4R2PA

Wilms tumor protein (wt1) zinc fingers in complex with hydroxymethylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
b'SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2pA00
2EMWA 2EPUA 4R2RA 3EPKA 2YTDA 3MHSC 2LO3A 1X3CA 2EM7A 2EOFA 2LVHA 4WSGA 2NABA 2ELYA 2YTGA 1LLMC 2EMAA 2A25A 2PRTA 1YUJA 2EMYA 1A1KA 1WJPA 3EPLA 2E72A 2EOHA 1X6HA 2CTDA 2EL6A 2EN3A 2R1FA 2VRDA 5KL3A 1A1GA 1P47A 1JK2A 2MKDA 2DLQA 2EMHA 2JPAA 1TN9A 2EMLA 2ENCA 2EM9A 2WBSA 3EPJA 2LT7A 2MKNA 1BBOA 2MDGA 1A1LA 2CT1A 2YTFA 2EN1A 2DRPA 2EORA 4R2SA 1RMDA 5KL5A 2ELZA 2EOYA 2HGHA 1MEYC 2EM0A 1UBDC 2EN2A 2EQ0A 1YSAC 1G2FC 2GLIA 4F2JC 2EMZA 2EMXA 2ENHA 2JP9A 2J7JA 1Z1BA 1DGCA 2EPCA 2DLKA 2YRHA 2DGCA 2YTOA 2EMGA 2EOZA 2LCEA 2EN8A 3MHHC 3UK3C 1ZAAC 2EN4A 2EPRA 5KL7A 4F6NA 2YTQA 2YTEA 2EP3A 2YTIA 2EN6A 2EPZA 2EMBA 1B69A 4R2PA 2EM8A 4M9VC 2YSPA 1TF3A 2EPPA 2ENAA 2YTPA 2YU8A 2EMCA 1JK1A 1A1JA 2M9AA 4X9JA 1TF6A 5KL2A 2EE8A 1X6EA 2EM3A 1X6FA 2EOQA 4IS1C 2LV2A 1ZR9A 2EJ4A 5KL4A 4R2CA 2EQ3A 2RPCA 4IJDA 4R2DA 2BB8A 2EQ1A 2EOEA 2EN7A 2EMKA 2WBTA 2YRKA 2EOMA 1YUIA 2D9HA 2EMIA 1A1IA 1X5WA 2YU5A 4R2AA 2DMIA 1KJKA 2EL5A 2YTJA 5KL6A 2WCC3 1ZU1A 2EOIA 2YRMA 2EM2A 3EPHA 2EPAA 2EPXA 2EOSA 2GHFA 2EL4A 3VHTB 1A1FA 2EM6A 2RSIA 2YSOA 2I13A 2YTNA 2EOOA 4FK5C 3M99B 1F2IG 2WBUA 2ADRA 2EMFA 4F6MA 4GZNC 1AAYA 2EOJA 1UN6B 4R2QA 1G2DC 2CSHA 1A1HA 1NCSA 1BB8A 2EM4A 4R2EA 2EM5A 2EOXA
chains in the Genus database with same CATH superfamily
2UXCE 3MHSC 2LO3A 5LLQA 3IWDA 2ELYA 2A25A 2FGGA 2V89A 4NHRA 2EMYA 3THNA 4JI4E 1X6HA 2EL6A 2R1FA 1IQSA 2L33A 1A1GA 2V8QB 3OMLA 2GPIA 4GEQB 2EMLA 2ENCA 2WBSA 4AQYE 1A1LA 5LL6R 5IT9C 4DR1E 2EN1A 1N32E 1KYQA 1O0WA 1RMDA 4GKJE 1WXRA 3ADJA 2HGHA 1XNRE 2EQ0A 2HC5A 2GLIA 1G2FC 4NXME 4I8OA 4ZYHA 2EMXA 4B3TE 4LF7E 4WSPA 2ENHA 2V83A 1XMQE 4DV5E 4TUGA 2L2MA 4KZSA 5ADZA 2E1MA 2MC6A 1T4NA 5A2QC 1PDAA 4DR3E 3VK6A 2EZ6A 2YTIA 2EN6A 1WRJA 1STUA 4OX9E 1YPNA 2NUFA 1TF3A 2EPPA 2V87A 4DMIA 2YTPA 4BC9A 1PJTA 4X9JA 2JWOA 2EM3A 4BHCA 1XMOE 1GZ6A 5A6BD 2MDRA 1QNTA 4O4KA 2EQ3A 5LMUE 2NA2A 2EQ1A 2EPLX 2EN7A 2JY9A 4R8OA 1IBME 5DNYA 2M7QA 2IHR1 1KJKA 4DR5E 4B3SE 2MC5A 1EH7A 1WHNA 3VYYA 2YZTA 4LF5E 2EPXA 2GHFA 3THOB 1YYOA 1A1FA 4DV7E 2LTSA 2VQFE 5IWAE 2YTNA 1N36E 2HHHE 3AUZA 4JI1E 4GKKE 2WBUA 2ADRA 1PJQA 1T39A 3DF6A 4BHBA 3C6MA 4WX9A 1A1HA 2ODRD 4BC7A 5FLXC 2JOBA 4R2EA 2EM5A 4R2RA 4DR7E 3EPKA 2YTDA 4X66E 1X3CA 1IQOA 2M1SA 1QU6A 2YTGA 1PJSA 2KOUA 2PRTA 1YUJA 2CPNA 1A1KA 3IWCA 1J5EE 1YZ9A 2EN3A 2LUQA 4JV5E 3JTZA 2UXBE 1HR0E 3FIGA 4F9BB 4HEIA 4JI5E 2CT1A 2G7HA 4R03A 2LUPB 2EORA 2VE7C 3HPSA 3KZZA 1FJGE 1UILA 2ZM6E 4WPYA 5KL5A 2EOYA 2EM0A 2EN2A 1YSAC 2LJUA 3BIDA 5AASA 1RC7A 4DR6E 2DB2A 2L2NA 3L00A 4NZVA 2JP9A 2NUEA 2EPCA 1SFEA 1PKPA 2YRHA 2DGCA 2YTOA 2EOZA 3QG5C 3C6KA 2VQEE 2EN8A 1WHQA 3MHHC 2LMZA 1T38A 3BGHA 2VF1A 4JYAE 5KL7A 2YTQA 2EP3A 2EPZA 4WXDA 3C4BA 3ECRA 2EMBA 4R2PA 2UUCE 2BBGA 3C4TA 2EMCA 1JK1A 2RSMA 1TF6A 2EE8A 1FKAE 1X6FA 4P7DA 5KL4A 2RPCA 4IJDA 2UXDE 2BB8A 4P78A 4WYQB 2L8TA 2EOEA 2DSYA 2EMKA 4NXNE 4BBYA 2D9HA 2EMIA 1A1IA 1X5WA 2YU5A 4KWYA 5AC5A 2LRSA 2V85A 2ODRC 2WCC3 4B3ME 4DV0E 2EOIA 4O43A 5A6BA 3VYXA 1N34E 3EPHA 5A69A 2L92A 2LTRA 2EOSA 3VHTB 2RSIA 3F6HA 5AE1A 2E5LE 4O5GA 2I9IA 1GQEA 2RS7A 4JI3E 3ADIA 3M99B 1F2IG 4BCAA 4ZYDA 2EMFA 1UN6B 4DR2E 4R2QA 4L5NC 1G2DC 1HNWE 2R76A 1IBKE 4LF4E 1BB8A 4LTYA 2KHXA 3OTOE 2UUBE 2EMWA 1ZBTA 4LFBE 2EOFA 1SR9A 2LVHA 2NABA 2LE2A 4LU9A 4WSGA 2EMAA 1EKZA 1J26A 4Q28A 2E72A 2EOHA 2B7TA 3HTXA 4HTGA 2UU9E 3ADGA 2DLQA 2EMHA 2JPAA 2JXPA 2K4VA 2NUGA 2EM9A 2LT7A 4JI6E 5LMNE 2MKNA 4O24A 1BBOA 2MDGA 4YY3E 2YTFA 1T4OA 1AH5A 4R2SA 1HNXE 2ELZA 4LFCE 1MEYC 1UBDC 2KONA 3T1YE 4JI0E 2RQLA 3ADLA 2EMZA 4OOGC 4M30A 3J81C 2B9DA 2J7JA 1Z1BA 1YYWA 5AE2A 1RQ0A 2EPKX 2EPNA 2JR1A 2DLKA 2EMGA 4RHBB 3UK3C 1ZAAC 1XNQE 2EPRA 3HPZA 4F6NA 2YTEA 4TUIA 4J8ZA 2EPOA 2EM8A 4M9VC 1X48A 3IWBA 5A6AA 1A1JA 2M9AA 1NEIA 3KZYA 2M4IA 3LLHA 5KL2A 1X6EA 4IS1C 1MGTA 4RH8A 1ZR9A 4X65E 4DV4E 1I94E 2JYAA 1N3GA 2JOXA 3RMPA 2WBTA 4DV3E 2EOMA 1YUIA 1L4SA 2JVAA 2YTJA 1HNZE 1T4LB 5KL6A 1DQ3A 2YPNA 3F6GA 1ZU1A 3JU0A 4M0VA 5AC4A 4DV2E 4B3RE 2EPAA 2LBSB 5TSEA 2V86A 3HXLA 2I13A 4WXCA 2YSOA 4JI8E 1N33E 3HQ1A 2EOOA 4N4RB 4FK5C 1X47A 4F6MA 4GZNC 2EOJA 2YWQA 2F8BA 4LF6E 3JAMC 3J80C 4YHHE 2RTXA 2EM4A 2B7VA 2DMYA 4JI7E 2EPUA 2HJJA 3ZOQB 2EM7A 1EH6A 1LLMC 4F54A 2LJHA 2N3HA 1WJPA 3EPLA 3H09A 2CTDA 2VRDA 4ZYGA 5KL3A 1P47A 1JK2A 5F3WA 2MKDA 5A6JA 4F9CB 1TN9A 4MLQA 5A6KA 3EPJA 4LF9E 2Q8UA 4ZYEA 2EWLA 4L8NA 2DRPA 4JI2E 4DKKA 1IMUA 4X62E 2H36X 1YYKA 5IV8B 4F2JC 4MLVA 1ZBQA 3LMLA 2RS6A 5IXMB 3P1XA 3EQ1A 3TQMA 4KHPE 1DGCA 1BBGA 4K0KE 1IBLE 3J7Yp 3T1HE 2LCEA 3MSWA 4M2ZA 4DUZE 2EN4A 4BS9A 3KWRA 4X64E 2UUAE 1B69A 2YSPA 2ENAA 1YFHA 2F4VE 2FV4B 3DJWA 5AE3A 4LFAE 2YU8A 4WFTA 2N8XA 2FTXB 4LF8E 2EOQA 2LV2A 2V88A 2EJ4A 4R2CA 4R2DA 4Q35B 3BBGA 2L6MA 4DUYE 2L2KB 2YRKA 2K7IA 2DMIA 3BF2A 4R2AA 2EL5A 5BR8E 2YRMA 2EM2A 3K6QA 2B3TB 2N3GA 4DR4E 2L3JA 5T6JA 3J7AG 4F9AB 1X49A 2EL4A 2EM6A 2L3CA 2EPMX 5CFFE 4X8WA 4BMJA 2YT4A 2DIXA 1GTKA 3AV0A 1EH8A 1AAYA 4DV6E 4DV1E 1DI2A 2CSHA 1UHZA 1NCSA 2WZOA 2EOXA
chains in the Genus database with same CATH topology
2EMWA 2EPUA 4R2RA 3EPKA 2YTDA 3MHSC 2LO3A 1X3CA 2EM7A 2EOFA 2LVHA 4WSGA 2NABA 2ELYA 2YTGA 1LLMC 2EMAA 2A25A 2PRTA 1YUJA 2EMYA 1A1KA 1WJPA 3EPLA 2E72A 2EOHA 1X6HA 2CTDA 2EL6A 2EN3A 2R1FA 2VRDA 5KL3A 1A1GA 1P47A 1JK2A 2MKDA 2DLQA 2EMHA 2JPAA 1TN9A 2EMLA 2ENCA 2EM9A 2WBSA 3EPJA 2LT7A 2MKNA 1BBOA 2MDGA 1A1LA 2CT1A 2YTFA 2EN1A 2DRPA 2EORA 4R2SA 1RMDA 5KL5A 2ELZA 2EOYA 2HGHA 1MEYC 2EM0A 1UBDC 2EN2A 2EQ0A 1YSAC 1G2FC 2GLIA 4F2JC 2EMZA 2EMXA 2ENHA 2JP9A 2J7JA 1Z1BA 1DGCA 2EPCA 2DLKA 2YRHA 2DGCA 2YTOA 2EMGA 2EOZA 2LCEA 2EN8A 3MHHC 3UK3C 1ZAAC 2EN4A 2EPRA 5KL7A 4F6NA 2YTQA 2YTEA 2EP3A 2YTIA 2EN6A 2EPZA 2EMBA 1B69A 4R2PA 2EM8A 4M9VC 2YSPA 1TF3A 2EPPA 2ENAA 2YTPA 2YU8A 2EMCA 1JK1A 1A1JA 2M9AA 4X9JA 1TF6A 5KL2A 2EE8A 1X6EA 2EM3A 1X6FA 2EOQA 4IS1C 2LV2A 1ZR9A 2EJ4A 5KL4A 4R2CA 2EQ3A 2RPCA 4IJDA 4R2DA 2BB8A 2EQ1A 2EOEA 2EN7A 2EMKA 2WBTA 2YRKA 2EOMA 1YUIA 2D9HA 2EMIA 1A1IA 1X5WA 2YU5A 4R2AA 2DMIA 1KJKA 2EL5A 2YTJA 5KL6A 2WCC3 1ZU1A 2EOIA 2YRMA 2EM2A 3EPHA 2EPAA 2EPXA 2EOSA 2GHFA 2EL4A 3VHTB 1A1FA 2EM6A 2RSIA 2YSOA 2I13A 2YTNA 2EOOA 4FK5C 3M99B 1F2IG 2WBUA 2ADRA 2EMFA 4F6MA 4GZNC 1AAYA 2EOJA 1UN6B 4R2QA 1G2DC 2CSHA 1A1HA 1NCSA 1BB8A 2EM4A 4R2EA 2EM5A 2EOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMW A;  2EPU A;  4R2R A;  3EPK A;  2YTD A;  3MHS C;  2LO3 A;  1X3C A;  2EM7 A;  2EOF A;  2LVH A;  4WSG A;  2NAB A;  2ELY A;  2YTG A;  1LLM C;  2EMA A;  2A25 A;  2PRT A;  1YUJ A;  2EMY A;  1A1K A;  1WJP A;  3EPL A;  2E72 A;  2EOH A;  1X6H A;  2CTD A;  2EL6 A;  2EN3 A;  2R1F A;  2VRD A;  5KL3 A;  1A1G A;  1P47 A;  1JK2 A;  2MKD A;  2DLQ A;  2EMH A;  2JPA A;  1TN9 A;  2EML A;  2ENC A;  2EM9 A;  2WBS A;  3EPJ A;  2LT7 A;  2MKN A;  1BBO A;  2MDG A;  1A1L A;  2CT1 A;  2YTF A;  2EN1 A;  2DRP A;  2EOR A;  4R2S A;  1RMD A;  5KL5 A;  2ELZ A;  2EOY A;  2HGH A;  1MEY C;  2EM0 A;  1UBD C;  2EN2 A;  2EQ0 A;  1YSA C;  1G2F C;  2GLI A;  4F2J C;  2EMZ A;  2EMX A;  2ENH A;  2JP9 A;  2J7J A;  1Z1B A;  1DGC A;  2EPC A;  2DLK A;  2YRH A;  2DGC A;  2YTO A;  2EMG A;  2EOZ A;  2LCE A;  2EN8 A;  3MHH C;  3UK3 C;  1ZAA C;  2EN4 A;  2EPR A;  5KL7 A;  4F6N A;  2YTQ A;  2YTE A;  2EP3 A;  2YTI A;  2EN6 A;  2EPZ A;  2EMB A;  1B69 A;  4R2P A;  2EM8 A;  4M9V C;  2YSP A;  1TF3 A;  2EPP A;  2ENA A;  2YTP A;  2YU8 A;  2EMC A;  1JK1 A;  1A1J A;  2M9A A;  4X9J A;  1TF6 A;  5KL2 A;  2EE8 A;  1X6E A;  2EM3 A;  1X6F A;  2EOQ A;  4IS1 C;  2LV2 A;  1ZR9 A;  2EJ4 A;  5KL4 A;  4R2C A;  2EQ3 A;  2RPC A;  4IJD A;  4R2D A;  2BB8 A;  2EQ1 A;  2EOE A;  2EN7 A;  2EMK A;  2WBT A;  2YRK A;  2EOM A;  1YUI A;  2D9H A;  2EMI A;  1A1I A;  1X5W A;  2YU5 A;  4R2A A;  2DMI A;  1KJK A;  2EL5 A;  2YTJ A;  5KL6 A;  2WCC 3;  1ZU1 A;  2EOI A;  2YRM A;  2EM2 A;  3EPH A;  2EPA A;  2EPX A;  2EOS A;  2GHF A;  2EL4 A;  3VHT B;  1A1F A;  2EM6 A;  2RSI A;  2YSO A;  2I13 A;  2YTN A;  2EOO A;  4FK5 C;  3M99 B;  1F2I G;  2WBU A;  2ADR A;  2EMF A;  4F6M A;  4GZN C;  1AAY A;  2EOJ A;  1UN6 B;  4R2Q A;  1G2D C;  2CSH A;  1A1H A;  1NCS A;  1BB8 A;  2EM4 A;  4R2E A;  2EM5 A;  2EOX A; 
#chains in the Genus database with same CATH topology
 2UXC E;  3MHS C;  2LO3 A;  5LLQ A;  3IWD A;  2ELY A;  2A25 A;  2FGG A;  2V89 A;  4NHR A;  2EMY A;  3THN A;  4JI4 E;  1X6H A;  2EL6 A;  2R1F A;  1IQS A;  2L33 A;  1A1G A;  2V8Q B;  3OML A;  2GPI A;  4GEQ B;  2EML A;  2ENC A;  2WBS A;  4AQY E;  1A1L A;  5LL6 R;  5IT9 C;  4DR1 E;  2EN1 A;  1N32 E;  1KYQ A;  1O0W A;  1RMD A;  4GKJ E;  1WXR A;  3ADJ A;  2HGH A;  1XNR E;  2EQ0 A;  2HC5 A;  2GLI A;  1G2F C;  4NXM E;  4I8O A;  4ZYH A;  2EMX A;  4B3T E;  4LF7 E;  4WSP A;  2ENH A;  2V83 A;  1XMQ E;  4DV5 E;  4TUG A;  2L2M A;  4KZS A;  5ADZ A;  2E1M A;  2MC6 A;  1T4N A;  5A2Q C;  1PDA A;  4DR3 E;  3VK6 A;  2EZ6 A;  2YTI A;  2EN6 A;  1WRJ A;  1STU A;  4OX9 E;  1YPN A;  2NUF A;  1TF3 A;  2EPP A;  2V87 A;  4DMI A;  2YTP A;  4BC9 A;  1PJT A;  4X9J A;  2JWO A;  2EM3 A;  4BHC A;  1XMO E;  1GZ6 A;  5A6B D;  2MDR A;  1QNT A;  4O4K A;  2EQ3 A;  5LMU E;  2NA2 A;  2EQ1 A;  2EPL X;  2EN7 A;  2JY9 A;  4R8O A;  1IBM E;  5DNY A;  2M7Q A;  2IHR 1;  1KJK A;  4DR5 E;  4B3S E;  2MC5 A;  1EH7 A;  1WHN A;  3VYY A;  2YZT A;  4LF5 E;  2EPX A;  2GHF A;  3THO B;  1YYO A;  1A1F A;  4DV7 E;  2LTS A;  2VQF E;  5IWA E;  2YTN A;  1N36 E;  2HHH E;  3AUZ A;  4JI1 E;  4GKK E;  2WBU A;  2ADR A;  1PJQ A;  1T39 A;  3DF6 A;  4BHB A;  3C6M A;  4WX9 A;  1A1H A;  2ODR D;  4BC7 A;  5FLX C;  2JOB A;  4R2E A;  2EM5 A;  4R2R A;  4DR7 E;  3EPK A;  2YTD A;  4X66 E;  1X3C A;  1IQO A;  2M1S A;  1QU6 A;  2YTG A;  1PJS A;  2KOU A;  2PRT A;  1YUJ A;  2CPN A;  1A1K A;  3IWC A;  1J5E E;  1YZ9 A;  2EN3 A;  2LUQ A;  4JV5 E;  3JTZ A;  2UXB E;  1HR0 E;  3FIG A;  4F9B B;  4HEI A;  4JI5 E;  2CT1 A;  2G7H A;  4R03 A;  2LUP B;  2EOR A;  2VE7 C;  3HPS A;  3KZZ A;  1FJG E;  1UIL A;  2ZM6 E;  4WPY A;  5KL5 A;  2EOY A;  2EM0 A;  2EN2 A;  1YSA C;  2LJU A;  3BID A;  5AAS A;  1RC7 A;  4DR6 E;  2DB2 A;  2L2N A;  3L00 A;  4NZV A;  2JP9 A;  2NUE A;  2EPC A;  1SFE A;  1PKP A;  2YRH A;  2DGC A;  2YTO A;  2EOZ A;  3QG5 C;  3C6K A;  2VQE E;  2EN8 A;  1WHQ A;  3MHH C;  2LMZ A;  1T38 A;  3BGH A;  2VF1 A;  4JYA E;  5KL7 A;  2YTQ A;  2EP3 A;  2EPZ A;  4WXD A;  3C4B A;  3ECR A;  2EMB A;  4R2P A;  2UUC E;  2BBG A;  3C4T A;  2EMC A;  1JK1 A;  2RSM A;  1TF6 A;  2EE8 A;  1FKA E;  1X6F A;  4P7D A;  5KL4 A;  2RPC A;  4IJD A;  2UXD E;  2BB8 A;  4P78 A;  4WYQ B;  2L8T A;  2EOE A;  2DSY A;  2EMK A;  4NXN E;  4BBY A;  2D9H A;  2EMI A;  1A1I A;  1X5W A;  2YU5 A;  4KWY A;  5AC5 A;  2LRS A;  2V85 A;  2ODR C;  2WCC 3;  4B3M E;  4DV0 E;  2EOI A;  4O43 A;  5A6B A;  3VYX A;  1N34 E;  3EPH A;  5A69 A;  2L92 A;  2LTR A;  2EOS A;  3VHT B;  2RSI A;  3F6H A;  5AE1 A;  2E5L E;  4O5G A;  2I9I A;  1GQE A;  2RS7 A;  4JI3 E;  3ADI A;  3M99 B;  1F2I G;  4BCA A;  4ZYD A;  2EMF A;  1UN6 B;  4DR2 E;  4R2Q A;  4L5N C;  1G2D C;  1HNW E;  2R76 A;  1IBK E;  4LF4 E;  1BB8 A;  4LTY A;  2KHX A;  3OTO E;  2UUB E;  2EMW A;  1ZBT A;  4LFB E;  2EOF A;  1SR9 A;  2LVH A;  2NAB A;  2LE2 A;  4LU9 A;  4WSG A;  2EMA A;  1EKZ A;  1J26 A;  4Q28 A;  2E72 A;  2EOH A;  2B7T A;  3HTX A;  4HTG A;  2UU9 E;  3ADG A;  2DLQ A;  2EMH A;  2JPA A;  2JXP A;  2K4V A;  2NUG A;  2EM9 A;  2LT7 A;  4JI6 E;  5LMN E;  2MKN A;  4O24 A;  1BBO A;  2MDG A;  4YY3 E;  2YTF A;  1T4O A;  1AH5 A;  4R2S A;  1HNX E;  2ELZ A;  4LFC E;  1MEY C;  1UBD C;  2KON A;  3T1Y E;  4JI0 E;  2RQL A;  3ADL A;  2EMZ A;  4OOG C;  4M30 A;  3J81 C;  2B9D A;  2J7J A;  1Z1B A;  1YYW A;  5AE2 A;  1RQ0 A;  2EPK X;  2EPN A;  2JR1 A;  2DLK A;  2EMG A;  4RHB B;  3UK3 C;  1ZAA C;  1XNQ E;  2EPR A;  3HPZ A;  4F6N A;  2YTE A;  4TUI A;  4J8Z A;  2EPO A;  2EM8 A;  4M9V C;  1X48 A;  3IWB A;  5A6A A;  1A1J A;  2M9A A;  1NEI A;  3KZY A;  2M4I A;  3LLH A;  5KL2 A;  1X6E A;  4IS1 C;  1MGT A;  4RH8 A;  1ZR9 A;  4X65 E;  4DV4 E;  1I94 E;  2JYA A;  1N3G A;  2JOX A;  3RMP A;  2WBT A;  4DV3 E;  2EOM A;  1YUI A;  1L4S A;  2JVA A;  2YTJ A;  1HNZ E;  1T4L B;  5KL6 A;  1DQ3 A;  2YPN A;  3F6G A;  1ZU1 A;  3JU0 A;  4M0V A;  5AC4 A;  4DV2 E;  4B3R E;  2EPA A;  2LBS B;  5TSE A;  2V86 A;  3HXL A;  2I13 A;  4WXC A;  2YSO A;  4JI8 E;  1N33 E;  3HQ1 A;  2EOO A;  4N4R B;  4FK5 C;  1X47 A;  4F6M A;  4GZN C;  2EOJ A;  2YWQ A;  2F8B A;  4LF6 E;  3JAM C;  3J80 C;  4YHH E;  2RTX A;  2EM4 A;  2B7V A;  2DMY A;  4JI7 E;  2EPU A;  2HJJ A;  3ZOQ B;  2EM7 A;  1EH6 A;  1LLM C;  4F54 A;  2LJH A;  2N3H A;  1WJP A;  3EPL A;  3H09 A;  2CTD A;  2VRD A;  4ZYG A;  5KL3 A;  1P47 A;  1JK2 A;  5F3W A;  2MKD A;  5A6J A;  4F9C B;  1TN9 A;  4MLQ A;  5A6K A;  3EPJ A;  4LF9 E;  2Q8U A;  4ZYE A;  2EWL A;  4L8N A;  2DRP A;  4JI2 E;  4DKK A;  1IMU A;  4X62 E;  2H36 X;  1YYK A;  5IV8 B;  4F2J C;  4MLV A;  1ZBQ A;  3LML A;  2RS6 A;  5IXM B;  3P1X A;  3EQ1 A;  3TQM A;  4KHP E;  1DGC A;  1BBG A;  4K0K E;  1IBL E;  3J7Y p;  3T1H E;  2LCE A;  3MSW A;  4M2Z A;  4DUZ E;  2EN4 A;  4BS9 A;  3KWR A;  4X64 E;  2UUA E;  1B69 A;  2YSP A;  2ENA A;  1YFH A;  2F4V E;  2FV4 B;  3DJW A;  5AE3 A;  4LFA E;  2YU8 A;  4WFT A;  2N8X A;  2FTX B;  4LF8 E;  2EOQ A;  2LV2 A;  2V88 A;  2EJ4 A;  4R2C A;  4R2D A;  4Q35 B;  3BBG A;  2L6M A;  4DUY E;  2L2K B;  2YRK A;  2K7I A;  2DMI A;  3BF2 A;  4R2A A;  2EL5 A;  5BR8 E;  2YRM A;  2EM2 A;  3K6Q A;  2B3T B;  2N3G A;  4DR4 E;  2L3J A;  5T6J A;  3J7A G;  4F9A B;  1X49 A;  2EL4 A;  2EM6 A;  2L3C A;  2EPM X;  5CFF E;  4X8W A;  4BMJ A;  2YT4 A;  2DIX A;  1GTK A;  3AV0 A;  1EH8 A;  1AAY A;  4DV6 E;  4DV1 E;  1DI2 A;  2CSH A;  1UHZ A;  1NCS A;  2WZO A;  2EOX A; 
#chains in the Genus database with same CATH homology
 2EMW A;  2EPU A;  4R2R A;  3EPK A;  2YTD A;  3MHS C;  2LO3 A;  1X3C A;  2EM7 A;  2EOF A;  2LVH A;  4WSG A;  2NAB A;  2ELY A;  2YTG A;  1LLM C;  2EMA A;  2A25 A;  2PRT A;  1YUJ A;  2EMY A;  1A1K A;  1WJP A;  3EPL A;  2E72 A;  2EOH A;  1X6H A;  2CTD A;  2EL6 A;  2EN3 A;  2R1F A;  2VRD A;  5KL3 A;  1A1G A;  1P47 A;  1JK2 A;  2MKD A;  2DLQ A;  2EMH A;  2JPA A;  1TN9 A;  2EML A;  2ENC A;  2EM9 A;  2WBS A;  3EPJ A;  2LT7 A;  2MKN A;  1BBO A;  2MDG A;  1A1L A;  2CT1 A;  2YTF A;  2EN1 A;  2DRP A;  2EOR A;  4R2S A;  1RMD A;  5KL5 A;  2ELZ A;  2EOY A;  2HGH A;  1MEY C;  2EM0 A;  1UBD C;  2EN2 A;  2EQ0 A;  1YSA C;  1G2F C;  2GLI A;  4F2J C;  2EMZ A;  2EMX A;  2ENH A;  2JP9 A;  2J7J A;  1Z1B A;  1DGC A;  2EPC A;  2DLK A;  2YRH A;  2DGC A;  2YTO A;  2EMG A;  2EOZ A;  2LCE A;  2EN8 A;  3MHH C;  3UK3 C;  1ZAA C;  2EN4 A;  2EPR A;  5KL7 A;  4F6N A;  2YTQ A;  2YTE A;  2EP3 A;  2YTI A;  2EN6 A;  2EPZ A;  2EMB A;  1B69 A;  4R2P A;  2EM8 A;  4M9V C;  2YSP A;  1TF3 A;  2EPP A;  2ENA A;  2YTP A;  2YU8 A;  2EMC A;  1JK1 A;  1A1J A;  2M9A A;  4X9J A;  1TF6 A;  5KL2 A;  2EE8 A;  1X6E A;  2EM3 A;  1X6F A;  2EOQ A;  4IS1 C;  2LV2 A;  1ZR9 A;  2EJ4 A;  5KL4 A;  4R2C A;  2EQ3 A;  2RPC A;  4IJD A;  4R2D A;  2BB8 A;  2EQ1 A;  2EOE A;  2EN7 A;  2EMK A;  2WBT A;  2YRK A;  2EOM A;  1YUI A;  2D9H A;  2EMI A;  1A1I A;  1X5W A;  2YU5 A;  4R2A A;  2DMI A;  1KJK A;  2EL5 A;  2YTJ A;  5KL6 A;  2WCC 3;  1ZU1 A;  2EOI A;  2YRM A;  2EM2 A;  3EPH A;  2EPA A;  2EPX A;  2EOS A;  2GHF A;  2EL4 A;  3VHT B;  1A1F A;  2EM6 A;  2RSI A;  2YSO A;  2I13 A;  2YTN A;  2EOO A;  4FK5 C;  3M99 B;  1F2I G;  2WBU A;  2ADR A;  2EMF A;  4F6M A;  4GZN C;  1AAY A;  2EOJ A;  1UN6 B;  4R2Q A;  1G2D C;  2CSH A;  1A1H A;  1NCS A;  1BB8 A;  2EM4 A;  4R2E A;  2EM5 A;  2EOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...