPNA 4DV1E 2JR1A 1TN9A 4DR2E 3QG5C 3THOB 3ZOQB 2L8TA 1EH6A 1RC7A 2ZM6E 2FV4B 1PJSA 4GKJE 4LF7E 1N36E 2L2KB 5BR8E 2GPIA 5A6BD 1N34E 4LFCE 2ELYA 2YU5A 3MHHC 4BBYA 2B7TA 2DSYA 1RMDA 2R1FA 4GEQB 2EMYA 2EMGA 5A2QC 1BBGA 1MGTA 2M1SA 1P47A 3H09A 4DV3E 2EOEA 4WSPA 1EKZA 2KONA 2K4VA 1SFEA 1B69A 3BBGA 4F9AB 2MC6A 4P7DA 2CT1A 2EPZA 1X6EA 3ADLA 2FTXB 4WFTA 3HQ1A 2EOSA 2EZ6A 2M9AA 3JAMC 3JTZA 2EN3A 4M9VC 4DV0E 3F6GA 1XMOE 3VK6A 5A6AA 4YHHE 3C6KA 1XNRE 4RH8A 2HJJA 1A1HA 1WRJA 1A1GA 2VF1A 3EPJA 4DR3E 1DQ3A 3MHSC 2EPUA 3VHTB 2EM2A 1A1KA 1FKAE 2ENHA 2MDRA 2EE8A 2WBSA 2YTQA 4O4KA 2V86A 3LMLA 4AQYE 2N3HA 2EMAA 4L8NA 2R76A 2RSIA 2WBTA 3HPSA 2EPXA 4LFBE 5LL6R 4BC7A 2YRMA 2EPCA 2B9DA 1YFHA 4M2ZA 2EOXA 2EQ1A 2YT4A 4OX9E 4YY3E 5KL3A 1YUJA 5IT9C 3RMPA 4F6NA 4X62E 2V87A 1JK1A 2RSMA 4WXCA 4DV2E 3J7Yp 4R2DA 1STUA 2YWQA 5FLXC 4LF4E 4JI6E 4WYQB 2EM8A 2DLQA 2ENCA 5DNYA 2JOXA 4B3SE 1TF6A 4R2CA 2EQ0A 4DR1E 1X5WA 5KL4A 4WXDA 4JYAE 2JWOA 2A25A 4MLQA 2YTEA 2EOOA 2L2MA 4K0KE 4X9JA 2EOYA 2LTSA 4KWYA 3T1HE 1ZR9A 1BBOA
chains in the Genus database with same CATH topology
2EMLA 2YSPA 2EMCA 2ELYA 2YU5A 2DMIA 3MHHC 5KL5A 1A1JA 2PRTA 2MDGA 1RMDA 2R1FA 1YSAC 2EMYA 2EMGA 2MKDA 1MEYC 2EMXA 1P47A 2EOEA 2EOJA 1UN6B 2CTDA 4R2QA 4R2AA 2EMIA 1WJPA 4IS1C 4F2JC 2YU8A 1B69A 4R2PA 2EM5A 2EOFA 1AAYA 1BB8A 2EPAA 2YSOA 2EN4A 2EMWA 2YTJA 2CT1A 2EPZA 1X6EA 2J7JA 2NABA 2WCC3 2EN7A 3EPKA 2DGCA 2EMZA 4GZNC 2YTPA 2EMBA 1G2DC 2EOSA 1X6HA 2M9AA 2RPCA 4R2EA 1KJKA 2EP3A 1X3CA 5KL7A 2YRHA 2YTFA 2HGHA 3UK3C 2EN3A 1A1IA 4M9VC 1DGCA 1NCSA 1F2IG 2EN8A 4IJDA 2EM9A 2LO3A 3EPLA 2DLKA 2EPPA 2EORA 4FK5C 4R2SA 2EM7A 1A1HA 1A1LA 2EOHA 1A1GA 2YTIA 1Z1BA 3EPJA 3MHSC 1ZAAC 2EQ3A 2EPUA 3VHTB 2EM2A 1A1KA 1ZU1A 2EOQA 2ENHA 4WSGA 2LT7A 2ENAA 2EE8A 2EM4A 1A1FA 2GHFA 2EL4A 2EM3A 2YTNA 2YTQA 2WBSA 2EMAA 2EMHA 2EN1A 5KL2A 2EMKA 1UBDC 2DRPA 2RSIA 2ELZA 2WBTA 1LLMC 2EPXA 2JPAA 2YTGA 2YRMA 2GLIA 2EPCA 1YUIA 2EOXA 2YRKA 2EQ1A 2LCEA 5KL3A 1YUJA 4F6NA 2EN2A 1JK1A 2EOMA 4R2DA 2EMFA 2EL5A 2MKNA 5KL6A 2EN6A 2VRDA 2YTDA 2YTOA 2EOZA 2EM0A 2D9HA 2EM6A 3M99B 2I13A 2LV2A 4R2RA 2EM8A 1X6FA 2DLQA 2ENCA 2EPRA 2E72A 1TF3A 1TF6A 4R2CA 1G2FC 1TN9A 2JP9A 2EQ0A 3EPHA 1X5WA 2LVHA 2CSHA 5KL4A 2A25A 4F6MA 1JK2A 2EL6A 2YTEA 2EOOA 4X9JA 2EJ4A 2EOYA 1ZR9A 2ADRA 2EOIA 1BBOA 2WBUA 2BB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EML A;  2YSP A;  2EMC A;  2ELY A;  2YU5 A;  2DMI A;  3MHH C;  5KL5 A;  1A1J A;  2PRT A;  2MDG A;  1RMD A;  2R1F A;  1YSA C;  2EMY A;  2EMG A;  2MKD A;  1MEY C;  2EMX A;  1P47 A;  2EOE A;  2EOJ A;  1UN6 B;  2CTD A;  4R2Q A;  4R2A A;  2EMI A;  1WJP A;  4IS1 C;  4F2J C;  2YU8 A;  1B69 A;  4R2P A;  2EM5 A;  2EOF A;  1AAY A;  1BB8 A;  2EPA A;  2YSO A;  2EN4 A;  2EMW A;  2YTJ A;  2CT1 A;  2EPZ A;  1X6E A;  2J7J A;  2NAB A;  2WCC 3;  2EN7 A;  3EPK A;  2DGC A;  2EMZ A;  4GZN C;  2YTP A;  2EMB A;  1G2D C;  2EOS A;  1X6H A;  2M9A A;  2RPC A;  4R2E A;  1KJK A;  2EP3 A;  1X3C A;  5KL7 A;  2YRH A;  2YTF A;  2HGH A;  3UK3 C;  2EN3 A;  1A1I A;  4M9V C;  1DGC A;  1NCS A;  1F2I G;  2EN8 A;  4IJD A;  2EM9 A;  2LO3 A;  3EPL A;  2DLK A;  2EPP A;  2EOR A;  4FK5 C;  4R2S A;  2EM7 A;  1A1H A;  1A1L A;  2EOH A;  1A1G A;  2YTI A;  1Z1B A;  3EPJ A;  3MHS C;  1ZAA C;  2EQ3 A;  2EPU A;  3VHT B;  2EM2 A;  1A1K A;  1ZU1 A;  2EOQ A;  2ENH A;  4WSG A;  2LT7 A;  2ENA A;  2EE8 A;  2EM4 A;  1A1F A;  2GHF A;  2EL4 A;  2EM3 A;  2YTN A;  2YTQ A;  2WBS A;  2EMA A;  2EMH A;  2EN1 A;  5KL2 A;  2EMK A;  1UBD C;  2DRP A;  2RSI A;  2ELZ A;  2WBT A;  1LLM C;  2EPX A;  2JPA A;  2YTG A;  2YRM A;  2GLI A;  2EPC A;  1YUI A;  2EOX A;  2YRK A;  2EQ1 A;  2LCE A;  5KL3 A;  1YUJ A;  4F6N A;  2EN2 A;  1JK1 A;  2EOM A;  4R2D A;  2EMF A;  2EL5 A;  2MKN A;  5KL6 A;  2EN6 A;  2VRD A;  2YTD A;  2YTO A;  2EOZ A;  2EM0 A;  2D9H A;  2EM6 A;  3M99 B;  2I13 A;  2LV2 A;  4R2R A;  2EM8 A;  1X6F A;  2DLQ A;  2ENC A;  2EPR A;  2E72 A;  1TF3 A;  1TF6 A;  4R2C A;  1G2F C;  1TN9 A;  2JP9 A;  2EQ0 A;  3EPH A;  1X5W A;  2LVH A;  2CSH A;  5KL4 A;  2A25 A;  4F6M A;  1JK2 A;  2EL6 A;  2YTE A;  2EOO A;  4X9J A;  2EJ4 A;  2EOY A;  1ZR9 A;  2ADR A;  2EOI A;  1BBO A;  2WBU A;  2BB8 A; 
#chains in the Genus database with same CATH topology
 1AH5 A;  2EMC A;  2N3G A;  5KL5 A;  4RHB B;  4I8O A;  1N33 E;  3BF2 A;  1YSA C;  3C4B A;  2N8X A;  3HTX A;  2EMX A;  3VYX A;  1T4O A;  4N4R B;  2CPN A;  2CTD A;  1UN6 B;  1X49 A;  2EPK X;  2EMI A;  1WJP A;  1X47 A;  1SR9 A;  4IS1 C;  2LTR A;  4R2P A;  2EOF A;  1AAY A;  1HNW E;  5ADZ A;  1BB8 A;  2EPA A;  2YSO A;  4LF9 E;  1GZ6 A;  3DF6 A;  3IWD A;  1PJQ A;  2B3T B;  2JXP A;  2NAB A;  2NA2 A;  2DGC A;  1UHZ A;  2YTP A;  4F54 A;  1G2D C;  2RPC A;  1ZBT A;  4JI7 E;  3C4T A;  2L33 A;  1IBK E;  5T6J A;  1DGC A;  4O24 A;  2EM9 A;  4KHP E;  2LO3 A;  3EPL A;  2UUC E;  2DLK A;  2EPP A;  4GKK E;  1I94 E;  4DR4 E;  4LU9 A;  4L5N C;  3F6H A;  1Z1B A;  5A6K A;  3KZY A;  2EPL X;  2LT7 A;  5IWA E;  2V83 A;  1A1F A;  5CFF E;  2LE2 A;  2VE7 C;  2EM3 A;  1UIL A;  3IWC A;  4M0V A;  4F9B B;  2EN1 A;  5KL2 A;  3THN A;  2M7Q A;  3AUZ A;  2ODR C;  4O5G A;  1YUI A;  4NXM E;  3J7A G;  2YRK A;  3OTO E;  4JI0 E;  2LCE A;  2JOB A;  4JI1 E;  5AC4 A;  1YYO A;  4DR7 E;  2V8Q B;  2MKN A;  5LMU E;  2F8B A;  2WZO A;  3M99 B;  4ZYH A;  3L00 A;  1T38 A;  1HNX E;  2LV2 A;  2LUQ A;  2RTX A;  1HR0 E;  5AC5 A;  1X6F A;  1TF3 A;  4J8Z A;  2JP9 A;  3EPH A;  2LVH A;  1J5E E;  2JVA A;  4NHR A;  4B3T E;  2NUE A;  2E1M A;  1EH7 A;  2EL6 A;  3FIG A;  4DMI A;  1L4S A;  5TSE A;  2BB8 A;  2ODR D;  1RQ0 A;  1A1J A;  1GQE A;  2DMI A;  3ADG A;  2PRT A;  2H36 X;  2MDG A;  1N3G A;  5IXM B;  1YZ9 A;  1IMU A;  4X64 E;  1IQO A;  2LBS B;  1DI2 A;  1QU6 A;  2L6M A;  1NEI A;  1IQS A;  4F2J C;  2EWL A;  2B7V A;  1QNT A;  1FJG E;  3BID A;  2L3C A;  4O43 A;  4MLV A;  4R03 A;  2EMW A;  2YTJ A;  4BHB A;  3MSW A;  4GZN C;  4JI2 E;  1X6H A;  4Q35 B;  1X3C A;  1ZBQ A;  3JU0 A;  2YRH A;  5KL7 A;  2YTF A;  3UK3 C;  1A1I A;  4OOG C;  1F2I G;  4IJD A;  2M4I A;  4DUZ E;  1HNZ E;  4JI4 E;  2EOR A;  1WHQ A;  2YTI A;  4BC9 A;  2EQ3 A;  4B3M E;  1ZU1 A;  2EOQ A;  4WSG A;  5AE3 A;  5IV8 B;  1XNQ E;  2GHF A;  1T39 A;  5AE1 A;  2K7I A;  4X65 E;  4LF5 E;  2EMK A;  1UBD C;  2IHR 1;  2ELZ A;  5AE2 A;  1LLM C;  5A6B A;  4TUG A;  2VQF E;  2GLI A;  4JI5 E;  2KHX A;  3KWR A;  3EQ1 A;  4LTY A;  4X66 E;  4BS9 A;  4ZYE A;  2L92 A;  2V89 A;  2EOM A;  2LMZ A;  2UUB E;  4DR6 E;  3OML A;  3J80 C;  1IBM E;  3TQM A;  1X48 A;  4NZV A;  2YTD A;  1EH8 A;  4DV6 E;  2EOZ A;  2EM0 A;  2EPN A;  4WX9 A;  2D9H A;  2I13 A;  2RS6 A;  5LLQ A;  2EPR A;  5A6J A;  2E72 A;  5AAS A;  1G2F C;  1O0W A;  2V85 A;  2CSH A;  1YYW A;  4BMJ A;  4F6M A;  2UUA E;  1JK2 A;  4Q28 A;  1T4N A;  2RS7 A;  1N32 E;  3ADJ A;  2HHH E;  2NUG A;  1T4L B;  2EJ4 A;  2LJU A;  4JV5 E;  4JI8 E;  2ADR A;  2EOI A;  2YZT A;  3KZZ A;  3P1X A;  2WBU A;  2DIX A;  3DJW A;  1PJT A;  1PKP A;  2EML A;  2YSP A;  2FGG A;  2HC5 A;  2V88 A;  3ECR A;  5A69 A;  2VQE E;  4DV4 E;  5LMN E;  1MEY C;  2MKD A;  2EOJ A;  2I9I A;  4KZS A;  4R2Q A;  4ZYD A;  4R2A A;  3T1Y E;  2YU8 A;  4DKK A;  2EM5 A;  4M30 A;  1IBL E;  2EN4 A;  4JI3 E;  2UXC E;  2UXD E;  2J7J A;  2WCC 3;  3EPK A;  2EN7 A;  1YYK A;  2E5L E;  2EMZ A;  2LJH A;  2EMB A;  3J81 C;  4TUI A;  2L2N A;  4R2E A;  1KJK A;  2EP3 A;  2HGH A;  3K6Q A;  4P78 A;  1NCS A;  2EN8 A;  3C6M A;  4R8O A;  2NUF A;  1KYQ A;  3LLH A;  4X8W A;  4LF6 E;  4HEI A;  2F4V E;  2LUP B;  4DUY E;  4FK5 C;  4R2S A;  2EM7 A;  2JYA A;  1A1L A;  3BGH A;  2EOH A;  2UXB E;  2Q8U A;  5F3W A;  4ZYG A;  2UU9 E;  4B3R E;  4DV5 E;  1ZAA C;  2YPN A;  4HTG A;  2ENA A;  1GTK A;  4BHC A;  2EM4 A;  2L3J A;  4DR5 E;  2EL4 A;  2YTN A;  4BCA A;  2KOU A;  2EMH A;  1XMQ E;  2DRP A;  2JPA A;  2YTG A;  2LRS A;  2G7H A;  2DB2 A;  4F9C B;  1WHN A;  4NXN E;  3IWB A;  4DV7 E;  3ADI A;  4WPY A;  1PDA A;  3HXL A;  2EN2 A;  4LFA E;  4LF8 E;  2EMF A;  2EL5 A;  2MC5 A;  5KL6 A;  2EN6 A;  2VRD A;  2YTO A;  2EM6 A;  2JY9 A;  1J26 A;  2DMY A;  2EPM X;  4R2R A;  2RQL A;  3VYY A;  3AV0 A;  2EPO A;  2BBG A;  1WXR A;  3HPZ A;  1YPN A;  4DV1 E;  2JR1 A;  1TN9 A;  4DR2 E;  3QG5 C;  3THO B;  3ZOQ B;  2L8T A;  1EH6 A;  1RC7 A;  2ZM6 E;  2FV4 B;  1PJS A;  4GKJ E;  4LF7 E;  1N36 E;  2L2K B;  5BR8 E;  2GPI A;  5A6B D;  1N34 E;  4LFC E;  2ELY A;  2YU5 A;  3MHH C;  4BBY A;  2B7T A;  2DSY A;  1RMD A;  2R1F A;  4GEQ B;  2EMY A;  2EMG A;  5A2Q C;  1BBG A;  1MGT A;  2M1S A;  1P47 A;  3H09 A;  4DV3 E;  2EOE A;  4WSP A;  1EKZ A;  2KON A;  2K4V A;  1SFE A;  1B69 A;  3BBG A;  4F9A B;  2MC6 A;  4P7D A;  2CT1 A;  2EPZ A;  1X6E A;  3ADL A;  2FTX B;  4WFT A;  3HQ1 A;  2EOS A;  2EZ6 A;  2M9A A;  3JAM C;  3JTZ A;  2EN3 A;  4M9V C;  4DV0 E;  3F6G A;  1XMO E;  3VK6 A;  5A6A A;  4YHH E;  3C6K A;  1XNR E;  4RH8 A;  2HJJ A;  1A1H A;  1WRJ A;  1A1G A;  2VF1 A;  3EPJ A;  4DR3 E;  1DQ3 A;  3MHS C;  2EPU A;  3VHT B;  2EM2 A;  1A1K A;  1FKA E;  2ENH A;  2MDR A;  2EE8 A;  2WBS A;  2YTQ A;  4O4K A;  2V86 A;  3LML A;  4AQY E;  2N3H A;  2EMA A;  4L8N A;  2R76 A;  2RSI A;  2WBT A;  3HPS A;  2EPX A;  4LFB E;  5LL6 R;  4BC7 A;  2YRM A;  2EPC A;  2B9D A;  1YFH A;  4M2Z A;  2EOX A;  2EQ1 A;  2YT4 A;  4OX9 E;  4YY3 E;  5KL3 A;  1YUJ A;  5IT9 C;  3RMP A;  4F6N A;  4X62 E;  2V87 A;  1JK1 A;  2RSM A;  4WXC A;  4DV2 E;  3J7Y p;  4R2D A;  1STU A;  2YWQ A;  5FLX C;  4LF4 E;  4JI6 E;  4WYQ B;  2EM8 A;  2DLQ A;  2ENC A;  5DNY A;  2JOX A;  4B3S E;  1TF6 A;  4R2C A;  2EQ0 A;  4DR1 E;  1X5W A;  5KL4 A;  4WXD A;  4JYA E;  2JWO A;  2A25 A;  4MLQ A;  2YTE A;  2EOO A;  2L2M A;  4K0K E;  4X9J A;  2EOY A;  2LTS A;  4KWY A;  3T1H E;  1ZR9 A;  1BBO A; 
#chains in the Genus database with same CATH homology
 2EML A;  2YSP A;  2EMC A;  2ELY A;  2YU5 A;  2DMI A;  3MHH C;  5KL5 A;  1A1J A;  2PRT A;  2MDG A;  1RMD A;  2R1F A;  1YSA C;  2EMY A;  2EMG A;  2MKD A;  1MEY C;  2EMX A;  1P47 A;  2EOE A;  2EOJ A;  1UN6 B;  2CTD A;  4R2Q A;  4R2A A;  2EMI A;  1WJP A;  4IS1 C;  4F2J C;  2YU8 A;  1B69 A;  4R2P A;  2EM5 A;  2EOF A;  1AAY A;  1BB8 A;  2EPA A;  2YSO A;  2EN4 A;  2EMW A;  2YTJ A;  2CT1 A;  2EPZ A;  1X6E A;  2J7J A;  2NAB A;  2WCC 3;  2EN7 A;  3EPK A;  2DGC A;  2EMZ A;  4GZN C;  2YTP A;  2EMB A;  1G2D C;  2EOS A;  1X6H A;  2M9A A;  2RPC A;  4R2E A;  1KJK A;  2EP3 A;  1X3C A;  5KL7 A;  2YRH A;  2YTF A;  2HGH A;  3UK3 C;  2EN3 A;  1A1I A;  4M9V C;  1DGC A;  1NCS A;  1F2I G;  2EN8 A;  4IJD A;  2EM9 A;  2LO3 A;  3EPL A;  2DLK A;  2EPP A;  2EOR A;  4FK5 C;  4R2S A;  2EM7 A;  1A1H A;  1A1L A;  2EOH A;  1A1G A;  2YTI A;  1Z1B A;  3EPJ A;  3MHS C;  1ZAA C;  2EQ3 A;  2EPU A;  3VHT B;  2EM2 A;  1A1K A;  1ZU1 A;  2EOQ A;  2ENH A;  4WSG A;  2LT7 A;  2ENA A;  2EE8 A;  2EM4 A;  1A1F A;  2GHF A;  2EL4 A;  2EM3 A;  2YTN A;  2YTQ A;  2WBS A;  2EMA A;  2EMH A;  2EN1 A;  5KL2 A;  2EMK A;  1UBD C;  2DRP A;  2RSI A;  2ELZ A;  2WBT A;  1LLM C;  2EPX A;  2JPA A;  2YTG A;  2YRM A;  2GLI A;  2EPC A;  1YUI A;  2EOX A;  2YRK A;  2EQ1 A;  2LCE A;  5KL3 A;  1YUJ A;  4F6N A;  2EN2 A;  1JK1 A;  2EOM A;  4R2D A;  2EMF A;  2EL5 A;  2MKN A;  5KL6 A;  2EN6 A;  2VRD A;  2YTD A;  2YTO A;  2EOZ A;  2EM0 A;  2D9H A;  2EM6 A;  3M99 B;  2I13 A;  2LV2 A;  4R2R A;  2EM8 A;  1X6F A;  2DLQ A;  2ENC A;  2EPR A;  2E72 A;  1TF3 A;  1TF6 A;  4R2C A;  1G2F C;  1TN9 A;  2JP9 A;  2EQ0 A;  3EPH A;  1X5W A;  2LVH A;  2CSH A;  5KL4 A;  2A25 A;  4F6M A;  1JK2 A;  2EL6 A;  2YTE A;  2EOO A;  4X9J A;  2EJ4 A;  2EOY A;  1ZR9 A;  2ADR A;  2EOI A;  1BBO A;  2WBU A;  2BB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...