4R2PA

Wilms tumor protein (wt1) zinc fingers in complex with hydroxymethylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2pA00
1X6HA 2WBUA 1UBDC 2MKDA 1Z1BA 1ZU1A 2EPRA 2GHFA 2YTIA 5KL5A 2EPPA 2EPAA 2J7JA 2CSHA 5KL2A 2YRMA 1P47A 1X3CA 2ENAA 1BB8A 2EMKA 1MEYC 2YSOA 5KL6A 1A1LA 2LV2A 4WSGA 2EMFA 4R2SA 1A1GA 2YTQA 2LVHA 1KJKA 2EE8A 2EJ4A 2EMBA 1YUJA 2EL4A 2EOMA 2A25A 1B69A 2E72A 2EM5A 2EQ1A 1A1IA 2LO3A 2YTEA 2ELYA 2EMAA 2MDGA 2EN3A 2EOFA 4R2DA 2EM7A 4R2AA 4IS1C 2RPCA 1X6EA 2HGHA 2EM2A 2JPAA 2DLKA 3EPLA 4GZNC 4M9VC 2EOZA 2EOHA 2EMCA 2VRDA 1RMDA 2YRHA 2YTDA 2YTPA 2DLQA 2GLIA 4FK5C 5KL4A 2EM6A 1A1JA 2EORA 1X5WA 1YUIA 2EM0A 2EMWA 4X9JA 2EN6A 1ZR9A 2EOJA 2YRKA 4R2CA 1A1FA 1UN6B 2LCEA 5KL7A 2EQ0A 2NABA 2EPXA 3MHHC 2YTJA 2PRTA 2EMXA 1G2DC 2EMZA 2WBSA 1BBOA 2YTOA 2DGCA 4F6NA 2ADRA 1YSAC 2YU8A 2EQ3A 2R1FA 2EMGA 4F2JC 2EL6A 2EM3A 2EOQA 2WBTA 2YTGA 4R2EA 2EN7A 2JP9A 1A1KA 2RSIA 2EN8A 1WJPA 1TF6A 2EN2A 2BB8A 1G2FC 2EMHA 4F6MA 2ELZA 2EOSA 2EOIA 2EM4A 2EOYA 2EMIA 3VHTB 2EMLA 4R2RA 3MHSC 2LT7A 2EPCA 2EPZA 2ENCA 4IJDA 1F2IG 2CTDA 2YSPA 2EM9A 2EL5A 2EM8A 2EOOA 1A1HA 1TF3A 3UK3C 2DMIA 1AAYA 3M99B 1TN9A 4R2PA 3EPHA 2YTFA 2EOEA 1JK2A 1NCSA 2WCC3 2D9HA 1X6FA 2ENHA 2EN4A 2EOXA 2EP3A 1DGCA 2DRPA 1JK1A 2MKNA 2YTNA 2EMYA 2YU5A 3EPJA 2I13A 2CT1A 1LLMC 3EPKA 1ZAAC 4R2QA 2EPUA 2M9AA 5KL3A 2EN1A
chains in the Genus database with same CATH superfamily
4JI7E 2N8XA 4X8WA 4BS9A 4RHBB 2EPPA 2CSHA 4J8ZA 3L00A 1X47A 1WHQA 1WHNA 2EZ6A 1BB8A 2EMKA 1MEYC 2JXPA 4BHBA 2F4VE 2YT4A 4O4KA 3J80C 4DMIA 2EPKX 4JI6E 1N32E 2RQLA 1PDAA 2YTQA 2UXDE 1XMQE 2EE8A 2V83A 3KZZA 4ZYHA 1HR0E 5IV8B 2YTEA 2E5LE 2EMAA 4R2DA 1PJQA 3H09A 2RPCA 2UUCE 3LMLA 2DLKA 4M9VC 2L33A 1WRJA 2EOZA 1EH6A 2VRDA 3QG5C 1MGTA 1NEIA 3JU0A 2EPMX 2EM6A 3MSWA 1A1JA 2HC5A 2EMWA 3FIGA 4OOGC 2EN6A 3AUZA 2R76A 2VQFE 2PRTA 3VYYA 4LF9E 2LRSA 1G2DC 2WBSA 4I8OA 2RS6A 4TUIA 4DR7E 1EH7A 4F6NA 2ADRA 2EQ3A 4JI4E 5T6JA 2EM3A 2EOQA 2YTGA 1HNZE 3P1XA 2YPNA 2JVAA 3AV0A 2EN8A 4TUGA 1G2FC 4WSPA 2UUBE 3VHTB 2LUQA 2JR1A 4YHHE 2LT7A 1T4OA 1IBLE 1PJSA 2L6MA 4DUYE 2V88A 2EM8A 2EL5A 2L2KB 1YFHA 3UK3C 2LE2A 2RTXA 4N4RB 1AAYA 2NA2A 4R2PA 1T39A 1NCSA 2LMZA 2D9HA 1YYOA 2E1MA 4DUZE 1GQEA 1EKZA 2V85A 2B7VA 4YY3E 4DR3E 4O24A 1JK1A 1N3GA 2L92A 2EMYA 2YU5A 3HXLA 3JAMC 5IXMB 2I13A 1LLMC 1ZBQA 3EPKA 1ZBTA 2V89A 2WZOA 1ZAAC 2L3JA 4R2QA 2HJJA 2B3TB 4X65E 1IBKE 2UXBE 1T4NA 2MKDA 1ZU1A 2VQEE 1HNWE 2V86A 5LLQA 3C6KA 5KL5A 5A2QC 5KL2A 1X49A 3KWRA 2YRMA 2RSMA 4B3TE 3ADLA 3IWCA 2NUEA 2LV2A 5FLXC 1YPNA 5AE3A 2LJHA 4WSGA 3BBGA 2EMFA 4DV5E 2CPNA 1A1GA 2EM5A 2JWOA 4KHPE 5LL6R 2MDGA 4BC7A 2EN3A 2UXCE 4LFCE 1X6EA 1EH8A 4GZNC 4ZYEA 2FGGA 4MLQA 1RMDA 2YTPA 4FK5C 2M4IA 4R8OA 2FTXB 1RQ0A 2EM0A 3HPSA 1ZR9A 2EOJA 2YRKA 2ODRD 1A1FA 3THOB 5ADZA 5DNYA 4Q28A 4BCAA 2EMXA 2EMZA 4P7DA 3ECRA 4DR2E 4X64E 2L8TA 3J7Yp 4JI0E 3HPZA 1YZ9A 2VE7C 4WFTA 4F2JC 4BMJA 1PKPA 4DV6E 1IMUA 2LBSB 1TF6A 1WJPA 4LFBE 2EN2A 1XNQE 3HTXA 2EOYA 2EPZA 4DKKA 2ENCA 3F6GA 1TF3A 2EM9A 1A1HA 2DSYA 2GPIA 5BR8E 4WXCA 4NXME 4X62E 2YTFA 1IQSA 5A6AA 1JK2A 2K4VA 2WCC3 2ENHA 5AE1A 4LF6E 2EN4A 2F8BA 3F6HA 2EOXA 2ODRC 2NUFA 3C4TA 1DGCA 2DRPA 2V87A 1T4LB 2MKNA 3J7AG 2IHR1 4X66E 1XMOE 2CT1A 1N34E 4DV4E 4M0VA 3JTZA 1O0WA 3BIDA 1WXRA 2EPUA 5IT9C 2EN1A 1X6HA 2WBUA 1UBDC 4B3ME 2EPRA 2G7HA 4P78A 5LMNE 1UILA 4F9CB 1P47A 1X3CA 1IBME 4HTGA 1A1LA 4LTYA 4Q35B 4DV7E 4ZYDA 1L4SA 1RC7A 2DMYA 2M1SA 2LVHA 4R03A 2LUPB 1KJKA 2EMBA 1SR9A 3OTOE 1J26A 2MDRA 2EL4A 2KHXA 5AE2A 1B69A 3ADJA 2E72A 1A1IA 2LO3A 2ELYA 3BGHA 4M30A 2EM7A 4R2AA 2YWQA 2UUAE 4O43A 2HGHA 2EM2A 4DV3E 1J5EE 2JPAA 3EPLA 2L3CA 4F9BB 4BHCA 2EOHA 2N3GA 5KL4A 4F54A 2EORA 1YUIA 4ZYGA 4X9JA 5A69A 2UU9E 2N3HA 4F9AB 3RMPA 1UN6B 2BBGA 4JI5E 2LCEA 4JV5E 5KL7A 2EQ0A 2FV4B 2NABA 2EPXA 3MHHC 2YTJA 4LF5E 3VYXA 1BBOA 2H36X 1YSAC 2YU8A 2R1FA 2DB2A 2EL6A 3KZYA 1N36E 4R2EA 2MC6A 2BB8A 2L2NA 2ELZA 2EOSA 2EOIA 4DV0E 2EM4A 2EMLA 3MHSC 2ZM6E 4IJDA 2LJUA 1STUA 1F2IG 2K7IA 2EOOA 4JI2E 1FJGE 4JYAE 4NXNE 3IWDA 2KONA 2VF1A 2EOEA 1X6FA 2V8QB 4DV2E 4WPYA 3ADIA 2EP3A 3BF2A 4OX9E 4BBYA 5A6BD 2YTNA 3EPJA 1YYWA 4BC9A 2RS7A 3TQMA 4JI3E 4K0KE 1FKAE 4MLVA 4DR4E 2M9AA 4L8NA 5AC5A 4LF8E 1Z1BA 3T1YE 4DR1E 2GHFA 4M2ZA 2KOUA 2YTIA 5LMUE 2EPAA 2J7JA 3IWBA 4JI1E 4L5NC 4KZSA 2ENAA 2YSOA 5KL6A 5A6KA 2JYAA 2LTRA 3K6QA 4B3RE 4R2SA 4GKJE 4LF7E 4GEQB 1BBGA 2EPNA 1I94E 4NZVA 3T1HE 2EJ4A 2LTSA 4HEIA 3ADGA 1YYKA 1YUJA 2EOMA 2A25A 1AH5A 1IQOA 2EQ1A 1GZ6A 4LU9A 5CFFE 3C6MA 4WYQB 1QU6A 1X48A 2EOFA 2M7QA 1XNRE 4WXDA 3ZOQB 4IS1C 3C4BA 1DI2A 1N33E 5A6BA 4DV1E 2EMCA 2HHHE 2YRHA 2YTDA 1GTKA 1QNTA 2DLQA 2GLIA 4B3SE 1X5WA 2EWLA 3EQ1A 4DR6E 2JOXA 4R2CA 5A6JA 1SFEA 4DR5E 3DJWA 2YTOA 2DGCA 1DQ3A 4NHRA 2DIXA 2EMGA 2JY9A 4O5GA 2WBTA 2YZTA 2EN7A 4JI8E 2JP9A 1A1KA 5AASA 2RSIA 2EMHA 4F6MA 5F3WA 1T38A 3OMLA 2EMIA 4R2RA 2EPCA 5IWAE 2B9DA 2CTDA 3J81C 3HQ1A 2YSPA 1KYQA 1HNXE 2B7TA 2DMIA 3M99B 3LLHA 1UHZA 3VK6A 2JOBA 1TN9A 3EPHA 5TSEA 4KWYA 2L2MA 2I9IA 4LFAE 5AC4A 3DF6A 3THNA 2EPLX 2NUGA 2EPOA 2Q8UA 2MC5A 4LF4E 4RH8A 4WX9A 4AQYE 1PJTA 5KL3A 4GKKE
chains in the Genus database with same CATH topology
1X6HA 2WBUA 1UBDC 2MKDA 1Z1BA 1ZU1A 2EPRA 2GHFA 2YTIA 5KL5A 2EPPA 2EPAA 2J7JA 2CSHA 5KL2A 2YRMA 1P47A 1X3CA 2ENAA 1BB8A 2EMKA 1MEYC 2YSOA 5KL6A 1A1LA 2LV2A 4WSGA 2EMFA 4R2SA 1A1GA 2YTQA 2LVHA 1KJKA 2EE8A 2EJ4A 2EMBA 1YUJA 2EL4A 2EOMA 2A25A 1B69A 2E72A 2EM5A 2EQ1A 1A1IA 2LO3A 2YTEA 2ELYA 2EMAA 2MDGA 2EN3A 2EOFA 4R2DA 2EM7A 4R2AA 4IS1C 2RPCA 1X6EA 2HGHA 2EM2A 2JPAA 2DLKA 3EPLA 4GZNC 4M9VC 2EOZA 2EOHA 2EMCA 2VRDA 1RMDA 2YRHA 2YTDA 2YTPA 2DLQA 2GLIA 4FK5C 5KL4A 2EM6A 1A1JA 2EORA 1X5WA 1YUIA 2EM0A 2EMWA 4X9JA 2EN6A 1ZR9A 2EOJA 2YRKA 4R2CA 1A1FA 1UN6B 2LCEA 5KL7A 2EQ0A 2NABA 2EPXA 3MHHC 2YTJA 2PRTA 2EMXA 1G2DC 2EMZA 2WBSA 1BBOA 2YTOA 2DGCA 4F6NA 2ADRA 1YSAC 2YU8A 2EQ3A 2R1FA 2EMGA 4F2JC 2EL6A 2EM3A 2EOQA 2WBTA 2YTGA 4R2EA 2EN7A 2JP9A 1A1KA 2RSIA 2EN8A 1WJPA 1TF6A 2EN2A 2BB8A 1G2FC 2EMHA 4F6MA 2ELZA 2EOSA 2EOIA 2EM4A 2EOYA 2EMIA 3VHTB 2EMLA 4R2RA 3MHSC 2LT7A 2EPCA 2EPZA 2ENCA 4IJDA 1F2IG 2CTDA 2YSPA 2EM9A 2EL5A 2EM8A 2EOOA 1A1HA 1TF3A 3UK3C 2DMIA 1AAYA 3M99B 1TN9A 4R2PA 3EPHA 2YTFA 2EOEA 1JK2A 1NCSA 2WCC3 2D9HA 1X6FA 2ENHA 2EN4A 2EOXA 2EP3A 1DGCA 2DRPA 1JK1A 2MKNA 2YTNA 2EMYA 2YU5A 3EPJA 2I13A 2CT1A 1LLMC 3EPKA 1ZAAC 4R2QA 2EPUA 2M9AA 5KL3A 2EN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6H A;  2WBU A;  1UBD C;  2MKD A;  1Z1B A;  1ZU1 A;  2EPR A;  2GHF A;  2YTI A;  5KL5 A;  2EPP A;  2EPA A;  2J7J A;  2CSH A;  5KL2 A;  2YRM A;  1P47 A;  1X3C A;  2ENA A;  1BB8 A;  2EMK A;  1MEY C;  2YSO A;  5KL6 A;  1A1L A;  2LV2 A;  4WSG A;  2EMF A;  4R2S A;  1A1G A;  2YTQ A;  2LVH A;  1KJK A;  2EE8 A;  2EJ4 A;  2EMB A;  1YUJ A;  2EL4 A;  2EOM A;  2A25 A;  1B69 A;  2E72 A;  2EM5 A;  2EQ1 A;  1A1I A;  2LO3 A;  2YTE A;  2ELY A;  2EMA A;  2MDG A;  2EN3 A;  2EOF A;  4R2D A;  2EM7 A;  4R2A A;  4IS1 C;  2RPC A;  1X6E A;  2HGH A;  2EM2 A;  2JPA A;  2DLK A;  3EPL A;  4GZN C;  4M9V C;  2EOZ A;  2EOH A;  2EMC A;  2VRD A;  1RMD A;  2YRH A;  2YTD A;  2YTP A;  2DLQ A;  2GLI A;  4FK5 C;  5KL4 A;  2EM6 A;  1A1J A;  2EOR A;  1X5W A;  1YUI A;  2EM0 A;  2EMW A;  4X9J A;  2EN6 A;  1ZR9 A;  2EOJ A;  2YRK A;  4R2C A;  1A1F A;  1UN6 B;  2LCE A;  5KL7 A;  2EQ0 A;  2NAB A;  2EPX A;  3MHH C;  2YTJ A;  2PRT A;  2EMX A;  1G2D C;  2EMZ A;  2WBS A;  1BBO A;  2YTO A;  2DGC A;  4F6N A;  2ADR A;  1YSA C;  2YU8 A;  2EQ3 A;  2R1F A;  2EMG A;  4F2J C;  2EL6 A;  2EM3 A;  2EOQ A;  2WBT A;  2YTG A;  4R2E A;  2EN7 A;  2JP9 A;  1A1K A;  2RSI A;  2EN8 A;  1WJP A;  1TF6 A;  2EN2 A;  2BB8 A;  1G2F C;  2EMH A;  4F6M A;  2ELZ A;  2EOS A;  2EOI A;  2EM4 A;  2EOY A;  2EMI A;  3VHT B;  2EML A;  4R2R A;  3MHS C;  2LT7 A;  2EPC A;  2EPZ A;  2ENC A;  4IJD A;  1F2I G;  2CTD A;  2YSP A;  2EM9 A;  2EL5 A;  2EM8 A;  2EOO A;  1A1H A;  1TF3 A;  3UK3 C;  2DMI A;  1AAY A;  3M99 B;  1TN9 A;  4R2P A;  3EPH A;  2YTF A;  2EOE A;  1JK2 A;  1NCS A;  2WCC 3;  2D9H A;  1X6F A;  2ENH A;  2EN4 A;  2EOX A;  2EP3 A;  1DGC A;  2DRP A;  1JK1 A;  2MKN A;  2YTN A;  2EMY A;  2YU5 A;  3EPJ A;  2I13 A;  2CT1 A;  1LLM C;  3EPK A;  1ZAA C;  4R2Q A;  2EPU A;  2M9A A;  5KL3 A;  2EN1 A; 
#chains in the Genus database with same CATH topology
 4JI7 E;  2N8X A;  4X8W A;  4BS9 A;  4RHB B;  2EPP A;  2CSH A;  4J8Z A;  3L00 A;  1X47 A;  1WHQ A;  1WHN A;  2EZ6 A;  1BB8 A;  2EMK A;  1MEY C;  2JXP A;  4BHB A;  2F4V E;  2YT4 A;  4O4K A;  3J80 C;  4DMI A;  2EPK X;  4JI6 E;  1N32 E;  2RQL A;  1PDA A;  2YTQ A;  2UXD E;  1XMQ E;  2EE8 A;  2V83 A;  3KZZ A;  4ZYH A;  1HR0 E;  5IV8 B;  2YTE A;  2E5L E;  2EMA A;  4R2D A;  1PJQ A;  3H09 A;  2RPC A;  2UUC E;  3LML A;  2DLK A;  4M9V C;  2L33 A;  1WRJ A;  2EOZ A;  1EH6 A;  2VRD A;  3QG5 C;  1MGT A;  1NEI A;  3JU0 A;  2EPM X;  2EM6 A;  3MSW A;  1A1J A;  2HC5 A;  2EMW A;  3FIG A;  4OOG C;  2EN6 A;  3AUZ A;  2R76 A;  2VQF E;  2PRT A;  3VYY A;  4LF9 E;  2LRS A;  1G2D C;  2WBS A;  4I8O A;  2RS6 A;  4TUI A;  4DR7 E;  1EH7 A;  4F6N A;  2ADR A;  2EQ3 A;  4JI4 E;  5T6J A;  2EM3 A;  2EOQ A;  2YTG A;  1HNZ E;  3P1X A;  2YPN A;  2JVA A;  3AV0 A;  2EN8 A;  4TUG A;  1G2F C;  4WSP A;  2UUB E;  3VHT B;  2LUQ A;  2JR1 A;  4YHH E;  2LT7 A;  1T4O A;  1IBL E;  1PJS A;  2L6M A;  4DUY E;  2V88 A;  2EM8 A;  2EL5 A;  2L2K B;  1YFH A;  3UK3 C;  2LE2 A;  2RTX A;  4N4R B;  1AAY A;  2NA2 A;  4R2P A;  1T39 A;  1NCS A;  2LMZ A;  2D9H A;  1YYO A;  2E1M A;  4DUZ E;  1GQE A;  1EKZ A;  2V85 A;  2B7V A;  4YY3 E;  4DR3 E;  4O24 A;  1JK1 A;  1N3G A;  2L92 A;  2EMY A;  2YU5 A;  3HXL A;  3JAM C;  5IXM B;  2I13 A;  1LLM C;  1ZBQ A;  3EPK A;  1ZBT A;  2V89 A;  2WZO A;  1ZAA C;  2L3J A;  4R2Q A;  2HJJ A;  2B3T B;  4X65 E;  1IBK E;  2UXB E;  1T4N A;  2MKD A;  1ZU1 A;  2VQE E;  1HNW E;  2V86 A;  5LLQ A;  3C6K A;  5KL5 A;  5A2Q C;  5KL2 A;  1X49 A;  3KWR A;  2YRM A;  2RSM A;  4B3T E;  3ADL A;  3IWC A;  2NUE A;  2LV2 A;  5FLX C;  1YPN A;  5AE3 A;  2LJH A;  4WSG A;  3BBG A;  2EMF A;  4DV5 E;  2CPN A;  1A1G A;  2EM5 A;  2JWO A;  4KHP E;  5LL6 R;  2MDG A;  4BC7 A;  2EN3 A;  2UXC E;  4LFC E;  1X6E A;  1EH8 A;  4GZN C;  4ZYE A;  2FGG A;  4MLQ A;  1RMD A;  2YTP A;  4FK5 C;  2M4I A;  4R8O A;  2FTX B;  1RQ0 A;  2EM0 A;  3HPS A;  1ZR9 A;  2EOJ A;  2YRK A;  2ODR D;  1A1F A;  3THO B;  5ADZ A;  5DNY A;  4Q28 A;  4BCA A;  2EMX A;  2EMZ A;  4P7D A;  3ECR A;  4DR2 E;  4X64 E;  2L8T A;  3J7Y p;  4JI0 E;  3HPZ A;  1YZ9 A;  2VE7 C;  4WFT A;  4F2J C;  4BMJ A;  1PKP A;  4DV6 E;  1IMU A;  2LBS B;  1TF6 A;  1WJP A;  4LFB E;  2EN2 A;  1XNQ E;  3HTX A;  2EOY A;  2EPZ A;  4DKK A;  2ENC A;  3F6G A;  1TF3 A;  2EM9 A;  1A1H A;  2DSY A;  2GPI A;  5BR8 E;  4WXC A;  4NXM E;  4X62 E;  2YTF A;  1IQS A;  5A6A A;  1JK2 A;  2K4V A;  2WCC 3;  2ENH A;  5AE1 A;  4LF6 E;  2EN4 A;  2F8B A;  3F6H A;  2EOX A;  2ODR C;  2NUF A;  3C4T A;  1DGC A;  2DRP A;  2V87 A;  1T4L B;  2MKN A;  3J7A G;  2IHR 1;  4X66 E;  1XMO E;  2CT1 A;  1N34 E;  4DV4 E;  4M0V A;  3JTZ A;  1O0W A;  3BID A;  1WXR A;  2EPU A;  5IT9 C;  2EN1 A;  1X6H A;  2WBU A;  1UBD C;  4B3M E;  2EPR A;  2G7H A;  4P78 A;  5LMN E;  1UIL A;  4F9C B;  1P47 A;  1X3C A;  1IBM E;  4HTG A;  1A1L A;  4LTY A;  4Q35 B;  4DV7 E;  4ZYD A;  1L4S A;  1RC7 A;  2DMY A;  2M1S A;  2LVH A;  4R03 A;  2LUP B;  1KJK A;  2EMB A;  1SR9 A;  3OTO E;  1J26 A;  2MDR A;  2EL4 A;  2KHX A;  5AE2 A;  1B69 A;  3ADJ A;  2E72 A;  1A1I A;  2LO3 A;  2ELY A;  3BGH A;  4M30 A;  2EM7 A;  4R2A A;  2YWQ A;  2UUA E;  4O43 A;  2HGH A;  2EM2 A;  4DV3 E;  1J5E E;  2JPA A;  3EPL A;  2L3C A;  4F9B B;  4BHC A;  2EOH A;  2N3G A;  5KL4 A;  4F54 A;  2EOR A;  1YUI A;  4ZYG A;  4X9J A;  5A69 A;  2UU9 E;  2N3H A;  4F9A B;  3RMP A;  1UN6 B;  2BBG A;  4JI5 E;  2LCE A;  4JV5 E;  5KL7 A;  2EQ0 A;  2FV4 B;  2NAB A;  2EPX A;  3MHH C;  2YTJ A;  4LF5 E;  3VYX A;  1BBO A;  2H36 X;  1YSA C;  2YU8 A;  2R1F A;  2DB2 A;  2EL6 A;  3KZY A;  1N36 E;  4R2E A;  2MC6 A;  2BB8 A;  2L2N A;  2ELZ A;  2EOS A;  2EOI A;  4DV0 E;  2EM4 A;  2EML A;  3MHS C;  2ZM6 E;  4IJD A;  2LJU A;  1STU A;  1F2I G;  2K7I A;  2EOO A;  4JI2 E;  1FJG E;  4JYA E;  4NXN E;  3IWD A;  2KON A;  2VF1 A;  2EOE A;  1X6F A;  2V8Q B;  4DV2 E;  4WPY A;  3ADI A;  2EP3 A;  3BF2 A;  4OX9 E;  4BBY A;  5A6B D;  2YTN A;  3EPJ A;  1YYW A;  4BC9 A;  2RS7 A;  3TQM A;  4JI3 E;  4K0K E;  1FKA E;  4MLV A;  4DR4 E;  2M9A A;  4L8N A;  5AC5 A;  4LF8 E;  1Z1B A;  3T1Y E;  4DR1 E;  2GHF A;  4M2Z A;  2KOU A;  2YTI A;  5LMU E;  2EPA A;  2J7J A;  3IWB A;  4JI1 E;  4L5N C;  4KZS A;  2ENA A;  2YSO A;  5KL6 A;  5A6K A;  2JYA A;  2LTR A;  3K6Q A;  4B3R E;  4R2S A;  4GKJ E;  4LF7 E;  4GEQ B;  1BBG A;  2EPN A;  1I94 E;  4NZV A;  3T1H E;  2EJ4 A;  2LTS A;  4HEI A;  3ADG A;  1YYK A;  1YUJ A;  2EOM A;  2A25 A;  1AH5 A;  1IQO A;  2EQ1 A;  1GZ6 A;  4LU9 A;  5CFF E;  3C6M A;  4WYQ B;  1QU6 A;  1X48 A;  2EOF A;  2M7Q A;  1XNR E;  4WXD A;  3ZOQ B;  4IS1 C;  3C4B A;  1DI2 A;  1N33 E;  5A6B A;  4DV1 E;  2EMC A;  2HHH E;  2YRH A;  2YTD A;  1GTK A;  1QNT A;  2DLQ A;  2GLI A;  4B3S E;  1X5W A;  2EWL A;  3EQ1 A;  4DR6 E;  2JOX A;  4R2C A;  5A6J A;  1SFE A;  4DR5 E;  3DJW A;  2YTO A;  2DGC A;  1DQ3 A;  4NHR A;  2DIX A;  2EMG A;  2JY9 A;  4O5G A;  2WBT A;  2YZT A;  2EN7 A;  4JI8 E;  2JP9 A;  1A1K A;  5AAS A;  2RSI A;  2EMH A;  4F6M A;  5F3W A;  1T38 A;  3OML A;  2EMI A;  4R2R A;  2EPC A;  5IWA E;  2B9D A;  2CTD A;  3J81 C;  3HQ1 A;  2YSP A;  1KYQ A;  1HNX E;  2B7T A;  2DMI A;  3M99 B;  3LLH A;  1UHZ A;  3VK6 A;  2JOB A;  1TN9 A;  3EPH A;  5TSE A;  4KWY A;  2L2M A;  2I9I A;  4LFA E;  5AC4 A;  3DF6 A;  3THN A;  2EPL X;  2NUG A;  2EPO A;  2Q8U A;  2MC5 A;  4LF4 E;  4RH8 A;  4WX9 A;  4AQY E;  1PJT A;  5KL3 A;  4GKK E; 
#chains in the Genus database with same CATH homology
 1X6H A;  2WBU A;  1UBD C;  2MKD A;  1Z1B A;  1ZU1 A;  2EPR A;  2GHF A;  2YTI A;  5KL5 A;  2EPP A;  2EPA A;  2J7J A;  2CSH A;  5KL2 A;  2YRM A;  1P47 A;  1X3C A;  2ENA A;  1BB8 A;  2EMK A;  1MEY C;  2YSO A;  5KL6 A;  1A1L A;  2LV2 A;  4WSG A;  2EMF A;  4R2S A;  1A1G A;  2YTQ A;  2LVH A;  1KJK A;  2EE8 A;  2EJ4 A;  2EMB A;  1YUJ A;  2EL4 A;  2EOM A;  2A25 A;  1B69 A;  2E72 A;  2EM5 A;  2EQ1 A;  1A1I A;  2LO3 A;  2YTE A;  2ELY A;  2EMA A;  2MDG A;  2EN3 A;  2EOF A;  4R2D A;  2EM7 A;  4R2A A;  4IS1 C;  2RPC A;  1X6E A;  2HGH A;  2EM2 A;  2JPA A;  2DLK A;  3EPL A;  4GZN C;  4M9V C;  2EOZ A;  2EOH A;  2EMC A;  2VRD A;  1RMD A;  2YRH A;  2YTD A;  2YTP A;  2DLQ A;  2GLI A;  4FK5 C;  5KL4 A;  2EM6 A;  1A1J A;  2EOR A;  1X5W A;  1YUI A;  2EM0 A;  2EMW A;  4X9J A;  2EN6 A;  1ZR9 A;  2EOJ A;  2YRK A;  4R2C A;  1A1F A;  1UN6 B;  2LCE A;  5KL7 A;  2EQ0 A;  2NAB A;  2EPX A;  3MHH C;  2YTJ A;  2PRT A;  2EMX A;  1G2D C;  2EMZ A;  2WBS A;  1BBO A;  2YTO A;  2DGC A;  4F6N A;  2ADR A;  1YSA C;  2YU8 A;  2EQ3 A;  2R1F A;  2EMG A;  4F2J C;  2EL6 A;  2EM3 A;  2EOQ A;  2WBT A;  2YTG A;  4R2E A;  2EN7 A;  2JP9 A;  1A1K A;  2RSI A;  2EN8 A;  1WJP A;  1TF6 A;  2EN2 A;  2BB8 A;  1G2F C;  2EMH A;  4F6M A;  2ELZ A;  2EOS A;  2EOI A;  2EM4 A;  2EOY A;  2EMI A;  3VHT B;  2EML A;  4R2R A;  3MHS C;  2LT7 A;  2EPC A;  2EPZ A;  2ENC A;  4IJD A;  1F2I G;  2CTD A;  2YSP A;  2EM9 A;  2EL5 A;  2EM8 A;  2EOO A;  1A1H A;  1TF3 A;  3UK3 C;  2DMI A;  1AAY A;  3M99 B;  1TN9 A;  4R2P A;  3EPH A;  2YTF A;  2EOE A;  1JK2 A;  1NCS A;  2WCC 3;  2D9H A;  1X6F A;  2ENH A;  2EN4 A;  2EOX A;  2EP3 A;  1DGC A;  2DRP A;  1JK1 A;  2MKN A;  2YTN A;  2EMY A;  2YU5 A;  3EPJ A;  2I13 A;  2CT1 A;  1LLM C;  3EPK A;  1ZAA C;  4R2Q A;  2EPU A;  2M9A A;  5KL3 A;  2EN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...