4R2PA

Wilms tumor protein (wt1) zinc fingers in complex with hydroxymethylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2pA00
2EOEA 2EMGA 2EPZA 2EL6A 2LO3A 2YTIA 3EPHA 2YTDA 2ENHA 1BBOA 2EOFA 2RPCA 1YSAC 2EOIA 1A1IA 1TF3A 2EMXA 5KL4A 2JPAA 2YTOA 2EMWA 2DMIA 2YTNA 1ZAAC 5KL5A 2EOQA 2MDGA 1P47A 2EOHA 2ELYA 2RSIA 1YUJA 2EN7A 4F2JC 2EPXA 2EM8A 3EPJA 1Z1BA 1A1FA 1KJKA 2EM3A 2EMCA 4IS1C 3EPKA 1F2IG 2YRKA 1ZR9A 5KL3A 4R2SA 1UBDC 2EOXA 2EOJA 4R2QA 4M9VC 5KL6A 4R2DA 2EN6A 4IJDA 2YU5A 2EOYA 2YTEA 1TN9A 2EOOA 2CT1A 2EM2A 2EOZA 1TF6A 2YSOA 2DLKA 2EMFA 4R2PA 2E72A 1AAYA 2EMLA 2JP9A 1WJPA 2NABA 2M9AA 2EORA 2PRTA 2EPPA 2EPRA 2EOMA 2A25A 2EQ3A 4WSGA 2I13A 2MKNA 1NCSA 5KL7A 1LLMC 1DGCA 1X6FA 2EN4A 1A1KA 2D9HA 2CTDA 1X5WA 2R1FA 1X3CA 1MEYC 3EPLA 2GLIA 3VHTB 2YSPA 4FK5C 2LV2A 2LVHA 2LCEA 1BB8A 2LT7A 2WBTA 2EM4A 2ENAA 2EPUA 2CSHA 1YUIA 2EN2A 2EPCA 1JK2A 2ELZA 2EL5A 1ZU1A 3MHHC 2EMAA 2WBSA 4F6NA 4F6MA 1X6HA 2ADRA 4R2CA 2EMKA 2EPAA 4R2AA 2EJ4A 2DLQA 2EM9A 2EOSA 2J7JA 2EMIA 2YRMA 2DGCA 1UN6B 2EN1A 3UK3C 2EMZA 2YTGA 4GZNC 1JK1A 1A1JA 2EMHA 2BB8A 1X6EA 2HGHA 2WBUA 2EM7A 2MKDA 4R2EA 2DRPA 2YTJA 1A1GA 2YU8A 1A1LA 2EM6A 2EN3A 2EM5A 4X9JA 2EQ0A 2EE8A 2VRDA 2EMBA 3MHSC 1RMDA 1G2DC 3M99B 2WCC3 2EQ1A 2YTPA 1A1HA 2EL4A 2EP3A 2EMYA 2EN8A 4R2RA 1G2FC 1B69A 2YTQA 2YTFA 2YRHA 5KL2A 2EM0A 2GHFA 2ENCA
chains in the Genus database with same CATH superfamily
5A6JA 3IWBA 2EPZA 2EL6A 4WXCA 2LO3A 3ADIA 2LJHA 2N3HA 2YTDA 4LTYA 2DB2A 2YPNA 5IV8B 1A1IA 1EKZA 5KL4A 3ADGA 2WZOA 1ZAAC 4JI3E 1PJTA 4O43A 2V88A 5A6AA 2RSIA 1RC7A 2EM8A 3EPJA 1SFEA 3KZZA 2EMCA 2UUAE 5F3WA 2UU9E 3QG5C 2FGGA 1X47A 3IWDA 5AE2A 2YU5A 4DR4E 2EOYA 2YTEA 2YWQA 2YSOA 4JI0E 2EMFA 4O4KA 4AQYE 4X66E 2EORA 2A25A 1WHQA 3DF6A 4F9AB 1NCSA 1WRJA 3AUZA 1DGCA 2EN4A 4ZYGA 4LF8E 3T1YE 4P7DA 1HNWE 2LTRA 2CTDA 4NHRA 1T38A 1XMQE 4M2ZA 1X3CA 2EPOA 4WX9A 3VYXA 4DV3E 2YSPA 2LVHA 1HNXE 4R8OA 2LCEA 2LT7A 2WBTA 2EM4A 4M0VA 2CSHA 4BC7A 2EN2A 2V86A 1N36E 2JY9A 3ECRA 1PJSA 3THOB 3H09A 4F6NA 2EPMX 3OMLA 1YZ9A 1QNTA 4RHBB 2FTXB 2E5LE 4LF5E 2YRMA 4BCAA 2DGCA 4F54A 3VYYA 3UK3C 1ZBQA 2LBSB 1N34E 2HGHA 2YU8A 5FLXC 2IHR1 2JVAA 4DR2E 2EM5A 4LFAE 3F6HA 1FKAE 2WCC3 4GEQB 2UUBE 2HC5A 3L00A 2ZM6E 5AASA 1B69A 4GKJE 2NA2A 4I8OA 1UHZA 1JK2A 4O5GA 3J7AG 1GZ6A 1T39A 1PJQA 1YSAC 2EOIA 2UXBE 2LE2A 2VE7C 1BBGA 2E1MA 1EH7A 2EOQA 1IMUA 4LF7E 5BR8E 2EOHA 2MC5A 2L33A 1YUJA 1L4SA 3JU0A 4P78A 1Z1BA 1KJKA 4WSPA 4B3SE 2JOBA 3EPKA 3TQMA 4DUYE 1DQ3A 4R2SA 1UBDC 4OX9E 3HPZA 5AE1A 2L6MA 4R2DA 1YFHA 4Q35B 2JR1A 2MDRA 4YY3E 1O0WA 1TN9A 2LJUA 2EOOA 2EOZA 2DLKA 3FIGA 4R2PA 2L2MA 3HTXA 3J7Yp 2V83A 2JP9A 1WJPA 2NABA 2M9AA 2L8TA 5CFFE 2EPPA 2MKNA 2EQ3A 2V8QB 4WSGA 2V87A 5KL7A 1DI2A 2HHHE 5LMUE 2RTXA 2ODRD 1X5WA 4HTGA 3OTOE 4ZYHA 3RMPA 4WYQB 4JI6E 3JTZA 2DSYA 3VHTB 4J8ZA 2K7IA 1PDAA 4TUGA 2ELZA 5LMNE 3MHHC 2L3JA 2B7VA 4DMIA 4O24A 2ADRA 2EMKA 4LU9A 2EPAA 5TSEA 2EJ4A 2DLQA 2EM9A 2EOSA 2J7JA 2EMIA 2LRSA 4LF4E 4R03A 2EMZA 1X6EA 4BS9A 2B7TA 2JXPA 2FV4B 2R76A 2DIXA 3IWCA 2VQFE 2YTJA 1A1LA 2V85A 2JOXA 1YYWA 2EN3A 1X49A 1FJGE 1GTKA 2M7QA 1IBKE 3HPSA 2EMBA 4DV6E 1G2DC 3F6GA 2YTPA 5ADZA 1I94E 2EL4A 2YTQA 5A6BA 3HXLA 4DR3E 2YT4A 4JI1E 2YRHA 2F8BA 4N4RB 5LL6R 2EPLX 2ENCA 5A2QC 2EOEA 2VF1A 1GQEA 3EPHA 4NXME 2ENHA 1BBOA 4DV0E 3C4TA 3VK6A 2EMXA 4DUZE 1EH8A 2JPAA 2JYAA 3BIDA 2RS7A 1YYOA 2YTNA 2I9IA 4KWYA 1ZBTA 1P47A 2ELYA 4F2JC 3KZYA 4IS1C 1F2IG 2YRKA 1ZR9A 4LFBE 2EOXA 2N3GA 2EOJA 4R2QA 5KL6A 2RS6A 4DR7E 1KYQA 2EN6A 2G7HA 4IJDA 4ZYDA 4HEIA 1NEIA 2GPIA 1J5EE 4DV5E 2CT1A 2L92A 2H36X 1TF6A 2E72A 4JI7E 1AAYA 2EMLA 2Q8UA 5IWAE 2EOMA 4BMJA 4NZVA 1IQOA 4MLQA 5AC5A 4M30A 1LLMC 4KZSA 4BBYA 1XMOE 2D9HA 2L3CA 3LLHA 4DV7E 1MEYC 4LFCE 4OOGC 2LTSA 3EPLA 4NXNE 4FK5C 1SR9A 2N8XA 1T4OA 2LUPB 2ENAA 2MC6A 1AH5A 2EPCA 2EL5A 2EMAA 4LF9E 4K0KE 4L8NA 2RQLA 2V89A 4JI5E 1UILA 2NUGA 4KHPE 5DNYA 4WPYA 1IBME 2L2KB 2KHXA 1YPNA 1STUA 4Q28A 1UN6B 2EN1A 2EWLA 1MGTA 3DJWA 1A1JA 2EMHA 4JYAE 2BB8A 2WBUA 4R2EA 2MKDA 4JI2E 1RQ0A 1A1GA 4X8WA 2UUCE 2EM6A 2M4IA 4B3ME 4X9JA 2EQ0A 2EE8A 3ADJA 1EH6A 3MHSC 5IT9C 3M99B 2EQ1A 4X62E 5AE3A 3T1HE 2EP3A 5AC4A 4YHHE 2EMYA 4WXDA 1G2FC 4JI4E 2YTFA 2K4VA 4L5NC 5KL2A 4DR5E 2EM0A 2GHFA 2VQEE 2EMGA 4JV5E 2YTIA 1QU6A 2UXDE 1X48A 2EOFA 2RPCA 3JAMC 1WXRA 3ZOQB 2YTOA 2EMWA 2DMIA 5T6JA 5KL5A 4F9CB 2JWOA 2MDGA 4B3TE 4TUIA 4B3RE 1T4NA 2BBGA 2EN7A 2CPNA 2EPXA 1A1FA 2ODRC 1N3GA 5LLQA 2EM3A 2LUQA 1N32E 5KL3A 2EPNA 4M9VC 1XNRE 4DR6E 3C6KA 2EM2A 2B3TB 2NUFA 2F4VE 1J26A 1HNZE 2PRTA 2EPRA 5IXMB 4GKKE 2I13A 5A69A 3C6MA 4WFTA 2UXCE 1X6FA 1A1KA 2DMYA 3P1XA 2HJJA 1XNQE 2R1FA 4X64E 2GLIA 1IQSA 4BHBA 2LV2A 1WHNA 1BB8A 3KWRA 2KONA 2EPUA 4ZYEA 4LF6E 4F9BB 2KOUA 1YUIA 4X65E 3C4BA 3AV0A 1ZU1A 1HR0E 4MLVA 2WBSA 3J81C 4F6MA 1X6HA 4DKKA 3BGHA 3K6QA 4R2CA 3MSWA 3J80C 3LMLA 4RH8A 4R2AA 4DR1E 4JI8E 2YTGA 4GZNC 1JK1A 4DV4E 2EM7A 1YYKA 2DRPA 2RSMA 2YZTA 5A6KA 2LMZA 4DV1E 2NUEA 4BHCA 1T4LB 1IBLE 3BBGA 3EQ1A 2VRDA 1RMDA 4DV2E 2EZ6A 2M1SA 3HQ1A 2B9DA 2EPKX 3BF2A 1A1HA 4R2RA 2EN8A 2L2NA 1PKPA 3ADLA 3THNA 4BC9A 1TF3A 5A6BD 1N33E
chains in the Genus database with same CATH topology
2EOEA 2EMGA 2EPZA 2EL6A 2LO3A 2YTIA 3EPHA 2YTDA 2ENHA 1BBOA 2EOFA 2RPCA 1YSAC 2EOIA 1A1IA 1TF3A 2EMXA 5KL4A 2JPAA 2YTOA 2EMWA 2DMIA 2YTNA 1ZAAC 5KL5A 2EOQA 2MDGA 1P47A 2EOHA 2ELYA 2RSIA 1YUJA 2EN7A 4F2JC 2EPXA 2EM8A 3EPJA 1Z1BA 1A1FA 1KJKA 2EM3A 2EMCA 4IS1C 3EPKA 1F2IG 2YRKA 1ZR9A 5KL3A 4R2SA 1UBDC 2EOXA 2EOJA 4R2QA 4M9VC 5KL6A 4R2DA 2EN6A 4IJDA 2YU5A 2EOYA 2YTEA 1TN9A 2EOOA 2CT1A 2EM2A 2EOZA 1TF6A 2YSOA 2DLKA 2EMFA 4R2PA 2E72A 1AAYA 2EMLA 2JP9A 1WJPA 2NABA 2M9AA 2EORA 2PRTA 2EPPA 2EPRA 2EOMA 2A25A 2EQ3A 4WSGA 2I13A 2MKNA 1NCSA 5KL7A 1LLMC 1DGCA 1X6FA 2EN4A 1A1KA 2D9HA 2CTDA 1X5WA 2R1FA 1X3CA 1MEYC 3EPLA 2GLIA 3VHTB 2YSPA 4FK5C 2LV2A 2LVHA 2LCEA 1BB8A 2LT7A 2WBTA 2EM4A 2ENAA 2EPUA 2CSHA 1YUIA 2EN2A 2EPCA 1JK2A 2ELZA 2EL5A 1ZU1A 3MHHC 2EMAA 2WBSA 4F6NA 4F6MA 1X6HA 2ADRA 4R2CA 2EMKA 2EPAA 4R2AA 2EJ4A 2DLQA 2EM9A 2EOSA 2J7JA 2EMIA 2YRMA 2DGCA 1UN6B 2EN1A 3UK3C 2EMZA 2YTGA 4GZNC 1JK1A 1A1JA 2EMHA 2BB8A 1X6EA 2HGHA 2WBUA 2EM7A 2MKDA 4R2EA 2DRPA 2YTJA 1A1GA 2YU8A 1A1LA 2EM6A 2EN3A 2EM5A 4X9JA 2EQ0A 2EE8A 2VRDA 2EMBA 3MHSC 1RMDA 1G2DC 3M99B 2WCC3 2EQ1A 2YTPA 1A1HA 2EL4A 2EP3A 2EMYA 2EN8A 4R2RA 1G2FC 1B69A 2YTQA 2YTFA 2YRHA 5KL2A 2EM0A 2GHFA 2ENCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOE A;  2EMG A;  2EPZ A;  2EL6 A;  2LO3 A;  2YTI A;  3EPH A;  2YTD A;  2ENH A;  1BBO A;  2EOF A;  2RPC A;  1YSA C;  2EOI A;  1A1I A;  1TF3 A;  2EMX A;  5KL4 A;  2JPA A;  2YTO A;  2EMW A;  2DMI A;  2YTN A;  1ZAA C;  5KL5 A;  2EOQ A;  2MDG A;  1P47 A;  2EOH A;  2ELY A;  2RSI A;  1YUJ A;  2EN7 A;  4F2J C;  2EPX A;  2EM8 A;  3EPJ A;  1Z1B A;  1A1F A;  1KJK A;  2EM3 A;  2EMC A;  4IS1 C;  3EPK A;  1F2I G;  2YRK A;  1ZR9 A;  5KL3 A;  4R2S A;  1UBD C;  2EOX A;  2EOJ A;  4R2Q A;  4M9V C;  5KL6 A;  4R2D A;  2EN6 A;  4IJD A;  2YU5 A;  2EOY A;  2YTE A;  1TN9 A;  2EOO A;  2CT1 A;  2EM2 A;  2EOZ A;  1TF6 A;  2YSO A;  2DLK A;  2EMF A;  4R2P A;  2E72 A;  1AAY A;  2EML A;  2JP9 A;  1WJP A;  2NAB A;  2M9A A;  2EOR A;  2PRT A;  2EPP A;  2EPR A;  2EOM A;  2A25 A;  2EQ3 A;  4WSG A;  2I13 A;  2MKN A;  1NCS A;  5KL7 A;  1LLM C;  1DGC A;  1X6F A;  2EN4 A;  1A1K A;  2D9H A;  2CTD A;  1X5W A;  2R1F A;  1X3C A;  1MEY C;  3EPL A;  2GLI A;  3VHT B;  2YSP A;  4FK5 C;  2LV2 A;  2LVH A;  2LCE A;  1BB8 A;  2LT7 A;  2WBT A;  2EM4 A;  2ENA A;  2EPU A;  2CSH A;  1YUI A;  2EN2 A;  2EPC A;  1JK2 A;  2ELZ A;  2EL5 A;  1ZU1 A;  3MHH C;  2EMA A;  2WBS A;  4F6N A;  4F6M A;  1X6H A;  2ADR A;  4R2C A;  2EMK A;  2EPA A;  4R2A A;  2EJ4 A;  2DLQ A;  2EM9 A;  2EOS A;  2J7J A;  2EMI A;  2YRM A;  2DGC A;  1UN6 B;  2EN1 A;  3UK3 C;  2EMZ A;  2YTG A;  4GZN C;  1JK1 A;  1A1J A;  2EMH A;  2BB8 A;  1X6E A;  2HGH A;  2WBU A;  2EM7 A;  2MKD A;  4R2E A;  2DRP A;  2YTJ A;  1A1G A;  2YU8 A;  1A1L A;  2EM6 A;  2EN3 A;  2EM5 A;  4X9J A;  2EQ0 A;  2EE8 A;  2VRD A;  2EMB A;  3MHS C;  1RMD A;  1G2D C;  3M99 B;  2WCC 3;  2EQ1 A;  2YTP A;  1A1H A;  2EL4 A;  2EP3 A;  2EMY A;  2EN8 A;  4R2R A;  1G2F C;  1B69 A;  2YTQ A;  2YTF A;  2YRH A;  5KL2 A;  2EM0 A;  2GHF A;  2ENC A; 
#chains in the Genus database with same CATH topology
 5A6J A;  3IWB A;  2EPZ A;  2EL6 A;  4WXC A;  2LO3 A;  3ADI A;  2LJH A;  2N3H A;  2YTD A;  4LTY A;  2DB2 A;  2YPN A;  5IV8 B;  1A1I A;  1EKZ A;  5KL4 A;  3ADG A;  2WZO A;  1ZAA C;  4JI3 E;  1PJT A;  4O43 A;  2V88 A;  5A6A A;  2RSI A;  1RC7 A;  2EM8 A;  3EPJ A;  1SFE A;  3KZZ A;  2EMC A;  2UUA E;  5F3W A;  2UU9 E;  3QG5 C;  2FGG A;  1X47 A;  3IWD A;  5AE2 A;  2YU5 A;  4DR4 E;  2EOY A;  2YTE A;  2YWQ A;  2YSO A;  4JI0 E;  2EMF A;  4O4K A;  4AQY E;  4X66 E;  2EOR A;  2A25 A;  1WHQ A;  3DF6 A;  4F9A B;  1NCS A;  1WRJ A;  3AUZ A;  1DGC A;  2EN4 A;  4ZYG A;  4LF8 E;  3T1Y E;  4P7D A;  1HNW E;  2LTR A;  2CTD A;  4NHR A;  1T38 A;  1XMQ E;  4M2Z A;  1X3C A;  2EPO A;  4WX9 A;  3VYX A;  4DV3 E;  2YSP A;  2LVH A;  1HNX E;  4R8O A;  2LCE A;  2LT7 A;  2WBT A;  2EM4 A;  4M0V A;  2CSH A;  4BC7 A;  2EN2 A;  2V86 A;  1N36 E;  2JY9 A;  3ECR A;  1PJS A;  3THO B;  3H09 A;  4F6N A;  2EPM X;  3OML A;  1YZ9 A;  1QNT A;  4RHB B;  2FTX B;  2E5L E;  4LF5 E;  2YRM A;  4BCA A;  2DGC A;  4F54 A;  3VYY A;  3UK3 C;  1ZBQ A;  2LBS B;  1N34 E;  2HGH A;  2YU8 A;  5FLX C;  2IHR 1;  2JVA A;  4DR2 E;  2EM5 A;  4LFA E;  3F6H A;  1FKA E;  2WCC 3;  4GEQ B;  2UUB E;  2HC5 A;  3L00 A;  2ZM6 E;  5AAS A;  1B69 A;  4GKJ E;  2NA2 A;  4I8O A;  1UHZ A;  1JK2 A;  4O5G A;  3J7A G;  1GZ6 A;  1T39 A;  1PJQ A;  1YSA C;  2EOI A;  2UXB E;  2LE2 A;  2VE7 C;  1BBG A;  2E1M A;  1EH7 A;  2EOQ A;  1IMU A;  4LF7 E;  5BR8 E;  2EOH A;  2MC5 A;  2L33 A;  1YUJ A;  1L4S A;  3JU0 A;  4P78 A;  1Z1B A;  1KJK A;  4WSP A;  4B3S E;  2JOB A;  3EPK A;  3TQM A;  4DUY E;  1DQ3 A;  4R2S A;  1UBD C;  4OX9 E;  3HPZ A;  5AE1 A;  2L6M A;  4R2D A;  1YFH A;  4Q35 B;  2JR1 A;  2MDR A;  4YY3 E;  1O0W A;  1TN9 A;  2LJU A;  2EOO A;  2EOZ A;  2DLK A;  3FIG A;  4R2P A;  2L2M A;  3HTX A;  3J7Y p;  2V83 A;  2JP9 A;  1WJP A;  2NAB A;  2M9A A;  2L8T A;  5CFF E;  2EPP A;  2MKN A;  2EQ3 A;  2V8Q B;  4WSG A;  2V87 A;  5KL7 A;  1DI2 A;  2HHH E;  5LMU E;  2RTX A;  2ODR D;  1X5W A;  4HTG A;  3OTO E;  4ZYH A;  3RMP A;  4WYQ B;  4JI6 E;  3JTZ A;  2DSY A;  3VHT B;  4J8Z A;  2K7I A;  1PDA A;  4TUG A;  2ELZ A;  5LMN E;  3MHH C;  2L3J A;  2B7V A;  4DMI A;  4O24 A;  2ADR A;  2EMK A;  4LU9 A;  2EPA A;  5TSE A;  2EJ4 A;  2DLQ A;  2EM9 A;  2EOS A;  2J7J A;  2EMI A;  2LRS A;  4LF4 E;  4R03 A;  2EMZ A;  1X6E A;  4BS9 A;  2B7T A;  2JXP A;  2FV4 B;  2R76 A;  2DIX A;  3IWC A;  2VQF E;  2YTJ A;  1A1L A;  2V85 A;  2JOX A;  1YYW A;  2EN3 A;  1X49 A;  1FJG E;  1GTK A;  2M7Q A;  1IBK E;  3HPS A;  2EMB A;  4DV6 E;  1G2D C;  3F6G A;  2YTP A;  5ADZ A;  1I94 E;  2EL4 A;  2YTQ A;  5A6B A;  3HXL A;  4DR3 E;  2YT4 A;  4JI1 E;  2YRH A;  2F8B A;  4N4R B;  5LL6 R;  2EPL X;  2ENC A;  5A2Q C;  2EOE A;  2VF1 A;  1GQE A;  3EPH A;  4NXM E;  2ENH A;  1BBO A;  4DV0 E;  3C4T A;  3VK6 A;  2EMX A;  4DUZ E;  1EH8 A;  2JPA A;  2JYA A;  3BID A;  2RS7 A;  1YYO A;  2YTN A;  2I9I A;  4KWY A;  1ZBT A;  1P47 A;  2ELY A;  4F2J C;  3KZY A;  4IS1 C;  1F2I G;  2YRK A;  1ZR9 A;  4LFB E;  2EOX A;  2N3G A;  2EOJ A;  4R2Q A;  5KL6 A;  2RS6 A;  4DR7 E;  1KYQ A;  2EN6 A;  2G7H A;  4IJD A;  4ZYD A;  4HEI A;  1NEI A;  2GPI A;  1J5E E;  4DV5 E;  2CT1 A;  2L92 A;  2H36 X;  1TF6 A;  2E72 A;  4JI7 E;  1AAY A;  2EML A;  2Q8U A;  5IWA E;  2EOM A;  4BMJ A;  4NZV A;  1IQO A;  4MLQ A;  5AC5 A;  4M30 A;  1LLM C;  4KZS A;  4BBY A;  1XMO E;  2D9H A;  2L3C A;  3LLH A;  4DV7 E;  1MEY C;  4LFC E;  4OOG C;  2LTS A;  3EPL A;  4NXN E;  4FK5 C;  1SR9 A;  2N8X A;  1T4O A;  2LUP B;  2ENA A;  2MC6 A;  1AH5 A;  2EPC A;  2EL5 A;  2EMA A;  4LF9 E;  4K0K E;  4L8N A;  2RQL A;  2V89 A;  4JI5 E;  1UIL A;  2NUG A;  4KHP E;  5DNY A;  4WPY A;  1IBM E;  2L2K B;  2KHX A;  1YPN A;  1STU A;  4Q28 A;  1UN6 B;  2EN1 A;  2EWL A;  1MGT A;  3DJW A;  1A1J A;  2EMH A;  4JYA E;  2BB8 A;  2WBU A;  4R2E A;  2MKD A;  4JI2 E;  1RQ0 A;  1A1G A;  4X8W A;  2UUC E;  2EM6 A;  2M4I A;  4B3M E;  4X9J A;  2EQ0 A;  2EE8 A;  3ADJ A;  1EH6 A;  3MHS C;  5IT9 C;  3M99 B;  2EQ1 A;  4X62 E;  5AE3 A;  3T1H E;  2EP3 A;  5AC4 A;  4YHH E;  2EMY A;  4WXD A;  1G2F C;  4JI4 E;  2YTF A;  2K4V A;  4L5N C;  5KL2 A;  4DR5 E;  2EM0 A;  2GHF A;  2VQE E;  2EMG A;  4JV5 E;  2YTI A;  1QU6 A;  2UXD E;  1X48 A;  2EOF A;  2RPC A;  3JAM C;  1WXR A;  3ZOQ B;  2YTO A;  2EMW A;  2DMI A;  5T6J A;  5KL5 A;  4F9C B;  2JWO A;  2MDG A;  4B3T E;  4TUI A;  4B3R E;  1T4N A;  2BBG A;  2EN7 A;  2CPN A;  2EPX A;  1A1F A;  2ODR C;  1N3G A;  5LLQ A;  2EM3 A;  2LUQ A;  1N32 E;  5KL3 A;  2EPN A;  4M9V C;  1XNR E;  4DR6 E;  3C6K A;  2EM2 A;  2B3T B;  2NUF A;  2F4V E;  1J26 A;  1HNZ E;  2PRT A;  2EPR A;  5IXM B;  4GKK E;  2I13 A;  5A69 A;  3C6M A;  4WFT A;  2UXC E;  1X6F A;  1A1K A;  2DMY A;  3P1X A;  2HJJ A;  1XNQ E;  2R1F A;  4X64 E;  2GLI A;  1IQS A;  4BHB A;  2LV2 A;  1WHN A;  1BB8 A;  3KWR A;  2KON A;  2EPU A;  4ZYE A;  4LF6 E;  4F9B B;  2KOU A;  1YUI A;  4X65 E;  3C4B A;  3AV0 A;  1ZU1 A;  1HR0 E;  4MLV A;  2WBS A;  3J81 C;  4F6M A;  1X6H A;  4DKK A;  3BGH A;  3K6Q A;  4R2C A;  3MSW A;  3J80 C;  3LML A;  4RH8 A;  4R2A A;  4DR1 E;  4JI8 E;  2YTG A;  4GZN C;  1JK1 A;  4DV4 E;  2EM7 A;  1YYK A;  2DRP A;  2RSM A;  2YZT A;  5A6K A;  2LMZ A;  4DV1 E;  2NUE A;  4BHC A;  1T4L B;  1IBL E;  3BBG A;  3EQ1 A;  2VRD A;  1RMD A;  4DV2 E;  2EZ6 A;  2M1S A;  3HQ1 A;  2B9D A;  2EPK X;  3BF2 A;  1A1H A;  4R2R A;  2EN8 A;  2L2N A;  1PKP A;  3ADL A;  3THN A;  4BC9 A;  1TF3 A;  5A6B D;  1N33 E; 
#chains in the Genus database with same CATH homology
 2EOE A;  2EMG A;  2EPZ A;  2EL6 A;  2LO3 A;  2YTI A;  3EPH A;  2YTD A;  2ENH A;  1BBO A;  2EOF A;  2RPC A;  1YSA C;  2EOI A;  1A1I A;  1TF3 A;  2EMX A;  5KL4 A;  2JPA A;  2YTO A;  2EMW A;  2DMI A;  2YTN A;  1ZAA C;  5KL5 A;  2EOQ A;  2MDG A;  1P47 A;  2EOH A;  2ELY A;  2RSI A;  1YUJ A;  2EN7 A;  4F2J C;  2EPX A;  2EM8 A;  3EPJ A;  1Z1B A;  1A1F A;  1KJK A;  2EM3 A;  2EMC A;  4IS1 C;  3EPK A;  1F2I G;  2YRK A;  1ZR9 A;  5KL3 A;  4R2S A;  1UBD C;  2EOX A;  2EOJ A;  4R2Q A;  4M9V C;  5KL6 A;  4R2D A;  2EN6 A;  4IJD A;  2YU5 A;  2EOY A;  2YTE A;  1TN9 A;  2EOO A;  2CT1 A;  2EM2 A;  2EOZ A;  1TF6 A;  2YSO A;  2DLK A;  2EMF A;  4R2P A;  2E72 A;  1AAY A;  2EML A;  2JP9 A;  1WJP A;  2NAB A;  2M9A A;  2EOR A;  2PRT A;  2EPP A;  2EPR A;  2EOM A;  2A25 A;  2EQ3 A;  4WSG A;  2I13 A;  2MKN A;  1NCS A;  5KL7 A;  1LLM C;  1DGC A;  1X6F A;  2EN4 A;  1A1K A;  2D9H A;  2CTD A;  1X5W A;  2R1F A;  1X3C A;  1MEY C;  3EPL A;  2GLI A;  3VHT B;  2YSP A;  4FK5 C;  2LV2 A;  2LVH A;  2LCE A;  1BB8 A;  2LT7 A;  2WBT A;  2EM4 A;  2ENA A;  2EPU A;  2CSH A;  1YUI A;  2EN2 A;  2EPC A;  1JK2 A;  2ELZ A;  2EL5 A;  1ZU1 A;  3MHH C;  2EMA A;  2WBS A;  4F6N A;  4F6M A;  1X6H A;  2ADR A;  4R2C A;  2EMK A;  2EPA A;  4R2A A;  2EJ4 A;  2DLQ A;  2EM9 A;  2EOS A;  2J7J A;  2EMI A;  2YRM A;  2DGC A;  1UN6 B;  2EN1 A;  3UK3 C;  2EMZ A;  2YTG A;  4GZN C;  1JK1 A;  1A1J A;  2EMH A;  2BB8 A;  1X6E A;  2HGH A;  2WBU A;  2EM7 A;  2MKD A;  4R2E A;  2DRP A;  2YTJ A;  1A1G A;  2YU8 A;  1A1L A;  2EM6 A;  2EN3 A;  2EM5 A;  4X9J A;  2EQ0 A;  2EE8 A;  2VRD A;  2EMB A;  3MHS C;  1RMD A;  1G2D C;  3M99 B;  2WCC 3;  2EQ1 A;  2YTP A;  1A1H A;  2EL4 A;  2EP3 A;  2EMY A;  2EN8 A;  4R2R A;  1G2F C;  1B69 A;  2YTQ A;  2YTF A;  2YRH A;  5KL2 A;  2EM0 A;  2GHF A;  2ENC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...