4R2PA

Wilms tumor protein (wt1) zinc fingers in complex with hydroxymethylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2pA00
1P47A 2EMIA 2MKDA 2EL4A 1B69A 2EM4A 2YRKA 2MKNA 2EMHA 1RMDA 2EM7A 1TN9A 4F6NA 4GZNC 1A1JA 5KL5A 2ELZA 1TF6A 2EN1A 1LLMC 2JPAA 1A1KA 2LT7A 2EM2A 2YU5A 1F2IG 2BB8A 4R2AA 2CT1A 2PRTA 2EOIA 1X3CA 2EN3A 2RPCA 2YSPA 1TF3A 4R2PA 3EPLA 2EL6A 2YTJA 5KL6A 2EM8A 2EOEA 4M9VC 1MEYC 3MHHC 5KL7A 2LO3A 4X9JA 2EM0A 2WBUA 2EP3A 4R2DA 2GLIA 1WJPA 2EM9A 2EOXA 1X6HA 1YUIA 2YTEA 2YSOA 2EMYA 2A25A 1DGCA 2D9HA 2EMAA 2EOSA 3EPKA 2EMZA 2EN7A 2EMWA 2EPUA 2EOFA 2DLKA 2MDGA 2YTGA 3VHTB 2EMBA 4F6MA 2LVHA 2EPXA 2M9AA 2EM6A 1JK2A 1NCSA 1YUJA 2YTNA 1G2FC 1YSAC 2J7JA 4IJDA 2EMGA 2EM5A 2E72A 1JK1A 2EOJA 1X6FA 2EOYA 1ZAAC 4FK5C 3EPJA 1A1LA 2RSIA 2EQ0A 4WSGA 2EOHA 2NABA 2ADRA 2VRDA 3UK3C 1X6EA 5KL3A 2EMKA 2EMFA 3M99B 2YTDA 2EPCA 3MHSC 2DLQA 2EE8A 2EPPA 1G2DC 2EL5A 4R2EA 1UN6B 2CTDA 1ZR9A 4R2SA 2EORA 2WBSA 2WCC3 1BBOA 2EJ4A 2GHFA 1BB8A 4R2RA 2EMCA 2EOOA 2EPAA 2I13A 2DRPA 1A1HA 1UBDC 2YTFA 2YTIA 1A1FA 3EPHA 4R2QA 2EM3A 2ENHA 2R1FA 2YTQA 2EQ3A 5KL4A 1KJKA 2ENAA 2LV2A 2YTOA 2YRMA 1A1IA 2JP9A 2YU8A 2LCEA 2EMXA 4IS1C 1AAYA 2EN8A 2EMLA 2EOZA 2EOQA 2WBTA 2DMIA 2EN2A 4F2JC 2EN6A 2EPRA 1ZU1A 1A1GA 5KL2A 2CSHA 2EOMA 1Z1BA 2DGCA 2EN4A 2EPZA 1X5WA 2ENCA 2HGHA 4R2CA 2YRHA 2YTPA 2EQ1A 2ELYA
chains in the Genus database with same CATH superfamily
5LMNE 1J26A 2EL4A 4X64E 3KZYA 3JTZA 2YRKA 1RMDA 2M7QA 4GZNC 2HC5A 2L33A 1YYKA 3J7AG 1TF6A 1IQSA 2EN1A 3IWCA 4DR4E 1LLMC 2JPAA 2JVAA 1EH8A 4JI3E 2YU5A 3HPZA 1YYOA 4AQYE 2EN3A 2RPCA 2EL6A 2YTJA 2EM8A 4M9VC 1SR9A 2LO3A 4X9JA 2EM0A 2E5LE 4F54A 4LTYA 4R2DA 4JI4E 2GLIA 2EWLA 2EM9A 4M30A 5IV8B 2EMYA 2A25A 1WHQA 4LF7E 1DGCA 2EOSA 2JR1A 3T1YE 2EPMX 2EPUA 2EOFA 1YYWA 2DLKA 3JAMC 2UUAE 2JOBA 2EPKX 2LUPB 1X47A 3F6HA 2LJHA 2LVHA 2EM6A 5TSEA 1GQEA 2YTNA 4RHBB 2ODRD 1YSAC 4GKJE 2K4VA 4R03A 2L2MA 1JK1A 2EM5A 2LTRA 2VE7C 5F3WA 2EOYA 5A6BD 2DIXA 2UUCE 2L3CA 2NABA 1T4OA 2ADRA 5AASA 3UK3C 2H36X 3BBGA 2B7TA 2N3GA 2EMKA 2EPOA 2EMFA 3KWRA 2YTDA 1YZ9A 4DMIA 1SFEA 2EE8A 4DV5E 1WHNA 4DV2E 2EPPA 2EL5A 1ZR9A 2WZOA 3J7Yp 3IWBA 4DUZE 4P78A 3C4BA 4NXME 4Q35B 3IWDA 2EMCA 2FGGA 3ADIA 2I13A 4F9BB 1A1HA 2YTFA 4HEIA 1HNXE 3EPHA 1O0WA 4ZYGA 2EM3A 4YY3E 4JI1E 4BMJA 4X66E 2EQ3A 2ENAA 1RC7A 2JP9A 2YU8A 3OTOE 4IS1C 1AAYA 4WPYA 1XNQE 2VQFE 2EOQA 2DMIA 1PDAA 1ZU1A 3BF2A 1A1GA 3C6KA 4JV5E 4DV0E 2YZTA 2YTPA 3RMPA 2EPNA 4JI5E 1WRJA 4M0VA 3LMLA 3VK6A 2L8TA 4DKKA 4NZVA 4JI2E 4F6NA 1A1JA 4LF9E 2ELZA 2V88A 1N36E 1A1KA 2LT7A 4X62E 4ZYHA 4ZYDA 2MDRA 4X65E 2BB8A 1F2IG 2CT1A 4LF6E 4O5GA 3VYYA 1TF3A 4MLQA 4BHBA 3KZZA 1IBKE 4R2PA 4BHCA 2RS7A 5KL7A 2EP3A 1N34E 2DMYA 2EOXA 1X6HA 2YTEA 2YSOA 1HR0E 4BS9A 2D9HA 2EMAA 3EPKA 2EMZA 4I8OA 4LF8E 4BBYA 1GTKA 3AV0A 2R76A 2MC5A 1X48A 2VQEE 2NUFA 2YTGA 3C4TA 3VHTB 4NXNE 4MLVA 3K6QA 4OX9E 2N3HA 2CPNA 4JI8E 1JK2A 1YUJA 1WXRA 5ADZA 4B3SE 1G2FC 1L4SA 3THNA 1EH6A 4F9AB 4DV3E 1ZAAC 1EKZA 2RSIA 1T4LB 5AE1A 4WSGA 5DNYA 4TUIA 3T1HE 5A6JA 4LFAE 1STUA 5KL3A 5FLXC 5AE2A 1YFHA 2EPCA 3MHSC 1IMUA 1I94E 1G2DC 1QU6A 4R2EA 4JI7E 2CTDA 4WXCA 5BR8E 4B3TE 2EORA 4GEQB 4BC7A 2JOXA 2K7IA 4LFBE 5A2QC 4R2RA 2DRPA 1A1FA 5IWAE 1FKAE 5T6JA 4R2QA 2YWQA 2LMZA 2NUEA 2Q8UA 4JI6E 4DR7E 4RH8A 1KJKA 2EZ6A 4O43A 2LBSB 1A1IA 2JXPA 4F9CB 2E1MA 4O24A 5IT9C 2EMLA 4F2JC 3MSWA 2EN6A 2DSYA 3THOB 1HNZE 3J81C 5KL2A 1Z1BA 2EN4A 3BGHA 2UXBE 2YPNA 5A69A 3HPSA 2ELYA 1QNTA 1P47A 2NA2A 2UU9E 1B69A 2EM4A 2M4IA 3HXLA 1KYQA 2EMHA 3F6GA 1DI2A 2LUQA 5IXMB 2M1SA 3HTXA 3VYXA 2L6MA 1X49A 2B7VA 4JI0E 2KHXA 3JU0A 4BCAA 2V89A 1PJSA 2PRTA 5AC4A 4P7DA 2EOIA 1X3CA 2YSPA 4KHPE 3EPLA 2DB2A 2MC6A 5KL6A 2JYAA 4WYQB 3ZOQB 2WBUA 2JWOA 4N4RB 3J80C 1WJPA 2FV4B 1ZBQA 1T4NA 4KZSA 4OOGC 5LLQA 2EN7A 2F8BA 4LU9A 2EPLX 2MDGA 1N33E 1YPNA 4WXDA 2B9DA 4J8ZA 2EMBA 4F6MA 4GKKE 4BC9A 2M9AA 1UHZA 4R8OA 2G7HA 1HNWE 2J7JA 1UILA 1AH5A 2EMGA 4IJDA 5LMUE 4FK5C 3ADJA 3EPJA 4WFTA 2EOHA 1J5EE 3ADGA 1X6EA 5A6AA 4B3ME 3M99B 2DLQA 4DR1E 4DR3E 2RTXA 2VF1A 3ADLA 4LFCE 1IQOA 3HQ1A 3P1XA 1BBOA 4DR6E 2GHFA 2LRSA 2EPAA 4WX9A 2KONA 4HTGA 4LF5E 1XMQE 2V83A 5KL4A 2LV2A 3EQ1A 2YRMA 2ZM6E 1BBGA 2EN8A 2EOZA 2WBTA 2EN2A 2EPRA 4L8NA 3AUZA 2UXCE 2EOMA 2DGCA 2EPZA 1XNRE 1X5WA 3QG5C 2HGHA 4TUGA 2YRHA 3H09A 2YT4A 1N32E 3FIGA 2EMIA 1T38A 2MKDA 2MKNA 2EM7A 3ECRA 1TN9A 5KL5A 2NUGA 2HHHE 4KWYA 2ODRC 4DR5E 2EM2A 1IBME 2L2NA 2UUBE 4R2AA 3OMLA 4DUYE 4DR2E 4B3RE 2EOEA 1MEYC 3TQMA 3MHHC 2UXDE 4Q28A 4X8WA 2RS6A 1YUIA 4DV6E 2I9IA 5LL6R 2F4VE 3DF6A 2EMWA 1PKPA 2JY9A 5AC5A 2RQLA 2FTXB 3BIDA 2EPXA 2GPIA 1NCSA 2L3JA 4K0KE 2LTSA 2E72A 2B3TB 2EOJA 5AE3A 3DJWA 1A1LA 1N3GA 2EQ0A 2HJJA 2L92A 3LLHA 1ZBTA 1GZ6A 2RSMA 2VRDA 4DV1E 1XMOE 3C6MA 2KOUA 4O4KA 1PJQA 1FJGE 1UN6B 2LJUA 4NHRA 4L5NC 4R2SA 2WBSA 2WCC3 2EJ4A 4YHHE 1BB8A 2V87A 1RQ0A 2EOOA 1T39A 1UBDC 5CFFE 2YTIA 4JYAE 1EH7A 2ENHA 4DV4E 2R1FA 1IBLE 2YTQA 1MGTA 1NEIA 2BBGA 2V85A 2YTOA 1DQ3A 4LF4E 3L00A 2IHR1 2LCEA 2EMXA 4WSPA 2L2KB 5A6BA 1PJTA 2CSHA 2LE2A 4ZYEA 4M2ZA 5A6KA 2N8XA 2ENCA 4DV7E 4R2CA 2V8QB 2V86A 2EQ1A 1X6FA
chains in the Genus database with same CATH topology
1P47A 2EMIA 2MKDA 2EL4A 1B69A 2EM4A 2YRKA 2MKNA 2EMHA 1RMDA 2EM7A 1TN9A 4F6NA 4GZNC 1A1JA 5KL5A 2ELZA 1TF6A 2EN1A 1LLMC 2JPAA 1A1KA 2LT7A 2EM2A 2YU5A 1F2IG 2BB8A 4R2AA 2CT1A 2PRTA 2EOIA 1X3CA 2EN3A 2RPCA 2YSPA 1TF3A 4R2PA 3EPLA 2EL6A 2YTJA 5KL6A 2EM8A 2EOEA 4M9VC 1MEYC 3MHHC 5KL7A 2LO3A 4X9JA 2EM0A 2WBUA 2EP3A 4R2DA 2GLIA 1WJPA 2EM9A 2EOXA 1X6HA 1YUIA 2YTEA 2YSOA 2EMYA 2A25A 1DGCA 2D9HA 2EMAA 2EOSA 3EPKA 2EMZA 2EN7A 2EMWA 2EPUA 2EOFA 2DLKA 2MDGA 2YTGA 3VHTB 2EMBA 4F6MA 2LVHA 2EPXA 2M9AA 2EM6A 1JK2A 1NCSA 1YUJA 2YTNA 1G2FC 1YSAC 2J7JA 4IJDA 2EMGA 2EM5A 2E72A 1JK1A 2EOJA 1X6FA 2EOYA 1ZAAC 4FK5C 3EPJA 1A1LA 2RSIA 2EQ0A 4WSGA 2EOHA 2NABA 2ADRA 2VRDA 3UK3C 1X6EA 5KL3A 2EMKA 2EMFA 3M99B 2YTDA 2EPCA 3MHSC 2DLQA 2EE8A 2EPPA 1G2DC 2EL5A 4R2EA 1UN6B 2CTDA 1ZR9A 4R2SA 2EORA 2WBSA 2WCC3 1BBOA 2EJ4A 2GHFA 1BB8A 4R2RA 2EMCA 2EOOA 2EPAA 2I13A 2DRPA 1A1HA 1UBDC 2YTFA 2YTIA 1A1FA 3EPHA 4R2QA 2EM3A 2ENHA 2R1FA 2YTQA 2EQ3A 5KL4A 1KJKA 2ENAA 2LV2A 2YTOA 2YRMA 1A1IA 2JP9A 2YU8A 2LCEA 2EMXA 4IS1C 1AAYA 2EN8A 2EMLA 2EOZA 2EOQA 2WBTA 2DMIA 2EN2A 4F2JC 2EN6A 2EPRA 1ZU1A 1A1GA 5KL2A 2CSHA 2EOMA 1Z1BA 2DGCA 2EN4A 2EPZA 1X5WA 2ENCA 2HGHA 4R2CA 2YRHA 2YTPA 2EQ1A 2ELYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P47 A;  2EMI A;  2MKD A;  2EL4 A;  1B69 A;  2EM4 A;  2YRK A;  2MKN A;  2EMH A;  1RMD A;  2EM7 A;  1TN9 A;  4F6N A;  4GZN C;  1A1J A;  5KL5 A;  2ELZ A;  1TF6 A;  2EN1 A;  1LLM C;  2JPA A;  1A1K A;  2LT7 A;  2EM2 A;  2YU5 A;  1F2I G;  2BB8 A;  4R2A A;  2CT1 A;  2PRT A;  2EOI A;  1X3C A;  2EN3 A;  2RPC A;  2YSP A;  1TF3 A;  4R2P A;  3EPL A;  2EL6 A;  2YTJ A;  5KL6 A;  2EM8 A;  2EOE A;  4M9V C;  1MEY C;  3MHH C;  5KL7 A;  2LO3 A;  4X9J A;  2EM0 A;  2WBU A;  2EP3 A;  4R2D A;  2GLI A;  1WJP A;  2EM9 A;  2EOX A;  1X6H A;  1YUI A;  2YTE A;  2YSO A;  2EMY A;  2A25 A;  1DGC A;  2D9H A;  2EMA A;  2EOS A;  3EPK A;  2EMZ A;  2EN7 A;  2EMW A;  2EPU A;  2EOF A;  2DLK A;  2MDG A;  2YTG A;  3VHT B;  2EMB A;  4F6M A;  2LVH A;  2EPX A;  2M9A A;  2EM6 A;  1JK2 A;  1NCS A;  1YUJ A;  2YTN A;  1G2F C;  1YSA C;  2J7J A;  4IJD A;  2EMG A;  2EM5 A;  2E72 A;  1JK1 A;  2EOJ A;  1X6F A;  2EOY A;  1ZAA C;  4FK5 C;  3EPJ A;  1A1L A;  2RSI A;  2EQ0 A;  4WSG A;  2EOH A;  2NAB A;  2ADR A;  2VRD A;  3UK3 C;  1X6E A;  5KL3 A;  2EMK A;  2EMF A;  3M99 B;  2YTD A;  2EPC A;  3MHS C;  2DLQ A;  2EE8 A;  2EPP A;  1G2D C;  2EL5 A;  4R2E A;  1UN6 B;  2CTD A;  1ZR9 A;  4R2S A;  2EOR A;  2WBS A;  2WCC 3;  1BBO A;  2EJ4 A;  2GHF A;  1BB8 A;  4R2R A;  2EMC A;  2EOO A;  2EPA A;  2I13 A;  2DRP A;  1A1H A;  1UBD C;  2YTF A;  2YTI A;  1A1F A;  3EPH A;  4R2Q A;  2EM3 A;  2ENH A;  2R1F A;  2YTQ A;  2EQ3 A;  5KL4 A;  1KJK A;  2ENA A;  2LV2 A;  2YTO A;  2YRM A;  1A1I A;  2JP9 A;  2YU8 A;  2LCE A;  2EMX A;  4IS1 C;  1AAY A;  2EN8 A;  2EML A;  2EOZ A;  2EOQ A;  2WBT A;  2DMI A;  2EN2 A;  4F2J C;  2EN6 A;  2EPR A;  1ZU1 A;  1A1G A;  5KL2 A;  2CSH A;  2EOM A;  1Z1B A;  2DGC A;  2EN4 A;  2EPZ A;  1X5W A;  2ENC A;  2HGH A;  4R2C A;  2YRH A;  2YTP A;  2EQ1 A;  2ELY A; 
#chains in the Genus database with same CATH topology
 5LMN E;  1J26 A;  2EL4 A;  4X64 E;  3KZY A;  3JTZ A;  2YRK A;  1RMD A;  2M7Q A;  4GZN C;  2HC5 A;  2L33 A;  1YYK A;  3J7A G;  1TF6 A;  1IQS A;  2EN1 A;  3IWC A;  4DR4 E;  1LLM C;  2JPA A;  2JVA A;  1EH8 A;  4JI3 E;  2YU5 A;  3HPZ A;  1YYO A;  4AQY E;  2EN3 A;  2RPC A;  2EL6 A;  2YTJ A;  2EM8 A;  4M9V C;  1SR9 A;  2LO3 A;  4X9J A;  2EM0 A;  2E5L E;  4F54 A;  4LTY A;  4R2D A;  4JI4 E;  2GLI A;  2EWL A;  2EM9 A;  4M30 A;  5IV8 B;  2EMY A;  2A25 A;  1WHQ A;  4LF7 E;  1DGC A;  2EOS A;  2JR1 A;  3T1Y E;  2EPM X;  2EPU A;  2EOF A;  1YYW A;  2DLK A;  3JAM C;  2UUA E;  2JOB A;  2EPK X;  2LUP B;  1X47 A;  3F6H A;  2LJH A;  2LVH A;  2EM6 A;  5TSE A;  1GQE A;  2YTN A;  4RHB B;  2ODR D;  1YSA C;  4GKJ E;  2K4V A;  4R03 A;  2L2M A;  1JK1 A;  2EM5 A;  2LTR A;  2VE7 C;  5F3W A;  2EOY A;  5A6B D;  2DIX A;  2UUC E;  2L3C A;  2NAB A;  1T4O A;  2ADR A;  5AAS A;  3UK3 C;  2H36 X;  3BBG A;  2B7T A;  2N3G A;  2EMK A;  2EPO A;  2EMF A;  3KWR A;  2YTD A;  1YZ9 A;  4DMI A;  1SFE A;  2EE8 A;  4DV5 E;  1WHN A;  4DV2 E;  2EPP A;  2EL5 A;  1ZR9 A;  2WZO A;  3J7Y p;  3IWB A;  4DUZ E;  4P78 A;  3C4B A;  4NXM E;  4Q35 B;  3IWD A;  2EMC A;  2FGG A;  3ADI A;  2I13 A;  4F9B B;  1A1H A;  2YTF A;  4HEI A;  1HNX E;  3EPH A;  1O0W A;  4ZYG A;  2EM3 A;  4YY3 E;  4JI1 E;  4BMJ A;  4X66 E;  2EQ3 A;  2ENA A;  1RC7 A;  2JP9 A;  2YU8 A;  3OTO E;  4IS1 C;  1AAY A;  4WPY A;  1XNQ E;  2VQF E;  2EOQ A;  2DMI A;  1PDA A;  1ZU1 A;  3BF2 A;  1A1G A;  3C6K A;  4JV5 E;  4DV0 E;  2YZT A;  2YTP A;  3RMP A;  2EPN A;  4JI5 E;  1WRJ A;  4M0V A;  3LML A;  3VK6 A;  2L8T A;  4DKK A;  4NZV A;  4JI2 E;  4F6N A;  1A1J A;  4LF9 E;  2ELZ A;  2V88 A;  1N36 E;  1A1K A;  2LT7 A;  4X62 E;  4ZYH A;  4ZYD A;  2MDR A;  4X65 E;  2BB8 A;  1F2I G;  2CT1 A;  4LF6 E;  4O5G A;  3VYY A;  1TF3 A;  4MLQ A;  4BHB A;  3KZZ A;  1IBK E;  4R2P A;  4BHC A;  2RS7 A;  5KL7 A;  2EP3 A;  1N34 E;  2DMY A;  2EOX A;  1X6H A;  2YTE A;  2YSO A;  1HR0 E;  4BS9 A;  2D9H A;  2EMA A;  3EPK A;  2EMZ A;  4I8O A;  4LF8 E;  4BBY A;  1GTK A;  3AV0 A;  2R76 A;  2MC5 A;  1X48 A;  2VQE E;  2NUF A;  2YTG A;  3C4T A;  3VHT B;  4NXN E;  4MLV A;  3K6Q A;  4OX9 E;  2N3H A;  2CPN A;  4JI8 E;  1JK2 A;  1YUJ A;  1WXR A;  5ADZ A;  4B3S E;  1G2F C;  1L4S A;  3THN A;  1EH6 A;  4F9A B;  4DV3 E;  1ZAA C;  1EKZ A;  2RSI A;  1T4L B;  5AE1 A;  4WSG A;  5DNY A;  4TUI A;  3T1H E;  5A6J A;  4LFA E;  1STU A;  5KL3 A;  5FLX C;  5AE2 A;  1YFH A;  2EPC A;  3MHS C;  1IMU A;  1I94 E;  1G2D C;  1QU6 A;  4R2E A;  4JI7 E;  2CTD A;  4WXC A;  5BR8 E;  4B3T E;  2EOR A;  4GEQ B;  4BC7 A;  2JOX A;  2K7I A;  4LFB E;  5A2Q C;  4R2R A;  2DRP A;  1A1F A;  5IWA E;  1FKA E;  5T6J A;  4R2Q A;  2YWQ A;  2LMZ A;  2NUE A;  2Q8U A;  4JI6 E;  4DR7 E;  4RH8 A;  1KJK A;  2EZ6 A;  4O43 A;  2LBS B;  1A1I A;  2JXP A;  4F9C B;  2E1M A;  4O24 A;  5IT9 C;  2EML A;  4F2J C;  3MSW A;  2EN6 A;  2DSY A;  3THO B;  1HNZ E;  3J81 C;  5KL2 A;  1Z1B A;  2EN4 A;  3BGH A;  2UXB E;  2YPN A;  5A69 A;  3HPS A;  2ELY A;  1QNT A;  1P47 A;  2NA2 A;  2UU9 E;  1B69 A;  2EM4 A;  2M4I A;  3HXL A;  1KYQ A;  2EMH A;  3F6G A;  1DI2 A;  2LUQ A;  5IXM B;  2M1S A;  3HTX A;  3VYX A;  2L6M A;  1X49 A;  2B7V A;  4JI0 E;  2KHX A;  3JU0 A;  4BCA A;  2V89 A;  1PJS A;  2PRT A;  5AC4 A;  4P7D A;  2EOI A;  1X3C A;  2YSP A;  4KHP E;  3EPL A;  2DB2 A;  2MC6 A;  5KL6 A;  2JYA A;  4WYQ B;  3ZOQ B;  2WBU A;  2JWO A;  4N4R B;  3J80 C;  1WJP A;  2FV4 B;  1ZBQ A;  1T4N A;  4KZS A;  4OOG C;  5LLQ A;  2EN7 A;  2F8B A;  4LU9 A;  2EPL X;  2MDG A;  1N33 E;  1YPN A;  4WXD A;  2B9D A;  4J8Z A;  2EMB A;  4F6M A;  4GKK E;  4BC9 A;  2M9A A;  1UHZ A;  4R8O A;  2G7H A;  1HNW E;  2J7J A;  1UIL A;  1AH5 A;  2EMG A;  4IJD A;  5LMU E;  4FK5 C;  3ADJ A;  3EPJ A;  4WFT A;  2EOH A;  1J5E E;  3ADG A;  1X6E A;  5A6A A;  4B3M E;  3M99 B;  2DLQ A;  4DR1 E;  4DR3 E;  2RTX A;  2VF1 A;  3ADL A;  4LFC E;  1IQO A;  3HQ1 A;  3P1X A;  1BBO A;  4DR6 E;  2GHF A;  2LRS A;  2EPA A;  4WX9 A;  2KON A;  4HTG A;  4LF5 E;  1XMQ E;  2V83 A;  5KL4 A;  2LV2 A;  3EQ1 A;  2YRM A;  2ZM6 E;  1BBG A;  2EN8 A;  2EOZ A;  2WBT A;  2EN2 A;  2EPR A;  4L8N A;  3AUZ A;  2UXC E;  2EOM A;  2DGC A;  2EPZ A;  1XNR E;  1X5W A;  3QG5 C;  2HGH A;  4TUG A;  2YRH A;  3H09 A;  2YT4 A;  1N32 E;  3FIG A;  2EMI A;  1T38 A;  2MKD A;  2MKN A;  2EM7 A;  3ECR A;  1TN9 A;  5KL5 A;  2NUG A;  2HHH E;  4KWY A;  2ODR C;  4DR5 E;  2EM2 A;  1IBM E;  2L2N A;  2UUB E;  4R2A A;  3OML A;  4DUY E;  4DR2 E;  4B3R E;  2EOE A;  1MEY C;  3TQM A;  3MHH C;  2UXD E;  4Q28 A;  4X8W A;  2RS6 A;  1YUI A;  4DV6 E;  2I9I A;  5LL6 R;  2F4V E;  3DF6 A;  2EMW A;  1PKP A;  2JY9 A;  5AC5 A;  2RQL A;  2FTX B;  3BID A;  2EPX A;  2GPI A;  1NCS A;  2L3J A;  4K0K E;  2LTS A;  2E72 A;  2B3T B;  2EOJ A;  5AE3 A;  3DJW A;  1A1L A;  1N3G A;  2EQ0 A;  2HJJ A;  2L92 A;  3LLH A;  1ZBT A;  1GZ6 A;  2RSM A;  2VRD A;  4DV1 E;  1XMO E;  3C6M A;  2KOU A;  4O4K A;  1PJQ A;  1FJG E;  1UN6 B;  2LJU A;  4NHR A;  4L5N C;  4R2S A;  2WBS A;  2WCC 3;  2EJ4 A;  4YHH E;  1BB8 A;  2V87 A;  1RQ0 A;  2EOO A;  1T39 A;  1UBD C;  5CFF E;  2YTI A;  4JYA E;  1EH7 A;  2ENH A;  4DV4 E;  2R1F A;  1IBL E;  2YTQ A;  1MGT A;  1NEI A;  2BBG A;  2V85 A;  2YTO A;  1DQ3 A;  4LF4 E;  3L00 A;  2IHR 1;  2LCE A;  2EMX A;  4WSP A;  2L2K B;  5A6B A;  1PJT A;  2CSH A;  2LE2 A;  4ZYE A;  4M2Z A;  5A6K A;  2N8X A;  2ENC A;  4DV7 E;  4R2C A;  2V8Q B;  2V86 A;  2EQ1 A;  1X6F A; 
#chains in the Genus database with same CATH homology
 1P47 A;  2EMI A;  2MKD A;  2EL4 A;  1B69 A;  2EM4 A;  2YRK A;  2MKN A;  2EMH A;  1RMD A;  2EM7 A;  1TN9 A;  4F6N A;  4GZN C;  1A1J A;  5KL5 A;  2ELZ A;  1TF6 A;  2EN1 A;  1LLM C;  2JPA A;  1A1K A;  2LT7 A;  2EM2 A;  2YU5 A;  1F2I G;  2BB8 A;  4R2A A;  2CT1 A;  2PRT A;  2EOI A;  1X3C A;  2EN3 A;  2RPC A;  2YSP A;  1TF3 A;  4R2P A;  3EPL A;  2EL6 A;  2YTJ A;  5KL6 A;  2EM8 A;  2EOE A;  4M9V C;  1MEY C;  3MHH C;  5KL7 A;  2LO3 A;  4X9J A;  2EM0 A;  2WBU A;  2EP3 A;  4R2D A;  2GLI A;  1WJP A;  2EM9 A;  2EOX A;  1X6H A;  1YUI A;  2YTE A;  2YSO A;  2EMY A;  2A25 A;  1DGC A;  2D9H A;  2EMA A;  2EOS A;  3EPK A;  2EMZ A;  2EN7 A;  2EMW A;  2EPU A;  2EOF A;  2DLK A;  2MDG A;  2YTG A;  3VHT B;  2EMB A;  4F6M A;  2LVH A;  2EPX A;  2M9A A;  2EM6 A;  1JK2 A;  1NCS A;  1YUJ A;  2YTN A;  1G2F C;  1YSA C;  2J7J A;  4IJD A;  2EMG A;  2EM5 A;  2E72 A;  1JK1 A;  2EOJ A;  1X6F A;  2EOY A;  1ZAA C;  4FK5 C;  3EPJ A;  1A1L A;  2RSI A;  2EQ0 A;  4WSG A;  2EOH A;  2NAB A;  2ADR A;  2VRD A;  3UK3 C;  1X6E A;  5KL3 A;  2EMK A;  2EMF A;  3M99 B;  2YTD A;  2EPC A;  3MHS C;  2DLQ A;  2EE8 A;  2EPP A;  1G2D C;  2EL5 A;  4R2E A;  1UN6 B;  2CTD A;  1ZR9 A;  4R2S A;  2EOR A;  2WBS A;  2WCC 3;  1BBO A;  2EJ4 A;  2GHF A;  1BB8 A;  4R2R A;  2EMC A;  2EOO A;  2EPA A;  2I13 A;  2DRP A;  1A1H A;  1UBD C;  2YTF A;  2YTI A;  1A1F A;  3EPH A;  4R2Q A;  2EM3 A;  2ENH A;  2R1F A;  2YTQ A;  2EQ3 A;  5KL4 A;  1KJK A;  2ENA A;  2LV2 A;  2YTO A;  2YRM A;  1A1I A;  2JP9 A;  2YU8 A;  2LCE A;  2EMX A;  4IS1 C;  1AAY A;  2EN8 A;  2EML A;  2EOZ A;  2EOQ A;  2WBT A;  2DMI A;  2EN2 A;  4F2J C;  2EN6 A;  2EPR A;  1ZU1 A;  1A1G A;  5KL2 A;  2CSH A;  2EOM A;  1Z1B A;  2DGC A;  2EN4 A;  2EPZ A;  1X5W A;  2ENC A;  2HGH A;  4R2C A;  2YRH A;  2YTP A;  2EQ1 A;  2ELY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...