4R2PA

Wilms tumor protein (wt1) zinc fingers in complex with hydroxymethylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2pA00
2EPCA 2YTOA 4R2EA 2EP3A 1X5WA 4FK5C 2YRHA 2VRDA 2DLQA 4M9VC 1NCSA 2EMCA 4R2AA 1JK2A 2ELYA 1B69A 2MKNA 1WJPA 2EPXA 2HGHA 2GHFA 1A1LA 2EJ4A 4X9JA 2YU5A 2JPAA 2YU8A 2EE8A 2EL5A 2EMXA 2EOZA 2EOSA 2EM5A 1TF3A 2ENAA 2EQ1A 1X3CA 2ENHA 2LT7A 2EMIA 2EOQA 4GZNC 3MHSC 2LVHA 1P47A 4R2DA 1YSAC 2EOOA 1BB8A 3EPLA 5KL6A 2EMZA 3EPKA 2YTJA 2JP9A 5KL5A 2EM0A 1TN9A 2EQ0A 2EM2A 2YSPA 4R2QA 2YTEA 5KL2A 1BBOA 2CSHA 2A25A 2EN2A 2YSOA 5KL7A 2EMAA 2YTGA 3UK3C 2EMWA 2M9AA 1UN6B 4R2PA 2WCC3 1Z1BA 2DRPA 1X6FA 1A1KA 2DMIA 2YRKA 1ZU1A 2YTPA 2EPUA 2LV2A 1KJKA 1G2DC 4R2CA 2EPZA 2YTDA 2WBSA 2PRTA 2CT1A 2ELZA 2YTIA 1A1HA 2EN7A 2EOYA 2CTDA 2EOHA 2EOFA 4WSGA 2EM7A 5KL4A 1G2FC 1TF6A 3EPHA 2WBTA 2LO3A 2EM9A 2EM6A 2RSIA 2EOEA 1A1IA 1A1JA 1JK1A 4F6MA 1X6EA 1A1FA 1X6HA 2YRMA 4R2SA 4IS1C 2R1FA 2EMYA 2LCEA 2EL4A 2EN8A 2E72A 2ADRA 2J7JA 3EPJA 2YTNA 2DLKA 2EPPA 2EOMA 2EMFA 3MHHC 2ENCA 2BB8A 2MKDA 2EMKA 2RPCA 1YUJA 2GLIA 4F2JC 3M99B 2YTFA 5KL3A 2EPAA 2EOJA 2EN3A 4F6NA 2EM4A 2EM8A 2I13A 1F2IG 2WBUA 2D9HA 1AAYA 1MEYC 2EM3A 2MDGA 3VHTB 4R2RA 1ZR9A 2EORA 2EMLA 2EOIA 2DGCA 2YTQA 1RMDA 2EOXA 2EQ3A 2NABA 1LLMC 1DGCA 1ZAAC 2EN1A 1A1GA 1UBDC 2EN6A 2EMHA 2EMBA 2EL6A 2EN4A 2EPRA 1YUIA 2EMGA 4IJDA
chains in the Genus database with same CATH superfamily
2YPNA 4ZYGA 1J26A 2EPMX 3AUZA 5AE3A 4FK5C 2YRHA 4M9VC 1JK2A 2ELYA 4L8NA 1B69A 1WJPA 3QG5C 4F54A 5ADZA 2EJ4A 2LUQA 4I8OA 1DQ3A 2EE8A 2RQLA 3ADGA 2UUBE 3P1XA 2ZM6E 2BBGA 3JU0A 2EM5A 1TF3A 1X3CA 2LT7A 4GZNC 4R2DA 5DNYA 2YWQA 5A2QC 3EPLA 4DUYE 5CFFE 1AH5A 4R03A 3MSWA 1X47A 2WZOA 1TN9A 1ZBQA 4BCAA 2L8TA 1DI2A 5KL2A 4RHBB 2A25A 5KL7A 2YSOA 3HXLA 2EMAA 3UK3C 2HC5A 2DSYA 4R2PA 3VYXA 2DMIA 2FGGA 2F4VE 5FLXC 2L2NA 1G2DC 4R2CA 3BF2A 2LMZA 4LF6E 2UXDE 2ELZA 4LFCE 2EN7A 2EPKX 2EOYA 2EOHA 3K6QA 3J7AG 2EM9A 4YY3E 4DR1E 2EOEA 4WX9A 2Q8UA 1O0WA 2M4IA 3BGHA 1X6HA 2YRMA 4R2SA 2V83A 2E72A 4YHHE 1GTKA 2J7JA 5T6JA 2EPPA 2EOMA 2EMFA 4Q35B 5IT9C 4BHBA 2VF1A 2MKDA 2V88A 1HNZE 2YZTA 1T4OA 5TSEA 4LF5E 2YTFA 2JOBA 1EH8A 4DKKA 4F6NA 4HEIA 1YYWA 2WBUA 2D9HA 4JI7E 4F9CB 2EORA 4DV4E 4WYQB 1EKZA 5AC5A 4M0VA 5A69A 2EOXA 2L2KB 4LFBE 4X62E 3VK6A 2V85A 4O5GA 4DUZE 5IV8B 1HR0E 4GKKE 2YTIA 3KZYA 4Q28A 5F3WA 4R2EA 1QU6A 1X5WA 1WXRA 3HPSA 3OMLA 3KZZA 2EPXA 3C4BA 2JOXA 2GHFA 2FTXB 2YU5A 2LJUA 4DV5E 2EL5A 4LU9A 2L33A 1EH7A 2EOSA 2RSMA 1IMUA 1WRJA 2EMIA 2EOQA 2V86A 2B7TA 4LF9E 4WXCA 2EOOA 5KL6A 3VYYA 4N4RB 1IBKE 5KL5A 4DV0E 2JR1A 4B3ME 4KHPE 2EM2A 2N3HA 4X64E 1XMOE 2YSPA 5LLQA 3OTOE 1UN6B 2WCC3 2R76A 3AV0A 5IXMB 2DRPA 4K0KE 1IQOA 2LV2A 2LTRA 2VE7C 3H09A 2EPZA 2YTDA 1WHQA 1A1HA 2JXPA 3LMLA 2CTDA 2EOFA 4WSGA 4BMJA 2WBTA 1KYQA 1A1IA 1A1JA 2ODRC 4DR5E 2UUAE 4F6MA 1A1FA 3ADLA 2JWOA 2ADRA 3EPJA 5AASA 3MHHC 1RC7A 4X66E 2EMKA 4F9BB 2RS6A 2NUGA 4JV5E 1FJGE 5A6JA 4JI4E 5KL3A 4DR2E 2EPAA 2EOJA 1PJQA 5BR8E 4MLQA 1PKPA 3TQMA 1F2IG 5A6KA 2VQFE 1AAYA 1MEYC 2EM3A 3F6HA 3VHTB 1YFHA 2DIXA 4ZYEA 3ADJA 1PDAA 2DMYA 2DGCA 1HNWE 1RMDA 2EQ3A 2NABA 2KHXA 2EN1A 1FKAE 2EN6A 2V89A 2EMHA 1SR9A 1XNQE 2EPRA 4M30A 4BC9A 4AQYE 2UU9E 2YTOA 4JI5E 1GZ6A 1X48A 2EMCA 2MKNA 1UHZA 4BBYA 4WSPA 2EZ6A 3ECRA 2JPAA 2YU8A 1PJSA 2F8BA 1L4SA 2EMXA 3LLHA 2IHR1 3RMPA 3JAMC 2LTSA 2HJJA 2LVHA 1P47A 4OX9E 3L00A 1XMQE 1BB8A 2ODRD 1YYOA 3IWBA 4O43A 3C6KA 2JP9A 2L2MA 1N33E 4O4KA 2EM0A 4BC7A 1RQ0A 1N36E 3T1YE 4JI2E 2B9DA 2EQ0A 4B3SE 3ADIA 4R2QA 2YTEA 1IBME 1J5EE 2JYAA 1YPNA 2YTGA 3DJWA 5LL6R 4LF7E 4KWYA 1IQSA 1BBGA 4WXDA 2LE2A 4JI6E 4HTGA 1X6FA 1A1KA 4NXNE 2V87A 1YYKA 1UILA 2YRKA 4NZVA 2YT4A 1NEIA 4O24A 3EQ1A 1N34E 1EH6A 1YZ9A 4NXME 1TF6A 1G2FC 3F6GA 2DB2A 2LO3A 2MC5A 5LMUE 4J8ZA 4JI0E 4GEQB 2EM6A 2LRSA 3C6MA 1X6EA 4IS1C 4L5NC 2G7HA 2EMYA 4P7DA 2LCEA 2EL4A 2EN8A 2H36X 1GQEA 4DV6E 2B3TB 4NHRA 2ENCA 5LMNE 2BB8A 2RPCA 4MLVA 1YUJA 2GLIA 3J7Yp 4F2JC 4DMIA 2EWLA 2NUFA 3J81C 3T1HE 4ZYDA 3THOB 2NUEA 2E5LE 2I13A 2KOUA 2B7VA 2MDGA 3DF6A 5AE2A 2KONA 4R8OA 1ZR9A 2M7QA 4JI1E 2EMLA 2EOIA 2V8QB 1N32E 4P78A 2YTQA 1DGCA 1ZAAC 3JTZA 1A1GA 2L6MA 2EL6A 2K4VA 2EN4A 3HPZA 2EMGA 4LTYA 2EPCA 2EPNA 2EP3A 3IWDA 2VRDA 2DLQA 1NCSA 4R2AA 4JI8E 2HGHA 1HNXE 1A1LA 2L3JA 4X9JA 2LUPB 4M2ZA 2UXBE 2EOZA 4DR7E 2ENAA 2EQ1A 2ENHA 3THNA 3FIGA 3MHSC 2N8XA 3C4TA 1YSAC 2VQEE 2EMZA 3BBGA 3EPKA 2YTJA 2HHHE 4B3RE 3J80C 4JI3E 2EPOA 1SFEA 3HTXA 1MGTA 1T4NA 4WPYA 4DV3E 4TUIA 1BBOA 2CSHA 5IWAE 4WFTA 1QNTA 1STUA 2EN2A 2K7IA 4DR4E 3HQ1A 2EMWA 2M9AA 4ZYHA 2JVAA 2L92A 4X8WA 2L3CA 1X49A 1Z1BA 5A6BD 2RTXA 1ZU1A 2N3GA 2YTPA 2LBSB 2EPUA 5A6BA 1KJKA 2JY9A 4DV7E 2WBSA 2RS7A 2CT1A 2PRTA 4OOGC 5AC4A 4LF4E 4DR6E 1WHNA 5KL4A 2EM7A 4DV2E 3EPHA 4JYAE 3BIDA 2RSIA 4F9AB 4RH8A 1JK1A 5AE1A 1T38A 2R1FA 1N3GA 1PJTA 4BS9A 4TUGA 5A6AA 2YTNA 2DLKA 2LJHA 4LFAE 2UUCE 4GKJE 2EPLX 2UXCE 1IBLE 2FV4B 3M99B 2E1MA 2MDRA 1T39A 2EN3A 2EM4A 4B3TE 2EM8A 3IWCA 2I9IA 2M1SA 4R2RA 2GPIA 3KWRA 4LF8E 4DR3E 1I94E 4X65E 1T4LB 1ZBTA 2MC6A 1LLMC 4KZSA 1UBDC 3ZOQB 2EMBA 2CPNA 2NA2A 1XNRE 1YUIA 4DV1E 4IJDA 4BHCA
chains in the Genus database with same CATH topology
2EPCA 2YTOA 4R2EA 2EP3A 1X5WA 4FK5C 2YRHA 2VRDA 2DLQA 4M9VC 1NCSA 2EMCA 4R2AA 1JK2A 2ELYA 1B69A 2MKNA 1WJPA 2EPXA 2HGHA 2GHFA 1A1LA 2EJ4A 4X9JA 2YU5A 2JPAA 2YU8A 2EE8A 2EL5A 2EMXA 2EOZA 2EOSA 2EM5A 1TF3A 2ENAA 2EQ1A 1X3CA 2ENHA 2LT7A 2EMIA 2EOQA 4GZNC 3MHSC 2LVHA 1P47A 4R2DA 1YSAC 2EOOA 1BB8A 3EPLA 5KL6A 2EMZA 3EPKA 2YTJA 2JP9A 5KL5A 2EM0A 1TN9A 2EQ0A 2EM2A 2YSPA 4R2QA 2YTEA 5KL2A 1BBOA 2CSHA 2A25A 2EN2A 2YSOA 5KL7A 2EMAA 2YTGA 3UK3C 2EMWA 2M9AA 1UN6B 4R2PA 2WCC3 1Z1BA 2DRPA 1X6FA 1A1KA 2DMIA 2YRKA 1ZU1A 2YTPA 2EPUA 2LV2A 1KJKA 1G2DC 4R2CA 2EPZA 2YTDA 2WBSA 2PRTA 2CT1A 2ELZA 2YTIA 1A1HA 2EN7A 2EOYA 2CTDA 2EOHA 2EOFA 4WSGA 2EM7A 5KL4A 1G2FC 1TF6A 3EPHA 2WBTA 2LO3A 2EM9A 2EM6A 2RSIA 2EOEA 1A1IA 1A1JA 1JK1A 4F6MA 1X6EA 1A1FA 1X6HA 2YRMA 4R2SA 4IS1C 2R1FA 2EMYA 2LCEA 2EL4A 2EN8A 2E72A 2ADRA 2J7JA 3EPJA 2YTNA 2DLKA 2EPPA 2EOMA 2EMFA 3MHHC 2ENCA 2BB8A 2MKDA 2EMKA 2RPCA 1YUJA 2GLIA 4F2JC 3M99B 2YTFA 5KL3A 2EPAA 2EOJA 2EN3A 4F6NA 2EM4A 2EM8A 2I13A 1F2IG 2WBUA 2D9HA 1AAYA 1MEYC 2EM3A 2MDGA 3VHTB 4R2RA 1ZR9A 2EORA 2EMLA 2EOIA 2DGCA 2YTQA 1RMDA 2EOXA 2EQ3A 2NABA 1LLMC 1DGCA 1ZAAC 2EN1A 1A1GA 1UBDC 2EN6A 2EMHA 2EMBA 2EL6A 2EN4A 2EPRA 1YUIA 2EMGA 4IJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPC A;  2YTO A;  4R2E A;  2EP3 A;  1X5W A;  4FK5 C;  2YRH A;  2VRD A;  2DLQ A;  4M9V C;  1NCS A;  2EMC A;  4R2A A;  1JK2 A;  2ELY A;  1B69 A;  2MKN A;  1WJP A;  2EPX A;  2HGH A;  2GHF A;  1A1L A;  2EJ4 A;  4X9J A;  2YU5 A;  2JPA A;  2YU8 A;  2EE8 A;  2EL5 A;  2EMX A;  2EOZ A;  2EOS A;  2EM5 A;  1TF3 A;  2ENA A;  2EQ1 A;  1X3C A;  2ENH A;  2LT7 A;  2EMI A;  2EOQ A;  4GZN C;  3MHS C;  2LVH A;  1P47 A;  4R2D A;  1YSA C;  2EOO A;  1BB8 A;  3EPL A;  5KL6 A;  2EMZ A;  3EPK A;  2YTJ A;  2JP9 A;  5KL5 A;  2EM0 A;  1TN9 A;  2EQ0 A;  2EM2 A;  2YSP A;  4R2Q A;  2YTE A;  5KL2 A;  1BBO A;  2CSH A;  2A25 A;  2EN2 A;  2YSO A;  5KL7 A;  2EMA A;  2YTG A;  3UK3 C;  2EMW A;  2M9A A;  1UN6 B;  4R2P A;  2WCC 3;  1Z1B A;  2DRP A;  1X6F A;  1A1K A;  2DMI A;  2YRK A;  1ZU1 A;  2YTP A;  2EPU A;  2LV2 A;  1KJK A;  1G2D C;  4R2C A;  2EPZ A;  2YTD A;  2WBS A;  2PRT A;  2CT1 A;  2ELZ A;  2YTI A;  1A1H A;  2EN7 A;  2EOY A;  2CTD A;  2EOH A;  2EOF A;  4WSG A;  2EM7 A;  5KL4 A;  1G2F C;  1TF6 A;  3EPH A;  2WBT A;  2LO3 A;  2EM9 A;  2EM6 A;  2RSI A;  2EOE A;  1A1I A;  1A1J A;  1JK1 A;  4F6M A;  1X6E A;  1A1F A;  1X6H A;  2YRM A;  4R2S A;  4IS1 C;  2R1F A;  2EMY A;  2LCE A;  2EL4 A;  2EN8 A;  2E72 A;  2ADR A;  2J7J A;  3EPJ A;  2YTN A;  2DLK A;  2EPP A;  2EOM A;  2EMF A;  3MHH C;  2ENC A;  2BB8 A;  2MKD A;  2EMK A;  2RPC A;  1YUJ A;  2GLI A;  4F2J C;  3M99 B;  2YTF A;  5KL3 A;  2EPA A;  2EOJ A;  2EN3 A;  4F6N A;  2EM4 A;  2EM8 A;  2I13 A;  1F2I G;  2WBU A;  2D9H A;  1AAY A;  1MEY C;  2EM3 A;  2MDG A;  3VHT B;  4R2R A;  1ZR9 A;  2EOR A;  2EML A;  2EOI A;  2DGC A;  2YTQ A;  1RMD A;  2EOX A;  2EQ3 A;  2NAB A;  1LLM C;  1DGC A;  1ZAA C;  2EN1 A;  1A1G A;  1UBD C;  2EN6 A;  2EMH A;  2EMB A;  2EL6 A;  2EN4 A;  2EPR A;  1YUI A;  2EMG A;  4IJD A; 
#chains in the Genus database with same CATH topology
 2YPN A;  4ZYG A;  1J26 A;  2EPM X;  3AUZ A;  5AE3 A;  4FK5 C;  2YRH A;  4M9V C;  1JK2 A;  2ELY A;  4L8N A;  1B69 A;  1WJP A;  3QG5 C;  4F54 A;  5ADZ A;  2EJ4 A;  2LUQ A;  4I8O A;  1DQ3 A;  2EE8 A;  2RQL A;  3ADG A;  2UUB E;  3P1X A;  2ZM6 E;  2BBG A;  3JU0 A;  2EM5 A;  1TF3 A;  1X3C A;  2LT7 A;  4GZN C;  4R2D A;  5DNY A;  2YWQ A;  5A2Q C;  3EPL A;  4DUY E;  5CFF E;  1AH5 A;  4R03 A;  3MSW A;  1X47 A;  2WZO A;  1TN9 A;  1ZBQ A;  4BCA A;  2L8T A;  1DI2 A;  5KL2 A;  4RHB B;  2A25 A;  5KL7 A;  2YSO A;  3HXL A;  2EMA A;  3UK3 C;  2HC5 A;  2DSY A;  4R2P A;  3VYX A;  2DMI A;  2FGG A;  2F4V E;  5FLX C;  2L2N A;  1G2D C;  4R2C A;  3BF2 A;  2LMZ A;  4LF6 E;  2UXD E;  2ELZ A;  4LFC E;  2EN7 A;  2EPK X;  2EOY A;  2EOH A;  3K6Q A;  3J7A G;  2EM9 A;  4YY3 E;  4DR1 E;  2EOE A;  4WX9 A;  2Q8U A;  1O0W A;  2M4I A;  3BGH A;  1X6H A;  2YRM A;  4R2S A;  2V83 A;  2E72 A;  4YHH E;  1GTK A;  2J7J A;  5T6J A;  2EPP A;  2EOM A;  2EMF A;  4Q35 B;  5IT9 C;  4BHB A;  2VF1 A;  2MKD A;  2V88 A;  1HNZ E;  2YZT A;  1T4O A;  5TSE A;  4LF5 E;  2YTF A;  2JOB A;  1EH8 A;  4DKK A;  4F6N A;  4HEI A;  1YYW A;  2WBU A;  2D9H A;  4JI7 E;  4F9C B;  2EOR A;  4DV4 E;  4WYQ B;  1EKZ A;  5AC5 A;  4M0V A;  5A69 A;  2EOX A;  2L2K B;  4LFB E;  4X62 E;  3VK6 A;  2V85 A;  4O5G A;  4DUZ E;  5IV8 B;  1HR0 E;  4GKK E;  2YTI A;  3KZY A;  4Q28 A;  5F3W A;  4R2E A;  1QU6 A;  1X5W A;  1WXR A;  3HPS A;  3OML A;  3KZZ A;  2EPX A;  3C4B A;  2JOX A;  2GHF A;  2FTX B;  2YU5 A;  2LJU A;  4DV5 E;  2EL5 A;  4LU9 A;  2L33 A;  1EH7 A;  2EOS A;  2RSM A;  1IMU A;  1WRJ A;  2EMI A;  2EOQ A;  2V86 A;  2B7T A;  4LF9 E;  4WXC A;  2EOO A;  5KL6 A;  3VYY A;  4N4R B;  1IBK E;  5KL5 A;  4DV0 E;  2JR1 A;  4B3M E;  4KHP E;  2EM2 A;  2N3H A;  4X64 E;  1XMO E;  2YSP A;  5LLQ A;  3OTO E;  1UN6 B;  2WCC 3;  2R76 A;  3AV0 A;  5IXM B;  2DRP A;  4K0K E;  1IQO A;  2LV2 A;  2LTR A;  2VE7 C;  3H09 A;  2EPZ A;  2YTD A;  1WHQ A;  1A1H A;  2JXP A;  3LML A;  2CTD A;  2EOF A;  4WSG A;  4BMJ A;  2WBT A;  1KYQ A;  1A1I A;  1A1J A;  2ODR C;  4DR5 E;  2UUA E;  4F6M A;  1A1F A;  3ADL A;  2JWO A;  2ADR A;  3EPJ A;  5AAS A;  3MHH C;  1RC7 A;  4X66 E;  2EMK A;  4F9B B;  2RS6 A;  2NUG A;  4JV5 E;  1FJG E;  5A6J A;  4JI4 E;  5KL3 A;  4DR2 E;  2EPA A;  2EOJ A;  1PJQ A;  5BR8 E;  4MLQ A;  1PKP A;  3TQM A;  1F2I G;  5A6K A;  2VQF E;  1AAY A;  1MEY C;  2EM3 A;  3F6H A;  3VHT B;  1YFH A;  2DIX A;  4ZYE A;  3ADJ A;  1PDA A;  2DMY A;  2DGC A;  1HNW E;  1RMD A;  2EQ3 A;  2NAB A;  2KHX A;  2EN1 A;  1FKA E;  2EN6 A;  2V89 A;  2EMH A;  1SR9 A;  1XNQ E;  2EPR A;  4M30 A;  4BC9 A;  4AQY E;  2UU9 E;  2YTO A;  4JI5 E;  1GZ6 A;  1X48 A;  2EMC A;  2MKN A;  1UHZ A;  4BBY A;  4WSP A;  2EZ6 A;  3ECR A;  2JPA A;  2YU8 A;  1PJS A;  2F8B A;  1L4S A;  2EMX A;  3LLH A;  2IHR 1;  3RMP A;  3JAM C;  2LTS A;  2HJJ A;  2LVH A;  1P47 A;  4OX9 E;  3L00 A;  1XMQ E;  1BB8 A;  2ODR D;  1YYO A;  3IWB A;  4O43 A;  3C6K A;  2JP9 A;  2L2M A;  1N33 E;  4O4K A;  2EM0 A;  4BC7 A;  1RQ0 A;  1N36 E;  3T1Y E;  4JI2 E;  2B9D A;  2EQ0 A;  4B3S E;  3ADI A;  4R2Q A;  2YTE A;  1IBM E;  1J5E E;  2JYA A;  1YPN A;  2YTG A;  3DJW A;  5LL6 R;  4LF7 E;  4KWY A;  1IQS A;  1BBG A;  4WXD A;  2LE2 A;  4JI6 E;  4HTG A;  1X6F A;  1A1K A;  4NXN E;  2V87 A;  1YYK A;  1UIL A;  2YRK A;  4NZV A;  2YT4 A;  1NEI A;  4O24 A;  3EQ1 A;  1N34 E;  1EH6 A;  1YZ9 A;  4NXM E;  1TF6 A;  1G2F C;  3F6G A;  2DB2 A;  2LO3 A;  2MC5 A;  5LMU E;  4J8Z A;  4JI0 E;  4GEQ B;  2EM6 A;  2LRS A;  3C6M A;  1X6E A;  4IS1 C;  4L5N C;  2G7H A;  2EMY A;  4P7D A;  2LCE A;  2EL4 A;  2EN8 A;  2H36 X;  1GQE A;  4DV6 E;  2B3T B;  4NHR A;  2ENC A;  5LMN E;  2BB8 A;  2RPC A;  4MLV A;  1YUJ A;  2GLI A;  3J7Y p;  4F2J C;  4DMI A;  2EWL A;  2NUF A;  3J81 C;  3T1H E;  4ZYD A;  3THO B;  2NUE A;  2E5L E;  2I13 A;  2KOU A;  2B7V A;  2MDG A;  3DF6 A;  5AE2 A;  2KON A;  4R8O A;  1ZR9 A;  2M7Q A;  4JI1 E;  2EML A;  2EOI A;  2V8Q B;  1N32 E;  4P78 A;  2YTQ A;  1DGC A;  1ZAA C;  3JTZ A;  1A1G A;  2L6M A;  2EL6 A;  2K4V A;  2EN4 A;  3HPZ A;  2EMG A;  4LTY A;  2EPC A;  2EPN A;  2EP3 A;  3IWD A;  2VRD A;  2DLQ A;  1NCS A;  4R2A A;  4JI8 E;  2HGH A;  1HNX E;  1A1L A;  2L3J A;  4X9J A;  2LUP B;  4M2Z A;  2UXB E;  2EOZ A;  4DR7 E;  2ENA A;  2EQ1 A;  2ENH A;  3THN A;  3FIG A;  3MHS C;  2N8X A;  3C4T A;  1YSA C;  2VQE E;  2EMZ A;  3BBG A;  3EPK A;  2YTJ A;  2HHH E;  4B3R E;  3J80 C;  4JI3 E;  2EPO A;  1SFE A;  3HTX A;  1MGT A;  1T4N A;  4WPY A;  4DV3 E;  4TUI A;  1BBO A;  2CSH A;  5IWA E;  4WFT A;  1QNT A;  1STU A;  2EN2 A;  2K7I A;  4DR4 E;  3HQ1 A;  2EMW A;  2M9A A;  4ZYH A;  2JVA A;  2L92 A;  4X8W A;  2L3C A;  1X49 A;  1Z1B A;  5A6B D;  2RTX A;  1ZU1 A;  2N3G A;  2YTP A;  2LBS B;  2EPU A;  5A6B A;  1KJK A;  2JY9 A;  4DV7 E;  2WBS A;  2RS7 A;  2CT1 A;  2PRT A;  4OOG C;  5AC4 A;  4LF4 E;  4DR6 E;  1WHN A;  5KL4 A;  2EM7 A;  4DV2 E;  3EPH A;  4JYA E;  3BID A;  2RSI A;  4F9A B;  4RH8 A;  1JK1 A;  5AE1 A;  1T38 A;  2R1F A;  1N3G A;  1PJT A;  4BS9 A;  4TUG A;  5A6A A;  2YTN A;  2DLK A;  2LJH A;  4LFA E;  2UUC E;  4GKJ E;  2EPL X;  2UXC E;  1IBL E;  2FV4 B;  3M99 B;  2E1M A;  2MDR A;  1T39 A;  2EN3 A;  2EM4 A;  4B3T E;  2EM8 A;  3IWC A;  2I9I A;  2M1S A;  4R2R A;  2GPI A;  3KWR A;  4LF8 E;  4DR3 E;  1I94 E;  4X65 E;  1T4L B;  1ZBT A;  2MC6 A;  1LLM C;  4KZS A;  1UBD C;  3ZOQ B;  2EMB A;  2CPN A;  2NA2 A;  1XNR E;  1YUI A;  4DV1 E;  4IJD A;  4BHC A; 
#chains in the Genus database with same CATH homology
 2EPC A;  2YTO A;  4R2E A;  2EP3 A;  1X5W A;  4FK5 C;  2YRH A;  2VRD A;  2DLQ A;  4M9V C;  1NCS A;  2EMC A;  4R2A A;  1JK2 A;  2ELY A;  1B69 A;  2MKN A;  1WJP A;  2EPX A;  2HGH A;  2GHF A;  1A1L A;  2EJ4 A;  4X9J A;  2YU5 A;  2JPA A;  2YU8 A;  2EE8 A;  2EL5 A;  2EMX A;  2EOZ A;  2EOS A;  2EM5 A;  1TF3 A;  2ENA A;  2EQ1 A;  1X3C A;  2ENH A;  2LT7 A;  2EMI A;  2EOQ A;  4GZN C;  3MHS C;  2LVH A;  1P47 A;  4R2D A;  1YSA C;  2EOO A;  1BB8 A;  3EPL A;  5KL6 A;  2EMZ A;  3EPK A;  2YTJ A;  2JP9 A;  5KL5 A;  2EM0 A;  1TN9 A;  2EQ0 A;  2EM2 A;  2YSP A;  4R2Q A;  2YTE A;  5KL2 A;  1BBO A;  2CSH A;  2A25 A;  2EN2 A;  2YSO A;  5KL7 A;  2EMA A;  2YTG A;  3UK3 C;  2EMW A;  2M9A A;  1UN6 B;  4R2P A;  2WCC 3;  1Z1B A;  2DRP A;  1X6F A;  1A1K A;  2DMI A;  2YRK A;  1ZU1 A;  2YTP A;  2EPU A;  2LV2 A;  1KJK A;  1G2D C;  4R2C A;  2EPZ A;  2YTD A;  2WBS A;  2PRT A;  2CT1 A;  2ELZ A;  2YTI A;  1A1H A;  2EN7 A;  2EOY A;  2CTD A;  2EOH A;  2EOF A;  4WSG A;  2EM7 A;  5KL4 A;  1G2F C;  1TF6 A;  3EPH A;  2WBT A;  2LO3 A;  2EM9 A;  2EM6 A;  2RSI A;  2EOE A;  1A1I A;  1A1J A;  1JK1 A;  4F6M A;  1X6E A;  1A1F A;  1X6H A;  2YRM A;  4R2S A;  4IS1 C;  2R1F A;  2EMY A;  2LCE A;  2EL4 A;  2EN8 A;  2E72 A;  2ADR A;  2J7J A;  3EPJ A;  2YTN A;  2DLK A;  2EPP A;  2EOM A;  2EMF A;  3MHH C;  2ENC A;  2BB8 A;  2MKD A;  2EMK A;  2RPC A;  1YUJ A;  2GLI A;  4F2J C;  3M99 B;  2YTF A;  5KL3 A;  2EPA A;  2EOJ A;  2EN3 A;  4F6N A;  2EM4 A;  2EM8 A;  2I13 A;  1F2I G;  2WBU A;  2D9H A;  1AAY A;  1MEY C;  2EM3 A;  2MDG A;  3VHT B;  4R2R A;  1ZR9 A;  2EOR A;  2EML A;  2EOI A;  2DGC A;  2YTQ A;  1RMD A;  2EOX A;  2EQ3 A;  2NAB A;  1LLM C;  1DGC A;  1ZAA C;  2EN1 A;  1A1G A;  1UBD C;  2EN6 A;  2EMH A;  2EMB A;  2EL6 A;  2EN4 A;  2EPR A;  1YUI A;  2EMG A;  4IJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...