3DF6A

The thermo- and acido-stable orf-99 from the archaeal virus afv1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
b'DTHEFHKLLIKVVDLFLEDRIKEFEMKLNTTLDELEFEELIGKPDSSNSAENNGIFIDEYSYDASENAMKKLFVEYVRQPEFKYTVLSIKGVNDWVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF99
publication title The thermo- and acido-stable ORF-99 from the archaeal virus AFV1
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Viral protein, unknown function
total genus 27
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07118 DUF1374 Protein of unknown function (DUF1374)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.300 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3df6A00
3DJWA 2H36X 3DF6A
chains in the Genus database with same CATH superfamily
4TUIA 2F4VE 2EL6A 1X49A 3ZOQB 1Z1BA 2EMZA 4R2PA 1N34E 1YYKA 2V89A 4R2QA 4DV3E 1WRJA 2UUAE 4DR3E 2E72A 2RSMA 4WXDA 1A1FA 4MLVA 3DJWA 5KL2A 1ZU1A 4JI5E 2DSYA 2EMHA 2EN6A 2YTJA 5AC5A 3ECRA 4R2RA 3EPHA 3TQMA 1SR9A 2YZTA 2DRPA 2EJ4A 2EORA 4BCAA 4O5GA 4LFBE 5LLQA 2LCEA 2L3JA 2DIXA 4NXME 1EH8A 5IXMB 4WXCA 5AE1A 1QNTA 5IT9C 4GKJE 1KYQA 5A2QC 4JI6E 1IBME 2DMIA 1DGCA 3OMLA 4LU9A 1N36E 4DV6E 1HNXE 4LFAE 2EMIA 2EOSA 2L3CA 4WSGA 2EWLA 4IJDA 4F6NA 4NHRA 3AV0A 3HPSA 2EN1A 1PJTA 4B3SE 2DLKA 1SFEA 4L8NA 4FK5C 1STUA 2RSIA 2L33A 2VQFE 1GZ6A 3C4TA 1XMOE 4O24A 2EOMA 2DLQA 3KZYA 4GEQB 4KZSA 1UBDC 4JI4E 3T1HE 2MDGA 1A1IA 3BGHA 2MC5A 2RQLA 1N32E 2E1MA 3BIDA 1PKPA 2EPPA 2ENCA 3MHHC 2VF1A 2K4VA 4BS9A 1NCSA 2GPIA 3BF2A 4F54A 3ADJA 1YUJA 1HNWE 4X62E 1N33E 2LUPB 1LLMC 1X5WA 1YUIA 4AQYE 2ADRA 2JXPA 4JV5E 4DV0E 5A69A 2UXDE 2M4IA 2JOXA 1RC7A 1ZR9A 4WPYA 3HQ1A 2EPNA 1EH7A 4P7DA 2EPRA 2KONA 4BHBA 2YWQA 3THOB 2LBSB 2EP3A 2V85A 2Q8UA 2WZOA 2EM6A 1PJQA 2EM5A 1JK2A 2UUCE 2ODRC 1UHZA 2EOOA 3LLHA 3IWCA 4O43A 2ODRD 2EMWA 2KHXA 1XNQE 1JK1A 2V88A 1YPNA 2YRKA 4RH8A 2YTOA 2B7TA 4X9JA 4X64E 4DV1E 4DKKA 3RMPA 3DF6A 3KWRA 2L2KB 4JI3E 1QU6A 2EPMX 3J7Yp 4RHBB 1DQ3A 5FLXC 4B3ME 4NZVA 1WHQA 3EPLA 4F2JC 2EOJA 4GKKE 4P78A 2EPOA 3THNA 2NUFA 2EN3A 2JYAA 2CPNA 3H09A 2WBUA 2LJUA 3VK6A 2MKDA 1I94E 4JI7E 4MLQA 5KL7A 4DR6E 4DV4E 3VYYA 1YYOA 4DV2E 1G2FC 4R2DA 4JI1E 4ZYDA 4F9AB 1A1JA 4R2SA 4ZYEA 2HJJA 3M99B 4DUYE 1IQSA 2EMBA 1T4OA 3AUZA 2EMAA 5KL3A 2YRHA 1X3CA 3ADGA 4OX9E 2DGCA 1J26A 2LO3A 2B3TB 3C4BA 4M2ZA 5BR8E 2L92A 3J7AG 2DB2A 2H36X 2EOZA 1B69A 4N4RB 4M9VC 2L2MA 1A1KA 2LVHA 4BMJA 2UXCE 3T1YE 5KL4A 2LE2A 2EM7A 2WBSA 1MGTA 3K6QA 4LFCE 2JVAA 1PJSA 4Q28A 2WBTA 5F3WA 1YZ9A 1XMQE 2LTRA 2NABA 4R8OA 2NUGA 2YTEA 2EOEA 2EE8A 4DR7E 4BHCA 2ENAA 2YPNA 2JPAA 2EOFA 2EQ1A 2I9IA 2YTIA 1A1LA 2FV4B 1MEYC 1T39A 4L5NC 1BBGA 3HPZA 2YTGA 2ELZA 1WHNA 2YU5A 1GTKA 2B9DA 2ENHA 2GLIA 3UK3C 2YTPA 4IS1C 1X48A 2JR1A 2EZ6A 4Q35B 2EL5A 2NA2A 1UILA 2V86A 1XNRE 2EPCA 4X8WA 4WFTA 2M1SA 2IHR1 1IMUA 1IQOA 1PDAA 2EPUA 4BC9A 1YFHA 4JI0E 1EH6A 2EM3A 3C6KA 2EN8A 4O4KA 4R03A 2EPLX 2EMYA 5DNYA 4R2CA 4ZYGA 2LRSA 1ZBTA 3QG5C 4KHPE 4HTGA 2L8TA 4DR2E 4B3RE 4J8ZA 2RS7A 2EMLA 2JY9A 2MDRA 2NUEA 4I8OA 1TF3A 4HEIA 1G2DC 1A1HA 3JU0A 4M30A 5A6AA 2LT7A 3J81C 3FIGA 4YY3E 2J7JA 2EMXA 1FKAE 4OOGC 4YHHE 2EPXA 1T4NA 2R76A 2LUQA 1FJGE 1T38A 2N8XA 1J5EE 2UXBE 1HNZE 4DR4E 1BB8A 2R1FA 4JI8E 4B3TE 1HR0E 4JYAE 4LF9E 2EQ0A 1RMDA 2ELYA 5CFFE 2N3GA 5T6JA 1X6HA 1A1GA 3KZZA 3LMLA 3EQ1A 4DR1E 2VQEE 5KL5A 4DV7E 2EM0A 2UU9E 2EOXA 1F2IG 2PRTA 4LF6E 2EOYA 1GQEA 2EOIA 1KJKA 3F6HA 1RQ0A 5A6BD 2JP9A 2EMCA 5AE3A 2YTNA 2EQ3A 2V8QB 2E5LE 2EN7A 2K7IA 2EPAA 4LF5E 4LTYA 2EM8A 4DUZE 1TN9A 4X66E 4M0VA 2BB8A 3F6GA 3OTOE 5IV8B 2L2NA 4R2EA 4ZYHA 2EPZA 2UUBE 2EMGA 2EMKA 2LMZA 1WXRA 4LF7E 3MHSC 4WX9A 2EN4A 3JTZA 4BBYA 1ZBQA 3MSWA 2YTQA 2LJHA 5LMUE 2EN2A 3BBGA 4JI2E 4WYQB 2RS6A 2KOUA 5AC4A 4TUGA 1YYWA 1L4SA 1O0WA 3VYXA 2HGHA 2G7HA 1DI2A 3ADIA 2EL4A 3EPJA 3EPKA 2B7VA 5AE2A 5IWAE 2EM9A 2ZM6E 5LL6R 2FTXB 2D9HA 3VHTB 5A6JA 4LF8E 2HC5A 4R2AA 3HTXA 1TF6A 2BBGA 2CT1A 1BBOA 2YT4A 2DMYA 2JOBA 2YU8A 2V87A 1N3GA 2YTFA 2YSPA 1ZAAC 1X6EA 1AAYA 5A6KA 2EM4A 2EPKX 2YSOA 1IBLE 5AASA 3IWDA 3L00A 4GZNC 1WJPA 2MKNA 1P47A 4DMIA 4F9BB 4DV5E 2RTXA 2YTDA 4NXNE 3HXLA 3P1XA 1NEIA 2RPCA 1UN6B 4F9CB 2A25A 2LTSA 2N3HA 4K0KE 1AH5A 2VE7C 2L6MA 1YSAC 2GHFA 4WSPA 5A6BA 2M7QA 2MC6A 1T4LB 5KL6A 3J80C 1X6FA 5TSEA 2JWOA 2LV2A 3ADLA 2EMFA 2M9AA 4F6MA 4BC7A 2F8BA 2EM2A 2V83A 5LMNE 2EOQA 2CTDA 3C6MA 3IWBA 1IBKE 4X65E 4DR5E 1EKZA 2HHHE 5ADZA 2WCC3 2YRMA 2CSHA 4KWYA 2EOHA 4LF4E 3JAMC 1X47A 2VRDA 2FGGA 2I13A
chains in the Genus database with same CATH topology
4DR7E 4TUIA 2F4VE 1X49A 2UXDE 2M4IA 2JOXA 2UUBE 1RC7A 4WPYA 3HQ1A 2LMZA 1WXRA 3ZOQB 4LF7E 1YYKA 1N34E 2FV4B 2V89A 4P7DA 2KONA 4DV3E 4L5NC 2UUAE 4DR3E 2LBSB 2RSMA 3HPZA 3JTZA 4BBYA 2V85A 1WHNA 1ZBQA 2WZOA 3MSWA 2B9DA 2UUCE 2ODRC 2LJHA 1UHZA 5LMUE 3DJWA 3LLHA 4JI2E 3IWCA 4WYQB 2RS6A 2ODRD 2KOUA 4TUGA 1YYWA 2KHXA 1O0WA 3VYXA 1X48A 2G7HA 2JR1A 4JI5E 3ADIA 2EZ6A 1DI2A 2DSYA 2NA2A 1XNQE 2B7VA 2V88A 1UILA 5AE2A 5IWAE 2V86A 1XNRE 4DV1E 2B7TA 4X8WA 4WFTA 4X64E 4DKKA 2ZM6E 5LL6R 2FTXB 3RMPA 1SR9A 2M1SA 2YZTA 3DF6A 3KWRA 2IHR1 2L2KB 4JI3E 1QU6A 4BCAA 3J7Yp 4LFBE 4LF8E 1DQ3A 4BC9A 4JI0E 5FLXC 2L3JA 4B3ME 3HTXA 1WHQA 2DIXA 4NXME 4R03A 4GKKE 5AE1A 4P78A 2YT4A 2DMYA 5DNYA 2NUFA 2JOBA 5IT9C 2LRSA 2V87A 1ZBTA 4KHPE 4DR2E 2CPNA 2L8TA 3H09A 4J8ZA 4B3RE 5A2QC 2RS7A 4GKJE 4JI6E 2JY9A 1IBME 2MDRA 3OMLA 4LU9A 3VK6A 1N36E 1I94E 4JI7E 4DV6E 4I8OA 1HNXE 4LFAE 2NUEA 4DR6E 3JU0A 4M30A 2L3CA 3VYYA 3J81C 4DV4E 3FIGA 4DV2E 2EWLA 4YY3E 1YYOA 1IBLE 5AASA 3IWDA 1FKAE 4JI1E 4F9AB 4DMIA 4F9BB 4OOGC 4YHHE 4DV5E 3AV0A 1T4NA 3HPSA 2LUQA 2RTXA 4DUYE 1FJGE 4NXNE 4B3SE 3HXLA 3P1XA 1T4OA 4F9CB 3AUZA 1J5EE 4L8NA 1STUA 2UXBE 1HNZE 2L33A 2VQFE 2LTSA 2N3HA 4DR4E 3ADGA 4OX9E 1GZ6A 3C4TA 4JI8E 1XMOE 1HR0E 4B3TE 4JYAE 1J26A 2B3TB 3C4BA 4LF9E 2VE7C 2L6MA 4M2ZA 4K0KE 5BR8E 2L92A 4GEQB 4KZSA 4WSPA 4JI4E 3J7AG 5CFFE 3T1HE 2N3GA 5T6JA 2DB2A 2H36X 2M7QA 2MC5A 2MC6A 1T4LB 3J80C 1N32E 3LMLA 4DR1E 2JWOA 2VQEE 4DV7E 2UU9E 2E1MA 3ADLA 1PKPA 4LF6E 2L2MA 1GQEA 2VF1A 3F6HA 2K4VA 2F8BA 1RQ0A 4BC7A 4BMJA 4BS9A 2UXCE 2V83A 5LMNE 3T1YE 5AE3A 4F54A 3IWBA 3ADJA 2V8QB 1IBKE 1HNWE 2LE2A 4X65E 4DR5E 1EKZA 4X62E 2E5LE 2HHHE 5ADZA 3K6QA 4LFCE 1N33E 2LUPB 4LF5E 4LTYA 2JVAA 4Q28A 4AQYE 5F3WA 4DUZE 4LF4E 3JAMC 4JV5E 4X66E 4M0VA 1YZ9A 1X47A 1XMQE 2LTRA 3F6GA 2FGGA 3OTOE 4DV0E 4R8OA 2NUGA 2L2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJW A;  2H36 X;  3DF6 A; 
#chains in the Genus database with same CATH topology
 4TUI A;  2F4V E;  2EL6 A;  1X49 A;  3ZOQ B;  1Z1B A;  2EMZ A;  4R2P A;  1N34 E;  1YYK A;  2V89 A;  4R2Q A;  4DV3 E;  1WRJ A;  2UUA E;  4DR3 E;  2E72 A;  2RSM A;  4WXD A;  1A1F A;  4MLV A;  3DJW A;  5KL2 A;  1ZU1 A;  4JI5 E;  2DSY A;  2EMH A;  2EN6 A;  2YTJ A;  5AC5 A;  3ECR A;  4R2R A;  3EPH A;  3TQM A;  1SR9 A;  2YZT A;  2DRP A;  2EJ4 A;  2EOR A;  4BCA A;  4O5G A;  4LFB E;  5LLQ A;  2LCE A;  2L3J A;  2DIX A;  4NXM E;  1EH8 A;  5IXM B;  4WXC A;  5AE1 A;  1QNT A;  5IT9 C;  4GKJ E;  1KYQ A;  5A2Q C;  4JI6 E;  1IBM E;  2DMI A;  1DGC A;  3OML A;  4LU9 A;  1N36 E;  4DV6 E;  1HNX E;  4LFA E;  2EMI A;  2EOS A;  2L3C A;  4WSG A;  2EWL A;  4IJD A;  4F6N A;  4NHR A;  3AV0 A;  3HPS A;  2EN1 A;  1PJT A;  4B3S E;  2DLK A;  1SFE A;  4L8N A;  4FK5 C;  1STU A;  2RSI A;  2L33 A;  2VQF E;  1GZ6 A;  3C4T A;  1XMO E;  4O24 A;  2EOM A;  2DLQ A;  3KZY A;  4GEQ B;  4KZS A;  1UBD C;  4JI4 E;  3T1H E;  2MDG A;  1A1I A;  3BGH A;  2MC5 A;  2RQL A;  1N32 E;  2E1M A;  3BID A;  1PKP A;  2EPP A;  2ENC A;  3MHH C;  2VF1 A;  2K4V A;  4BS9 A;  1NCS A;  2GPI A;  3BF2 A;  4F54 A;  3ADJ A;  1YUJ A;  1HNW E;  4X62 E;  1N33 E;  2LUP B;  1LLM C;  1X5W A;  1YUI A;  4AQY E;  2ADR A;  2JXP A;  4JV5 E;  4DV0 E;  5A69 A;  2UXD E;  2M4I A;  2JOX A;  1RC7 A;  1ZR9 A;  4WPY A;  3HQ1 A;  2EPN A;  1EH7 A;  4P7D A;  2EPR A;  2KON A;  4BHB A;  2YWQ A;  3THO B;  2LBS B;  2EP3 A;  2V85 A;  2Q8U A;  2WZO A;  2EM6 A;  1PJQ A;  2EM5 A;  1JK2 A;  2UUC E;  2ODR C;  1UHZ A;  2EOO A;  3LLH A;  3IWC A;  4O43 A;  2ODR D;  2EMW A;  2KHX A;  1XNQ E;  1JK1 A;  2V88 A;  1YPN A;  2YRK A;  4RH8 A;  2YTO A;  2B7T A;  4X9J A;  4X64 E;  4DV1 E;  4DKK A;  3RMP A;  3DF6 A;  3KWR A;  2L2K B;  4JI3 E;  1QU6 A;  2EPM X;  3J7Y p;  4RHB B;  1DQ3 A;  5FLX C;  4B3M E;  4NZV A;  1WHQ A;  3EPL A;  4F2J C;  2EOJ A;  4GKK E;  4P78 A;  2EPO A;  3THN A;  2NUF A;  2EN3 A;  2JYA A;  2CPN A;  3H09 A;  2WBU A;  2LJU A;  3VK6 A;  2MKD A;  1I94 E;  4JI7 E;  4MLQ A;  5KL7 A;  4DR6 E;  4DV4 E;  3VYY A;  1YYO A;  4DV2 E;  1G2F C;  4R2D A;  4JI1 E;  4ZYD A;  4F9A B;  1A1J A;  4R2S A;  4ZYE A;  2HJJ A;  3M99 B;  4DUY E;  1IQS A;  2EMB A;  1T4O A;  3AUZ A;  2EMA A;  5KL3 A;  2YRH A;  1X3C A;  3ADG A;  4OX9 E;  2DGC A;  1J26 A;  2LO3 A;  2B3T B;  3C4B A;  4M2Z A;  5BR8 E;  2L92 A;  3J7A G;  2DB2 A;  2H36 X;  2EOZ A;  1B69 A;  4N4R B;  4M9V C;  2L2M A;  1A1K A;  2LVH A;  4BMJ A;  2UXC E;  3T1Y E;  5KL4 A;  2LE2 A;  2EM7 A;  2WBS A;  1MGT A;  3K6Q A;  4LFC E;  2JVA A;  1PJS A;  4Q28 A;  2WBT A;  5F3W A;  1YZ9 A;  1XMQ E;  2LTR A;  2NAB A;  4R8O A;  2NUG A;  2YTE A;  2EOE A;  2EE8 A;  4DR7 E;  4BHC A;  2ENA A;  2YPN A;  2JPA A;  2EOF A;  2EQ1 A;  2I9I A;  2YTI A;  1A1L A;  2FV4 B;  1MEY C;  1T39 A;  4L5N C;  1BBG A;  3HPZ A;  2YTG A;  2ELZ A;  1WHN A;  2YU5 A;  1GTK A;  2B9D A;  2ENH A;  2GLI A;  3UK3 C;  2YTP A;  4IS1 C;  1X48 A;  2JR1 A;  2EZ6 A;  4Q35 B;  2EL5 A;  2NA2 A;  1UIL A;  2V86 A;  1XNR E;  2EPC A;  4X8W A;  4WFT A;  2M1S A;  2IHR 1;  1IMU A;  1IQO A;  1PDA A;  2EPU A;  4BC9 A;  1YFH A;  4JI0 E;  1EH6 A;  2EM3 A;  3C6K A;  2EN8 A;  4O4K A;  4R03 A;  2EPL X;  2EMY A;  5DNY A;  4R2C A;  4ZYG A;  2LRS A;  1ZBT A;  3QG5 C;  4KHP E;  4HTG A;  2L8T A;  4DR2 E;  4B3R E;  4J8Z A;  2RS7 A;  2EML A;  2JY9 A;  2MDR A;  2NUE A;  4I8O A;  1TF3 A;  4HEI A;  1G2D C;  1A1H A;  3JU0 A;  4M30 A;  5A6A A;  2LT7 A;  3J81 C;  3FIG A;  4YY3 E;  2J7J A;  2EMX A;  1FKA E;  4OOG C;  4YHH E;  2EPX A;  1T4N A;  2R76 A;  2LUQ A;  1FJG E;  1T38 A;  2N8X A;  1J5E E;  2UXB E;  1HNZ E;  4DR4 E;  1BB8 A;  2R1F A;  4JI8 E;  4B3T E;  1HR0 E;  4JYA E;  4LF9 E;  2EQ0 A;  1RMD A;  2ELY A;  5CFF E;  2N3G A;  5T6J A;  1X6H A;  1A1G A;  3KZZ A;  3LML A;  3EQ1 A;  4DR1 E;  2VQE E;  5KL5 A;  4DV7 E;  2EM0 A;  2UU9 E;  2EOX A;  1F2I G;  2PRT A;  4LF6 E;  2EOY A;  1GQE A;  2EOI A;  1KJK A;  3F6H A;  1RQ0 A;  5A6B D;  2JP9 A;  2EMC A;  5AE3 A;  2YTN A;  2EQ3 A;  2V8Q B;  2E5L E;  2EN7 A;  2K7I A;  2EPA A;  4LF5 E;  4LTY A;  2EM8 A;  4DUZ E;  1TN9 A;  4X66 E;  4M0V A;  2BB8 A;  3F6G A;  3OTO E;  5IV8 B;  2L2N A;  4R2E A;  4ZYH A;  2EPZ A;  2UUB E;  2EMG A;  2EMK A;  2LMZ A;  1WXR A;  4LF7 E;  3MHS C;  4WX9 A;  2EN4 A;  3JTZ A;  4BBY A;  1ZBQ A;  3MSW A;  2YTQ A;  2LJH A;  5LMU E;  2EN2 A;  3BBG A;  4JI2 E;  4WYQ B;  2RS6 A;  2KOU A;  5AC4 A;  4TUG A;  1YYW A;  1L4S A;  1O0W A;  3VYX A;  2HGH A;  2G7H A;  1DI2 A;  3ADI A;  2EL4 A;  3EPJ A;  3EPK A;  2B7V A;  5AE2 A;  5IWA E;  2EM9 A;  2ZM6 E;  5LL6 R;  2FTX B;  2D9H A;  3VHT B;  5A6J A;  4LF8 E;  2HC5 A;  4R2A A;  3HTX A;  1TF6 A;  2BBG A;  2CT1 A;  1BBO A;  2YT4 A;  2DMY A;  2JOB A;  2YU8 A;  2V87 A;  1N3G A;  2YTF A;  2YSP A;  1ZAA C;  1X6E A;  1AAY A;  5A6K A;  2EM4 A;  2EPK X;  2YSO A;  1IBL E;  5AAS A;  3IWD A;  3L00 A;  4GZN C;  1WJP A;  2MKN A;  1P47 A;  4DMI A;  4F9B B;  4DV5 E;  2RTX A;  2YTD A;  4NXN E;  3HXL A;  3P1X A;  1NEI A;  2RPC A;  1UN6 B;  4F9C B;  2A25 A;  2LTS A;  2N3H A;  4K0K E;  1AH5 A;  2VE7 C;  2L6M A;  1YSA C;  2GHF A;  4WSP A;  5A6B A;  2M7Q A;  2MC6 A;  1T4L B;  5KL6 A;  3J80 C;  1X6F A;  5TSE A;  2JWO A;  2LV2 A;  3ADL A;  2EMF A;  2M9A A;  4F6M A;  4BC7 A;  2F8B A;  2EM2 A;  2V83 A;  5LMN E;  2EOQ A;  2CTD A;  3C6M A;  3IWB A;  1IBK E;  4X65 E;  4DR5 E;  1EKZ A;  2HHH E;  5ADZ A;  2WCC 3;  2YRM A;  2CSH A;  4KWY A;  2EOH A;  4LF4 E;  3JAM C;  1X47 A;  2VRD A;  2FGG A;  2I13 A; 
#chains in the Genus database with same CATH homology
 4DR7 E;  4TUI A;  2F4V E;  1X49 A;  2UXD E;  2M4I A;  2JOX A;  2UUB E;  1RC7 A;  4WPY A;  3HQ1 A;  2LMZ A;  1WXR A;  3ZOQ B;  4LF7 E;  1YYK A;  1N34 E;  2FV4 B;  2V89 A;  4P7D A;  2KON A;  4DV3 E;  4L5N C;  2UUA E;  4DR3 E;  2LBS B;  2RSM A;  3HPZ A;  3JTZ A;  4BBY A;  2V85 A;  1WHN A;  1ZBQ A;  2WZO A;  3MSW A;  2B9D A;  2UUC E;  2ODR C;  2LJH A;  1UHZ A;  5LMU E;  3DJW A;  3LLH A;  4JI2 E;  3IWC A;  4WYQ B;  2RS6 A;  2ODR D;  2KOU A;  4TUG A;  1YYW A;  2KHX A;  1O0W A;  3VYX A;  1X48 A;  2G7H A;  2JR1 A;  4JI5 E;  3ADI A;  2EZ6 A;  1DI2 A;  2DSY A;  2NA2 A;  1XNQ E;  2B7V A;  2V88 A;  1UIL A;  5AE2 A;  5IWA E;  2V86 A;  1XNR E;  4DV1 E;  2B7T A;  4X8W A;  4WFT A;  4X64 E;  4DKK A;  2ZM6 E;  5LL6 R;  2FTX B;  3RMP A;  1SR9 A;  2M1S A;  2YZT A;  3DF6 A;  3KWR A;  2IHR 1;  2L2K B;  4JI3 E;  1QU6 A;  4BCA A;  3J7Y p;  4LFB E;  4LF8 E;  1DQ3 A;  4BC9 A;  4JI0 E;  5FLX C;  2L3J A;  4B3M E;  3HTX A;  1WHQ A;  2DIX A;  4NXM E;  4R03 A;  4GKK E;  5AE1 A;  4P78 A;  2YT4 A;  2DMY A;  5DNY A;  2NUF A;  2JOB A;  5IT9 C;  2LRS A;  2V87 A;  1ZBT A;  4KHP E;  4DR2 E;  2CPN A;  2L8T A;  3H09 A;  4J8Z A;  4B3R E;  5A2Q C;  2RS7 A;  4GKJ E;  4JI6 E;  2JY9 A;  1IBM E;  2MDR A;  3OML A;  4LU9 A;  3VK6 A;  1N36 E;  1I94 E;  4JI7 E;  4DV6 E;  4I8O A;  1HNX E;  4LFA E;  2NUE A;  4DR6 E;  3JU0 A;  4M30 A;  2L3C A;  3VYY A;  3J81 C;  4DV4 E;  3FIG A;  4DV2 E;  2EWL A;  4YY3 E;  1YYO A;  1IBL E;  5AAS A;  3IWD A;  1FKA E;  4JI1 E;  4F9A B;  4DMI A;  4F9B B;  4OOG C;  4YHH E;  4DV5 E;  3AV0 A;  1T4N A;  3HPS A;  2LUQ A;  2RTX A;  4DUY E;  1FJG E;  4NXN E;  4B3S E;  3HXL A;  3P1X A;  1T4O A;  4F9C B;  3AUZ A;  1J5E E;  4L8N A;  1STU A;  2UXB E;  1HNZ E;  2L33 A;  2VQF E;  2LTS A;  2N3H A;  4DR4 E;  3ADG A;  4OX9 E;  1GZ6 A;  3C4T A;  4JI8 E;  1XMO E;  1HR0 E;  4B3T E;  4JYA E;  1J26 A;  2B3T B;  3C4B A;  4LF9 E;  2VE7 C;  2L6M A;  4M2Z A;  4K0K E;  5BR8 E;  2L92 A;  4GEQ B;  4KZS A;  4WSP A;  4JI4 E;  3J7A G;  5CFF E;  3T1H E;  2N3G A;  5T6J A;  2DB2 A;  2H36 X;  2M7Q A;  2MC5 A;  2MC6 A;  1T4L B;  3J80 C;  1N32 E;  3LML A;  4DR1 E;  2JWO A;  2VQE E;  4DV7 E;  2UU9 E;  2E1M A;  3ADL A;  1PKP A;  4LF6 E;  2L2M A;  1GQE A;  2VF1 A;  3F6H A;  2K4V A;  2F8B A;  1RQ0 A;  4BC7 A;  4BMJ A;  4BS9 A;  2UXC E;  2V83 A;  5LMN E;  3T1Y E;  5AE3 A;  4F54 A;  3IWB A;  3ADJ A;  2V8Q B;  1IBK E;  1HNW E;  2LE2 A;  4X65 E;  4DR5 E;  1EKZ A;  4X62 E;  2E5L E;  2HHH E;  5ADZ A;  3K6Q A;  4LFC E;  1N33 E;  2LUP B;  4LF5 E;  4LTY A;  2JVA A;  4Q28 A;  4AQY E;  5F3W A;  4DUZ E;  4LF4 E;  3JAM C;  4JV5 E;  4X66 E;  4M0V A;  1YZ9 A;  1X47 A;  1XMQ E;  2LTR A;  3F6G A;  2FGG A;  3OTO E;  4DV0 E;  4R8O A;  2NUG A;  2L2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...