4R2PA

Wilms tumor protein (wt1) zinc fingers in complex with hydroxymethylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2pA00
2EQ1A 2EQ0A 1TN9A 2ADRA 1X6HA 1A1LA 2EN3A 2EOSA 2RSIA 4R2AA 2J7JA 1X6FA 2LO3A 2YRMA 1TF6A 2GLIA 3MHSC 2YTIA 2EOOA 2LCEA 2DRPA 2EPZA 3EPLA 2EMKA 2JPAA 2EM7A 2EQ3A 2EMIA 2YU5A 1A1IA 5KL2A 2M9AA 2EMAA 2EL6A 2EOZA 2YTEA 2EM5A 4IS1C 2DLQA 1YSAC 1LLMC 2YTGA 2ENCA 2EN7A 2EN6A 2WBUA 4R2DA 1P47A 1A1JA 2YTQA 3EPHA 2R1FA 2YU8A 4X9JA 2CSHA 1BBOA 2ELYA 2YRHA 2HGHA 2EMGA 2EN1A 1WJPA 5KL5A 2EM8A 2BB8A 2DMIA 2EN4A 2YRKA 3VHTB 2YTDA 2YTOA 1BB8A 2EOJA 4IJDA 1TF3A 1YUJA 2EOFA 1Z1BA 1A1GA 1NCSA 1ZAAC 2NABA 2VRDA 2EMWA 2EOYA 2EL4A 2EPUA 2YTPA 2EOIA 2EPRA 3MHHC 2EOQA 2EMXA 3EPJA 1JK1A 2EMFA 2EPXA 2YSPA 2EOEA 2PRTA 4R2CA 2I13A 2GHFA 2EOHA 2DGCA 2EL5A 1X5WA 4R2EA 2A25A 4F2JC 3EPKA 3UK3C 2JP9A 1F2IG 2EM0A 2EM6A 2EMYA 4R2RA 4R2SA 1JK2A 4M9VC 2LT7A 2EJ4A 2EOXA 4FK5C 2ENAA 1ZU1A 4R2PA 2CT1A 2DLKA 4WSGA 1G2FC 1RMDA 2CTDA 2EE8A 2EM2A 1A1FA 2MDGA 2EORA 2EMHA 1YUIA 1ZR9A 2EM3A 1KJKA 2D9HA 1UN6B 2EMBA 2EPAA 2ELZA 2EMZA 2EP3A 2EPPA 1A1HA 2MKNA 1X6EA 2EOMA 2EMLA 2WBSA 4R2QA 1X3CA 5KL6A 2YTJA 5KL4A 3M99B 1G2DC 1AAYA 4GZNC 2WCC3 2YTNA 1B69A 2YTFA 2EM9A 4F6NA 1A1KA 5KL3A 1UBDC 5KL7A 2EM4A 4F6MA 1MEYC 2RPCA 2YSOA 2LVHA 2MKDA 2WBTA 2EMCA 2EN2A 2LV2A 2ENHA 2EPCA 2EN8A 2E72A 1DGCA
chains in the Genus database with same CATH superfamily
4LF7E 2DMYA 2F8BA 3IWDA 3VK6A 5A6JA 2NUGA 4OX9E 2EPOA 3BBGA 1A1LA 2R76A 2EN3A 2EOSA 1EH8A 2J7JA 4JYAE 2YWQA 2YTIA 2DRPA 2EM7A 4F9AB 2KONA 4X8WA 5F3WA 2YTEA 1HNZE 2V86A 2EM5A 4IS1C 3DJWA 2YTGA 4DR7E 3C6MA 2ENCA 2DIXA 2EN7A 2KHXA 2R1FA 4BCAA 2EPNA 1BBOA 2YRHA 2HGHA 2EMGA 1HNWE 2B7VA 1XMOE 2BB8A 2RQLA 4JI6E 4O5GA 2V88A 3VHTB 2YTDA 1T38A 1TF3A 2RS6A 1PJTA 2EOFA 3BF2A 2EWLA 2NABA 4JI7E 2VRDA 4X64E 4R03A 2JWOA 4LFAE 2RSMA 4BMJA 4DR6E 1MGTA 2EPUA 3MHHC 4M2ZA 2EOQA 3H09A 5LLQA 4LF6E 1BBGA 1PDAA 1T4OA 4BC9A 3KZZA 2HC5A 2I13A 4K0KE 2DGCA 4B3TE 2LUQA 4R2EA 4F2JC 4BS9A 4JI4E 3ADJA 4JI3E 2JOBA 2E5LE 4R2SA 4P7DA 1N36E 1JK2A 2CPNA 4M0VA 2B9DA 2CT1A 2L33A 3ADLA 1IMUA 2EM2A 1WHQA 4DR1E 3P1XA 1A1FA 4X62E 5T6JA 1YUIA 2EM3A 3FIGA 2D9HA 3LLHA 4DV3E 1QU6A 1HR0E 4KZSA 4X66E 4L5NC 1UN6B 2EMBA 3T1HE 1PJSA 1X48A 4R8OA 2EPPA 1A1HA 2JOXA 5ADZA 4R2QA 3T1YE 1X3CA 4MLVA 2HHHE 1N33E 1N3GA 3RMPA 3F6GA 3JTZA 4GZNC 2KOUA 2YTNA 1UBDC 2EM4A 1MEYC 2V8QB 4O24A 1AH5A 2LVHA 2YPNA 1ZBQA 2L2NA 2EQ0A 1X6HA 4ZYDA 1NEIA 2LO3A 1TF6A 3MHSC 2LCEA 5A69A 2EPZA 2N8XA 2V83A 2B7TA 2DSYA 4JI5E 1YFHA 2BBGA 2EQ3A 2L92A 4BBYA 4YY3E 3DF6A 2M4IA 4B3RE 4DV6E 2WBUA 3HTXA 1P47A 2V89A 2YTQA 4JV5E 2VF1A 2EN1A 5KL5A 5LL6R 2EN4A 1DQ3A 3C4BA 2WZOA 4DV1E 2NUEA 3HPZA 1BB8A 1RQ0A 2EOJA 2EPKX 4IJDA 3ADIA 1ZBTA 4WFTA 5A6BA 4DR5E 1X49A 3IWCA 1IQOA 4GKJE 2EPMX 1EH7A 2UUBE 4DV5E 1I94E 2N3HA 1IBLE 2VE7C 1XMQE 2L3CA 1GZ6A 2G7HA 3BIDA 2E1MA 3HQ1A 1YPNA 3F6HA 2GHFA 2EOHA 2UXBE 1EKZA 4DV4E 1YZ9A 2GPIA 3K6QA 3J81C 1X5WA 3TQMA 5LMUE 1XNRE 3VYXA 3EPKA 1HNXE 1N34E 2EMYA 2FV4B 4F9CB 2ODRD 1SFEA 2UXDE 2DLKA 1GTKA 1EH6A 1RMDA 4Q28A 3KZYA 2MDGA 2EORA 4BHBA 4O43A 2K4VA 3HPSA 2UXCE 4J8ZA 4KHPE 3JU0A 2ELZA 5A6KA 5CFFE 2EOMA 4LFCE 2JXPA 2JY9A 2IHR1 4N4RB 5IXMB 2YZTA 2EPLX 2WCC3 2LE2A 2EM9A 2YTFA 4BHCA 4TUGA 2YSOA 3THOB 2LV2A 4JI8E 1IBME 4JI1E 2E72A 2K7IA 2EQ1A 1TN9A 2ADRA 4R2AA 1PKPA 2RSIA 1X6FA 2YRMA 3ECRA 4NHRA 4B3ME 4X65E 3EPLA 4JI2E 2EMKA 2JPAA 5AC5A 2LUPB 4ZYGA 4L8NA 2EOZA 1T4NA 5A6AA 2HJJA 2LJUA 2UUCE 2YU8A 4X9JA 2CSHA 2ELYA 2JVAA 2LJHA 2I9IA 2EM8A 2YRKA 2YTOA 1Z1BA 1ZAAC 5LMNE 3HXLA 2ZM6E 2MC6A 4LU9A 3AV0A 5IT9C 5AE1A 1KYQA 4TUIA 5IV8B 2YTPA 2EPRA 4WPYA 4AQYE 4NZVA 2EMXA 1JK1A 2EMFA 2EPXA 5TSEA 2EOEA 4WX9A 2H36X 4R2CA 5FLXC 2LBSB 4LTYA 2LTRA 3J80C 3ZOQB 2YT4A 3QG5C 2NA2A 3UK3C 4WXDA 1F2IG 2JP9A 2EM0A 4LF8E 2EM6A 2L8TA 4R2RA 2RS7A 4M9VC 2LT7A 5DNYA 2EJ4A 1FKAE 4FK5C 4OOGC 4WSGA 4F54A 5A2QC 1STUA 1G2FC 2EE8A 1T39A 2V87A 2DB2A 3OMLA 3J7Yp 2EMHA 4NXME 1ZR9A 4ZYEA 1KJKA 1FJGE 2L3JA 4WYQB 2EPAA 2MKNA 5AC4A 2M7QA 2B3TB 5KL6A 2YTJA 1G2DC 4HEIA 2UU9E 1PJQA 2JR1A 1XNQE 2ODRC 4DV7E 5A6BD 1A1KA 5KL3A 4P78A 1SR9A 4GEQB 2MDRA 4BC7A 2VQEE 2MKDA 2WBTA 2EMCA 2M1SA 4GKKE 1J26A 1X47A 5AE3A 4DV0E 1IQSA 1DI2A 3C6KA 4WXCA 2GLIA 4LF5E 2EOOA 5BR8E 3VYYA 1QNTA 2EMIA 2YU5A 1A1IA 4RHBB 1UILA 2UUAE 3BGHA 2M9AA 3LMLA 2EMAA 2EL6A 5KL2A 1YSAC 2DLQA 4DR4E 1LLMC 5AASA 3J7AG 2EN6A 4LF9E 4R2DA 3MSWA 1A1JA 4O4KA 3EPHA 1N32E 5AE2A 2N3GA 2L6MA 1WJPA 2Q8UA 2DMIA 4DUZE 3OTOE 1YUJA 1A1GA 1NCSA 1L4SA 4NXNE 3KWRA 2V85A 2EMWA 3IWBA 1WXRA 2RTXA 3EQ1A 1IBKE 2EOYA 2EL4A 2L2MA 2EOIA 4B3SE 5IWAE 3EPJA 1O0WA 2YSPA 2JYAA 2PRTA 3ADGA 3AUZA 4LF4E 1T4LB 2EL5A 4YHHE 1YYWA 2A25A 4DR2E 2LTSA 4DUYE 4DV2E 2F4VE 1J5EE 3C4TA 4DKKA 3L00A 2EOXA 2EZ6A 1YYKA 2ENAA 2LRSA 4DMIA 1YYOA 1ZU1A 4R2PA 4WSPA 2CTDA 2FTXB 2MC5A 3THNA 4DR3E 3JAMC 1UHZA 2LMZA 4KWYA 2EMZA 2EP3A 1WHNA 4Q35B 4LFBE 1GQEA 1X6EA 2EMLA 4I8OA 1WRJA 2WBSA 1RC7A 2FGGA 5KL4A 4JI0E 3M99B 1AAYA 2NUFA 4ZYHA 4F9BB 1B69A 4F6NA 4HTGA 5KL7A 2L2KB 4F6MA 4MLQA 2RPCA 2VQFE 4RH8A 2EN2A 4M30A 2ENHA 2EPCA 2EN8A 1DGCA
chains in the Genus database with same CATH topology
2EQ1A 2EQ0A 1TN9A 2ADRA 1X6HA 1A1LA 2EN3A 2EOSA 2RSIA 4R2AA 2J7JA 1X6FA 2LO3A 2YRMA 1TF6A 2GLIA 3MHSC 2YTIA 2EOOA 2LCEA 2DRPA 2EPZA 3EPLA 2EMKA 2JPAA 2EM7A 2EQ3A 2EMIA 2YU5A 1A1IA 5KL2A 2M9AA 2EMAA 2EL6A 2EOZA 2YTEA 2EM5A 4IS1C 2DLQA 1YSAC 1LLMC 2YTGA 2ENCA 2EN7A 2EN6A 2WBUA 4R2DA 1P47A 1A1JA 2YTQA 3EPHA 2R1FA 2YU8A 4X9JA 2CSHA 1BBOA 2ELYA 2YRHA 2HGHA 2EMGA 2EN1A 1WJPA 5KL5A 2EM8A 2BB8A 2DMIA 2EN4A 2YRKA 3VHTB 2YTDA 2YTOA 1BB8A 2EOJA 4IJDA 1TF3A 1YUJA 2EOFA 1Z1BA 1A1GA 1NCSA 1ZAAC 2NABA 2VRDA 2EMWA 2EOYA 2EL4A 2EPUA 2YTPA 2EOIA 2EPRA 3MHHC 2EOQA 2EMXA 3EPJA 1JK1A 2EMFA 2EPXA 2YSPA 2EOEA 2PRTA 4R2CA 2I13A 2GHFA 2EOHA 2DGCA 2EL5A 1X5WA 4R2EA 2A25A 4F2JC 3EPKA 3UK3C 2JP9A 1F2IG 2EM0A 2EM6A 2EMYA 4R2RA 4R2SA 1JK2A 4M9VC 2LT7A 2EJ4A 2EOXA 4FK5C 2ENAA 1ZU1A 4R2PA 2CT1A 2DLKA 4WSGA 1G2FC 1RMDA 2CTDA 2EE8A 2EM2A 1A1FA 2MDGA 2EORA 2EMHA 1YUIA 1ZR9A 2EM3A 1KJKA 2D9HA 1UN6B 2EMBA 2EPAA 2ELZA 2EMZA 2EP3A 2EPPA 1A1HA 2MKNA 1X6EA 2EOMA 2EMLA 2WBSA 4R2QA 1X3CA 5KL6A 2YTJA 5KL4A 3M99B 1G2DC 1AAYA 4GZNC 2WCC3 2YTNA 1B69A 2YTFA 2EM9A 4F6NA 1A1KA 5KL3A 1UBDC 5KL7A 2EM4A 4F6MA 1MEYC 2RPCA 2YSOA 2LVHA 2MKDA 2WBTA 2EMCA 2EN2A 2LV2A 2ENHA 2EPCA 2EN8A 2E72A 1DGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ1 A;  2EQ0 A;  1TN9 A;  2ADR A;  1X6H A;  1A1L A;  2EN3 A;  2EOS A;  2RSI A;  4R2A A;  2J7J A;  1X6F A;  2LO3 A;  2YRM A;  1TF6 A;  2GLI A;  3MHS C;  2YTI A;  2EOO A;  2LCE A;  2DRP A;  2EPZ A;  3EPL A;  2EMK A;  2JPA A;  2EM7 A;  2EQ3 A;  2EMI A;  2YU5 A;  1A1I A;  5KL2 A;  2M9A A;  2EMA A;  2EL6 A;  2EOZ A;  2YTE A;  2EM5 A;  4IS1 C;  2DLQ A;  1YSA C;  1LLM C;  2YTG A;  2ENC A;  2EN7 A;  2EN6 A;  2WBU A;  4R2D A;  1P47 A;  1A1J A;  2YTQ A;  3EPH A;  2R1F A;  2YU8 A;  4X9J A;  2CSH A;  1BBO A;  2ELY A;  2YRH A;  2HGH A;  2EMG A;  2EN1 A;  1WJP A;  5KL5 A;  2EM8 A;  2BB8 A;  2DMI A;  2EN4 A;  2YRK A;  3VHT B;  2YTD A;  2YTO A;  1BB8 A;  2EOJ A;  4IJD A;  1TF3 A;  1YUJ A;  2EOF A;  1Z1B A;  1A1G A;  1NCS A;  1ZAA C;  2NAB A;  2VRD A;  2EMW A;  2EOY A;  2EL4 A;  2EPU A;  2YTP A;  2EOI A;  2EPR A;  3MHH C;  2EOQ A;  2EMX A;  3EPJ A;  1JK1 A;  2EMF A;  2EPX A;  2YSP A;  2EOE A;  2PRT A;  4R2C A;  2I13 A;  2GHF A;  2EOH A;  2DGC A;  2EL5 A;  1X5W A;  4R2E A;  2A25 A;  4F2J C;  3EPK A;  3UK3 C;  2JP9 A;  1F2I G;  2EM0 A;  2EM6 A;  2EMY A;  4R2R A;  4R2S A;  1JK2 A;  4M9V C;  2LT7 A;  2EJ4 A;  2EOX A;  4FK5 C;  2ENA A;  1ZU1 A;  4R2P A;  2CT1 A;  2DLK A;  4WSG A;  1G2F C;  1RMD A;  2CTD A;  2EE8 A;  2EM2 A;  1A1F A;  2MDG A;  2EOR A;  2EMH A;  1YUI A;  1ZR9 A;  2EM3 A;  1KJK A;  2D9H A;  1UN6 B;  2EMB A;  2EPA A;  2ELZ A;  2EMZ A;  2EP3 A;  2EPP A;  1A1H A;  2MKN A;  1X6E A;  2EOM A;  2EML A;  2WBS A;  4R2Q A;  1X3C A;  5KL6 A;  2YTJ A;  5KL4 A;  3M99 B;  1G2D C;  1AAY A;  4GZN C;  2WCC 3;  2YTN A;  1B69 A;  2YTF A;  2EM9 A;  4F6N A;  1A1K A;  5KL3 A;  1UBD C;  5KL7 A;  2EM4 A;  4F6M A;  1MEY C;  2RPC A;  2YSO A;  2LVH A;  2MKD A;  2WBT A;  2EMC A;  2EN2 A;  2LV2 A;  2ENH A;  2EPC A;  2EN8 A;  2E72 A;  1DGC A; 
#chains in the Genus database with same CATH topology
 4LF7 E;  2DMY A;  2F8B A;  3IWD A;  3VK6 A;  5A6J A;  2NUG A;  4OX9 E;  2EPO A;  3BBG A;  1A1L A;  2R76 A;  2EN3 A;  2EOS A;  1EH8 A;  2J7J A;  4JYA E;  2YWQ A;  2YTI A;  2DRP A;  2EM7 A;  4F9A B;  2KON A;  4X8W A;  5F3W A;  2YTE A;  1HNZ E;  2V86 A;  2EM5 A;  4IS1 C;  3DJW A;  2YTG A;  4DR7 E;  3C6M A;  2ENC A;  2DIX A;  2EN7 A;  2KHX A;  2R1F A;  4BCA A;  2EPN A;  1BBO A;  2YRH A;  2HGH A;  2EMG A;  1HNW E;  2B7V A;  1XMO E;  2BB8 A;  2RQL A;  4JI6 E;  4O5G A;  2V88 A;  3VHT B;  2YTD A;  1T38 A;  1TF3 A;  2RS6 A;  1PJT A;  2EOF A;  3BF2 A;  2EWL A;  2NAB A;  4JI7 E;  2VRD A;  4X64 E;  4R03 A;  2JWO A;  4LFA E;  2RSM A;  4BMJ A;  4DR6 E;  1MGT A;  2EPU A;  3MHH C;  4M2Z A;  2EOQ A;  3H09 A;  5LLQ A;  4LF6 E;  1BBG A;  1PDA A;  1T4O A;  4BC9 A;  3KZZ A;  2HC5 A;  2I13 A;  4K0K E;  2DGC A;  4B3T E;  2LUQ A;  4R2E A;  4F2J C;  4BS9 A;  4JI4 E;  3ADJ A;  4JI3 E;  2JOB A;  2E5L E;  4R2S A;  4P7D A;  1N36 E;  1JK2 A;  2CPN A;  4M0V A;  2B9D A;  2CT1 A;  2L33 A;  3ADL A;  1IMU A;  2EM2 A;  1WHQ A;  4DR1 E;  3P1X A;  1A1F A;  4X62 E;  5T6J A;  1YUI A;  2EM3 A;  3FIG A;  2D9H A;  3LLH A;  4DV3 E;  1QU6 A;  1HR0 E;  4KZS A;  4X66 E;  4L5N C;  1UN6 B;  2EMB A;  3T1H E;  1PJS A;  1X48 A;  4R8O A;  2EPP A;  1A1H A;  2JOX A;  5ADZ A;  4R2Q A;  3T1Y E;  1X3C A;  4MLV A;  2HHH E;  1N33 E;  1N3G A;  3RMP A;  3F6G A;  3JTZ A;  4GZN C;  2KOU A;  2YTN A;  1UBD C;  2EM4 A;  1MEY C;  2V8Q B;  4O24 A;  1AH5 A;  2LVH A;  2YPN A;  1ZBQ A;  2L2N A;  2EQ0 A;  1X6H A;  4ZYD A;  1NEI A;  2LO3 A;  1TF6 A;  3MHS C;  2LCE A;  5A69 A;  2EPZ A;  2N8X A;  2V83 A;  2B7T A;  2DSY A;  4JI5 E;  1YFH A;  2BBG A;  2EQ3 A;  2L92 A;  4BBY A;  4YY3 E;  3DF6 A;  2M4I A;  4B3R E;  4DV6 E;  2WBU A;  3HTX A;  1P47 A;  2V89 A;  2YTQ A;  4JV5 E;  2VF1 A;  2EN1 A;  5KL5 A;  5LL6 R;  2EN4 A;  1DQ3 A;  3C4B A;  2WZO A;  4DV1 E;  2NUE A;  3HPZ A;  1BB8 A;  1RQ0 A;  2EOJ A;  2EPK X;  4IJD A;  3ADI A;  1ZBT A;  4WFT A;  5A6B A;  4DR5 E;  1X49 A;  3IWC A;  1IQO A;  4GKJ E;  2EPM X;  1EH7 A;  2UUB E;  4DV5 E;  1I94 E;  2N3H A;  1IBL E;  2VE7 C;  1XMQ E;  2L3C A;  1GZ6 A;  2G7H A;  3BID A;  2E1M A;  3HQ1 A;  1YPN A;  3F6H A;  2GHF A;  2EOH A;  2UXB E;  1EKZ A;  4DV4 E;  1YZ9 A;  2GPI A;  3K6Q A;  3J81 C;  1X5W A;  3TQM A;  5LMU E;  1XNR E;  3VYX A;  3EPK A;  1HNX E;  1N34 E;  2EMY A;  2FV4 B;  4F9C B;  2ODR D;  1SFE A;  2UXD E;  2DLK A;  1GTK A;  1EH6 A;  1RMD A;  4Q28 A;  3KZY A;  2MDG A;  2EOR A;  4BHB A;  4O43 A;  2K4V A;  3HPS A;  2UXC E;  4J8Z A;  4KHP E;  3JU0 A;  2ELZ A;  5A6K A;  5CFF E;  2EOM A;  4LFC E;  2JXP A;  2JY9 A;  2IHR 1;  4N4R B;  5IXM B;  2YZT A;  2EPL X;  2WCC 3;  2LE2 A;  2EM9 A;  2YTF A;  4BHC A;  4TUG A;  2YSO A;  3THO B;  2LV2 A;  4JI8 E;  1IBM E;  4JI1 E;  2E72 A;  2K7I A;  2EQ1 A;  1TN9 A;  2ADR A;  4R2A A;  1PKP A;  2RSI A;  1X6F A;  2YRM A;  3ECR A;  4NHR A;  4B3M E;  4X65 E;  3EPL A;  4JI2 E;  2EMK A;  2JPA A;  5AC5 A;  2LUP B;  4ZYG A;  4L8N A;  2EOZ A;  1T4N A;  5A6A A;  2HJJ A;  2LJU A;  2UUC E;  2YU8 A;  4X9J A;  2CSH A;  2ELY A;  2JVA A;  2LJH A;  2I9I A;  2EM8 A;  2YRK A;  2YTO A;  1Z1B A;  1ZAA C;  5LMN E;  3HXL A;  2ZM6 E;  2MC6 A;  4LU9 A;  3AV0 A;  5IT9 C;  5AE1 A;  1KYQ A;  4TUI A;  5IV8 B;  2YTP A;  2EPR A;  4WPY A;  4AQY E;  4NZV A;  2EMX A;  1JK1 A;  2EMF A;  2EPX A;  5TSE A;  2EOE A;  4WX9 A;  2H36 X;  4R2C A;  5FLX C;  2LBS B;  4LTY A;  2LTR A;  3J80 C;  3ZOQ B;  2YT4 A;  3QG5 C;  2NA2 A;  3UK3 C;  4WXD A;  1F2I G;  2JP9 A;  2EM0 A;  4LF8 E;  2EM6 A;  2L8T A;  4R2R A;  2RS7 A;  4M9V C;  2LT7 A;  5DNY A;  2EJ4 A;  1FKA E;  4FK5 C;  4OOG C;  4WSG A;  4F54 A;  5A2Q C;  1STU A;  1G2F C;  2EE8 A;  1T39 A;  2V87 A;  2DB2 A;  3OML A;  3J7Y p;  2EMH A;  4NXM E;  1ZR9 A;  4ZYE A;  1KJK A;  1FJG E;  2L3J A;  4WYQ B;  2EPA A;  2MKN A;  5AC4 A;  2M7Q A;  2B3T B;  5KL6 A;  2YTJ A;  1G2D C;  4HEI A;  2UU9 E;  1PJQ A;  2JR1 A;  1XNQ E;  2ODR C;  4DV7 E;  5A6B D;  1A1K A;  5KL3 A;  4P78 A;  1SR9 A;  4GEQ B;  2MDR A;  4BC7 A;  2VQE E;  2MKD A;  2WBT A;  2EMC A;  2M1S A;  4GKK E;  1J26 A;  1X47 A;  5AE3 A;  4DV0 E;  1IQS A;  1DI2 A;  3C6K A;  4WXC A;  2GLI A;  4LF5 E;  2EOO A;  5BR8 E;  3VYY A;  1QNT A;  2EMI A;  2YU5 A;  1A1I A;  4RHB B;  1UIL A;  2UUA E;  3BGH A;  2M9A A;  3LML A;  2EMA A;  2EL6 A;  5KL2 A;  1YSA C;  2DLQ A;  4DR4 E;  1LLM C;  5AAS A;  3J7A G;  2EN6 A;  4LF9 E;  4R2D A;  3MSW A;  1A1J A;  4O4K A;  3EPH A;  1N32 E;  5AE2 A;  2N3G A;  2L6M A;  1WJP A;  2Q8U A;  2DMI A;  4DUZ E;  3OTO E;  1YUJ A;  1A1G A;  1NCS A;  1L4S A;  4NXN E;  3KWR A;  2V85 A;  2EMW A;  3IWB A;  1WXR A;  2RTX A;  3EQ1 A;  1IBK E;  2EOY A;  2EL4 A;  2L2M A;  2EOI A;  4B3S E;  5IWA E;  3EPJ A;  1O0W A;  2YSP A;  2JYA A;  2PRT A;  3ADG A;  3AUZ A;  4LF4 E;  1T4L B;  2EL5 A;  4YHH E;  1YYW A;  2A25 A;  4DR2 E;  2LTS A;  4DUY E;  4DV2 E;  2F4V E;  1J5E E;  3C4T A;  4DKK A;  3L00 A;  2EOX A;  2EZ6 A;  1YYK A;  2ENA A;  2LRS A;  4DMI A;  1YYO A;  1ZU1 A;  4R2P A;  4WSP A;  2CTD A;  2FTX B;  2MC5 A;  3THN A;  4DR3 E;  3JAM C;  1UHZ A;  2LMZ A;  4KWY A;  2EMZ A;  2EP3 A;  1WHN A;  4Q35 B;  4LFB E;  1GQE A;  1X6E A;  2EML A;  4I8O A;  1WRJ A;  2WBS A;  1RC7 A;  2FGG A;  5KL4 A;  4JI0 E;  3M99 B;  1AAY A;  2NUF A;  4ZYH A;  4F9B B;  1B69 A;  4F6N A;  4HTG A;  5KL7 A;  2L2K B;  4F6M A;  4MLQ A;  2RPC A;  2VQF E;  4RH8 A;  2EN2 A;  4M30 A;  2ENH A;  2EPC A;  2EN8 A;  1DGC A; 
#chains in the Genus database with same CATH homology
 2EQ1 A;  2EQ0 A;  1TN9 A;  2ADR A;  1X6H A;  1A1L A;  2EN3 A;  2EOS A;  2RSI A;  4R2A A;  2J7J A;  1X6F A;  2LO3 A;  2YRM A;  1TF6 A;  2GLI A;  3MHS C;  2YTI A;  2EOO A;  2LCE A;  2DRP A;  2EPZ A;  3EPL A;  2EMK A;  2JPA A;  2EM7 A;  2EQ3 A;  2EMI A;  2YU5 A;  1A1I A;  5KL2 A;  2M9A A;  2EMA A;  2EL6 A;  2EOZ A;  2YTE A;  2EM5 A;  4IS1 C;  2DLQ A;  1YSA C;  1LLM C;  2YTG A;  2ENC A;  2EN7 A;  2EN6 A;  2WBU A;  4R2D A;  1P47 A;  1A1J A;  2YTQ A;  3EPH A;  2R1F A;  2YU8 A;  4X9J A;  2CSH A;  1BBO A;  2ELY A;  2YRH A;  2HGH A;  2EMG A;  2EN1 A;  1WJP A;  5KL5 A;  2EM8 A;  2BB8 A;  2DMI A;  2EN4 A;  2YRK A;  3VHT B;  2YTD A;  2YTO A;  1BB8 A;  2EOJ A;  4IJD A;  1TF3 A;  1YUJ A;  2EOF A;  1Z1B A;  1A1G A;  1NCS A;  1ZAA C;  2NAB A;  2VRD A;  2EMW A;  2EOY A;  2EL4 A;  2EPU A;  2YTP A;  2EOI A;  2EPR A;  3MHH C;  2EOQ A;  2EMX A;  3EPJ A;  1JK1 A;  2EMF A;  2EPX A;  2YSP A;  2EOE A;  2PRT A;  4R2C A;  2I13 A;  2GHF A;  2EOH A;  2DGC A;  2EL5 A;  1X5W A;  4R2E A;  2A25 A;  4F2J C;  3EPK A;  3UK3 C;  2JP9 A;  1F2I G;  2EM0 A;  2EM6 A;  2EMY A;  4R2R A;  4R2S A;  1JK2 A;  4M9V C;  2LT7 A;  2EJ4 A;  2EOX A;  4FK5 C;  2ENA A;  1ZU1 A;  4R2P A;  2CT1 A;  2DLK A;  4WSG A;  1G2F C;  1RMD A;  2CTD A;  2EE8 A;  2EM2 A;  1A1F A;  2MDG A;  2EOR A;  2EMH A;  1YUI A;  1ZR9 A;  2EM3 A;  1KJK A;  2D9H A;  1UN6 B;  2EMB A;  2EPA A;  2ELZ A;  2EMZ A;  2EP3 A;  2EPP A;  1A1H A;  2MKN A;  1X6E A;  2EOM A;  2EML A;  2WBS A;  4R2Q A;  1X3C A;  5KL6 A;  2YTJ A;  5KL4 A;  3M99 B;  1G2D C;  1AAY A;  4GZN C;  2WCC 3;  2YTN A;  1B69 A;  2YTF A;  2EM9 A;  4F6N A;  1A1K A;  5KL3 A;  1UBD C;  5KL7 A;  2EM4 A;  4F6M A;  1MEY C;  2RPC A;  2YSO A;  2LVH A;  2MKD A;  2WBT A;  2EMC A;  2EN2 A;  2LV2 A;  2ENH A;  2EPC A;  2EN8 A;  2E72 A;  1DGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...