3DF6A

The thermo- and acido-stable orf-99 from the archaeal virus afv1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
DTHEFHKLLIKVVDLFLEDRIKEFEMKLNTTLDELEFEELIGKPDSSNSAENNGIFIDEYSYDASENAMKKLFVEYVRQPEFKYTVLSIKGVNDWVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF99
publication title The thermo- and acido-stable ORF-99 from the archaeal virus AFV1
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Viral protein, unknown function
total genus 27
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07118 DUF1374 Protein of unknown function (DUF1374)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.300 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3df6A00
2H36X 3DF6A 3DJWA
chains in the Genus database with same CATH superfamily
3ZOQB 4LF6E 2EN2A 1IBME 2DLKA 2DB2A 4R2QA 5TSEA 4BHBA 1UN6B 3HTXA 1A1FA 1A1GA 2EPLX 1BBOA 1A1HA 4NHRA 4DV5E 2EMLA 4JI1E 2EMGA 5AC5A 1SR9A 3EPKA 1DGCA 3EQ1A 1UBDC 2B9DA 2DMYA 4BMJA 4JI7E 5KL2A 1TF6A 1LLMC 2L33A 4DUZE 2EPRA 4NXME 1B69A 3ADIA 3OMLA 4DR5E 2EQ0A 1YYWA 2EQ1A 4MLQA 5LMUE 4X9JA 5ADZA 1TF3A 4X8WA 2EL4A 3IWBA 1T38A 4N4RB 2JXPA 2BBGA 4LF4E 2N3HA 1TN9A 3IWCA 3EPJA 4WYQB 2ADRA 2ODRD 3OTOE 1XMOE 2EMIA 4P78A 4JI0E 5A69A 1YYOA 3ECRA 2EM8A 1X47A 2EPXA 2KHXA 4DV1E 1ZAAC 5IT9C 4F6MA 1YPNA 2ELYA 4X66E 3F6GA 1A1LA 4O24A 2EM2A 4ZYHA 4IS1C 2L3CA 4R2SA 2EM9A 1BB8A 1RQ0A 1N36E 3VK6A 5LLQA 1HNZE 1DQ3A 2EOJA 4F2JC 2JPAA 4O4KA 1A1KA 1F2IG 3H09A 2EZ6A 4JI6E 4AQYE 2YTNA 2KOUA 2ELZA 2YTEA 4R2RA 2EPOA 3KZYA 1WHQA 4Q35B 2MDGA 1A1JA 2EPMX 3IWDA 2L3JA 3DF6A 1NEIA 2VE7C 5AE2A 4HTGA 2LO3A 1EH7A 2RS6A 3KZZA 4X62E 4DV7E 5KL4A 2WZOA 3J80C 2EE8A 3LLHA 1T39A 2YTQA 4JI5E 4WFTA 2Q8UA 4BCAA 4R2PA 1WHNA 4GEQB 2UXBE 1HR0E 2EOYA 2R1FA 2YRKA 1G2DC 2RPCA 4JI8E 1GTKA 2JP9A 4OOGC 5IWAE 2M1SA 4WX9A 4Q28A 2YTOA 2D9HA 3MHSC 4F6NA 2F4VE 2EWLA 4DV3E 4WSGA 5AASA 4L8NA 3HPSA 3BF2A 1T4LB 2MDRA 1GQEA 4WSPA 2VQEE 3HPZA 1HNXE 2MKNA 3AUZA 2ODRC 2EL6A 2UU9E 1AH5A 3THNA 2EJ4A 4LF9E 4YHHE 5KL7A 1DI2A 4KZSA 1I94E 2YTIA 1J26A 1XMQE 1RMDA 4B3ME 5DNYA 2JWOA 2LJUA 5F3WA 5IXMB 2JY9A 4X65E 2EPUA 2EM3A 2WBUA 2K7IA 2HC5A 2FTXB 1FJGE 2EOXA 2WBSA 2BB8A 2WBTA 2JOBA 4HEIA 4WPYA 4P7DA 4KHPE 3EPLA 2DLQA 4JI4E 4M9VC 4BC9A 4ZYEA 1YZ9A 2EOFA 2HGHA 2LJHA 4DV0E 4BBYA 2EM5A 1X6HA 1T4OA 3ADJA 2G7HA 1A1IA 5KL3A 2YTDA 4DR2E 3C4TA 1IBKE 1WJPA 4F9AB 4DR3E 2EPAA 2YU5A 2EOEA 2I9IA 2YTJA 1IMUA 1IBLE 4R2CA 4DR4E 4F9CB 2V85A 2EM6A 2MC5A 2PRTA 3RMPA 4OX9E 2YSPA 2YPNA 4JI2E 1SFEA 2ENCA 2YSOA 4GZNC 2CTDA 3BIDA 4DKKA 2DMIA 1JK1A 4GKKE 2JVAA 1P47A 3BBGA 4TUGA 2EMCA 5A6BD 2B3TB 1ZBTA 3T1HE 2YZTA 2LMZA 4BHCA 4R8OA 2L6MA 2L2KB 1HNWE 4DMIA 1YUIA 1IQSA 1PJTA 2E1MA 2UUCE 3C6MA 1UILA 4RH8A 5A6JA 3JU0A 4RHBB 5LL6R 1WRJA 4JI3E 2YTPA 4LFCE 3J7AG 1AAYA 2RS7A 3VYYA 4O43A 1ZU1A 2EPPA 1T4NA 2EP3A 4DR6E 4NXNE 4R2AA 2DRPA 3UK3C 3C6KA 2NUGA 2IHR1 5AE1A 5KL6A 2NABA 4F54A 4F9BB 4ZYGA 2L8TA 4R03A 2YRMA 2EL5A 1N34E 2YWQA 4LF7E 1X5WA 5T6JA 4DV2E 4IJDA 2EOOA 2KONA 5CFFE 2EMKA 4LF5E 1X3CA 3EPHA 4DV6E 4KWYA 4LU9A 2EORA 5LMNE 2EMBA 1QU6A 2V83A 2LCEA 1N3GA 2MKDA 2EOHA 2EOMA 2EOIA 4J8ZA 2NA2A 4LFAE 3P1XA 2EPZA 2DSYA 3ADLA 1KYQA 2B7VA 4X64E 4BS9A 1ZBQA 1PJQA 2V88A 3JAMC 2EMYA 1O0WA 2V87A 5AE3A 4R2EA 1EKZA 2LT7A 2EM7A 2EOQA 2YTGA 2LTSA 1PKPA 2NUFA 4JYAE 1L4SA 3M99B 2FV4B 3C4BA 3K6QA 1Z1BA 3FIGA 3HXLA 2LTRA 1WXRA 1X49A 2L2NA 4LFBE 2E5LE 2LBSB 1G2FC 1JK2A 5IV8B 2FGGA 4YY3E 2UXCE 2N8XA 2UUBE 2B7TA 2CT1A 2L92A 2GHFA 4BC7A 4DR1E 1XNQE 2UUAE 1STUA 2EN7A 2EMWA 5A6AA 3BGHA 2EPNA 2LRSA 4I8OA 1BBGA 3VYXA 3JTZA 2RQLA 2EN3A 4O5GA 2EMAA 4B3SE 2EMFA 2M9AA 3L00A 2CSHA 4JV5E 2M7QA 3MSWA 1N33E 2V86A 4DV4E 5BR8E 2ZM6E 1X6EA 2ENAA 2YU8A 1EH6A 2EQ3A 4LTYA 1KJKA 2GLIA 4B3TE 4TUIA 1X6FA 2A25A 2LV2A 3J7Yp 3LMLA 2VQFE 5AC4A 2EN8A 2HHHE 2EN1A 2I13A 2E72A 4NZVA 4M0VA 2EN4A 3AV0A 1PJSA 2EM4A 2JYAA 2UXDE 1YSAC 4L5NC 2RSIA 3QG5C 3J81C 2LVHA 2LUQA 2EM0A 5A6KA 2EN6A 2EOZA 2YRHA 2HJJA 1YFHA 2JOXA 1PDAA 5A6BA 5KL5A 4K0KE 4WXCA 1EH8A 2EMZA 1ZR9A 2J7JA 2L2MA 2K4VA 2CPNA 4ZYDA 2DGCA 1QNTA 4GKJE 1UHZA 1NCSA 2GPIA 2R76A 1XNRE 2V8QB 2LUPB 2VRDA 4MLVA 3KWRA 4LF8E 2YT4A 3TQMA 4DUYE 5FLXC 1MEYC 3HQ1A 2EPCA 1GZ6A 4DR7E 2JR1A 1MGTA 3F6HA 2EOSA 1YYKA 1N32E 3MHHC 1YUJA 2LE2A 2ENHA 3THOB 2VF1A 2N3GA 1IQOA 2YTFA 2DIXA 4B3RE 2F8BA 3ADGA 4FK5C 4WXDA 2EMXA 3T1YE 1J5EE 2RSMA 2EMHA 3DJWA 2H36X 1RC7A 4M30A 2RTXA 5A2QC 1X48A 1FKAE 4M2ZA 3VHTB 2EPKX 2NUEA 4R2DA 2MC6A 2V89A 2M4IA 2WCC3
chains in the Genus database with same CATH topology
3ZOQB 2WZOA 2UUAE 4LF6E 1STUA 3LLHA 1IBME 4TUGA 2DB2A 4JI5E 4WFTA 4BCAA 1WHNA 2B3TB 4GEQB 1ZBTA 2UXBE 1HR0E 3T1HE 2LRSA 4I8OA 2YZTA 2LMZA 3HTXA 3VYXA 4R8OA 2L6MA 2L2KB 1HNWE 4DMIA 3JTZA 4JI8E 4OOGC 5IWAE 2M1SA 2E1MA 2UUCE 1UILA 3J80C 4B3SE 4Q28A 3JU0A 5LL6R 2F4VE 2EWLA 4JI3E 4LFCE 4DV5E 4JV5E 2M7QA 3J7AG 4DV3E 3MSWA 2RS7A 3VYYA 5AASA 4JI1E 1N33E 4L8NA 2V86A 1SR9A 4DV4E 1T4NA 5BR8E 3HPSA 2ZM6E 1T4LB 2MDRA 1GQEA 2B9DA 4LTYA 4WSPA 4DR6E 2DMYA 4NXNE 4B3TE 4TUIA 3HPZA 4BMJA 2VQEE 4JI7E 1HNXE 3AUZA 3J7Yp 2ODRC 3LMLA 2UU9E 2VQFE 2NUGA 2IHR1 5AE1A 2L33A 2HHHE 4F54A 4F9BB 4LF9E 4DUZE 2L8TA 4NXME 4YHHE 3ADIA 4M0VA 3OMLA 4R03A 1N34E 4DR5E 3AV0A 4LF7E 4KZSA 1DI2A 4DV2E 5T6JA 1I94E 1YYWA 5LMUE 2UXDE 2KONA 4L5NC 5CFFE 5ADZA 1J26A 4X8WA 3IWBA 4LF4E 4LF5E 1XMQE 2N3HA 3J81C 3IWCA 4DV6E 2LUQA 5DNYA 4WYQB 2JWOA 4LU9A 5LMNE 4B3ME 5F3WA 1QU6A 2V83A 4J8ZA 4LFAE 2ODRD 3OTOE 1XMOE 2NA2A 2JY9A 4X65E 4P78A 3P1XA 4JI0E 1YYOA 2JOXA 2DSYA 4K0KE 3ADLA 2FTXB 2B7VA 2L2MA 1FJGE 2K4VA 4X64E 1X47A 2CPNA 2KHXA 1ZBQA 4BS9A 2JOBA 4DV1E 1XNQE 4GKJE 4WPYA 4P7DA 1UHZA 4KHPE 2V88A 3JAMC 4JI4E 1O0WA 5IT9C 4BC9A 2V87A 5AE3A 4X66E 2V8QB 3F6GA 2LUPB 1XNRE 1YZ9A 1EKZA 2L3CA 2LJHA 4DV0E 2LTSA 4BBYA 1PKPA 3KWRA 2NUFA 1T4OA 3ADJA 2YT4A 4LF8E 2G7HA 4JYAE 4DUYE 5FLXC 1RQ0A 3HQ1A 1N36E 2FV4B 3C4BA 3K6QA 1GZ6A 3VK6A 4DR2E 2JR1A 3FIGA 4DR7E 3HXLA 3C4TA 3F6HA 1DQ3A 2LTRA 4F9AB 1IBKE 1WXRA 1HNZE 1N32E 1YYKA 4DR3E 1X49A 2L2NA 2LE2A 3H09A 2VF1A 2EZ6A 4JI6E 4AQYE 1IBLE 4DR4E 2KOUA 2N3GA 4F9CB 2DIXA 2V85A 2F8BA 3ADGA 2E5LE 4B3RE 2LBSB 1WHQA 2MC5A 4LFBE 3T1YE 1J5EE 2RSMA 3RMPA 4OX9E 3DJWA 2H36X 2FGGA 4M30A 4YY3E 2RTXA 5A2QC 1X48A 3IWDA 2L3JA 1RC7A 4JI2E 2UXCE 1FKAE 3DF6A 2UUBE 4M2ZA 2B7TA 4DKKA 2VE7C 2L92A 2NUEA 4BC7A 4GKKE 2JVAA 5AE2A 4DR1E 2RS6A 4DV7E 4X62E 2MC6A 2V89A 2M4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H36 X;  3DF6 A;  3DJW A; 
#chains in the Genus database with same CATH topology
 3ZOQ B;  4LF6 E;  2EN2 A;  1IBM E;  2DLK A;  2DB2 A;  4R2Q A;  5TSE A;  4BHB A;  1UN6 B;  3HTX A;  1A1F A;  1A1G A;  2EPL X;  1BBO A;  1A1H A;  4NHR A;  4DV5 E;  2EML A;  4JI1 E;  2EMG A;  5AC5 A;  1SR9 A;  3EPK A;  1DGC A;  3EQ1 A;  1UBD C;  2B9D A;  2DMY A;  4BMJ A;  4JI7 E;  5KL2 A;  1TF6 A;  1LLM C;  2L33 A;  4DUZ E;  2EPR A;  4NXM E;  1B69 A;  3ADI A;  3OML A;  4DR5 E;  2EQ0 A;  1YYW A;  2EQ1 A;  4MLQ A;  5LMU E;  4X9J A;  5ADZ A;  1TF3 A;  4X8W A;  2EL4 A;  3IWB A;  1T38 A;  4N4R B;  2JXP A;  2BBG A;  4LF4 E;  2N3H A;  1TN9 A;  3IWC A;  3EPJ A;  4WYQ B;  2ADR A;  2ODR D;  3OTO E;  1XMO E;  2EMI A;  4P78 A;  4JI0 E;  5A69 A;  1YYO A;  3ECR A;  2EM8 A;  1X47 A;  2EPX A;  2KHX A;  4DV1 E;  1ZAA C;  5IT9 C;  4F6M A;  1YPN A;  2ELY A;  4X66 E;  3F6G A;  1A1L A;  4O24 A;  2EM2 A;  4ZYH A;  4IS1 C;  2L3C A;  4R2S A;  2EM9 A;  1BB8 A;  1RQ0 A;  1N36 E;  3VK6 A;  5LLQ A;  1HNZ E;  1DQ3 A;  2EOJ A;  4F2J C;  2JPA A;  4O4K A;  1A1K A;  1F2I G;  3H09 A;  2EZ6 A;  4JI6 E;  4AQY E;  2YTN A;  2KOU A;  2ELZ A;  2YTE A;  4R2R A;  2EPO A;  3KZY A;  1WHQ A;  4Q35 B;  2MDG A;  1A1J A;  2EPM X;  3IWD A;  2L3J A;  3DF6 A;  1NEI A;  2VE7 C;  5AE2 A;  4HTG A;  2LO3 A;  1EH7 A;  2RS6 A;  3KZZ A;  4X62 E;  4DV7 E;  5KL4 A;  2WZO A;  3J80 C;  2EE8 A;  3LLH A;  1T39 A;  2YTQ A;  4JI5 E;  4WFT A;  2Q8U A;  4BCA A;  4R2P A;  1WHN A;  4GEQ B;  2UXB E;  1HR0 E;  2EOY A;  2R1F A;  2YRK A;  1G2D C;  2RPC A;  4JI8 E;  1GTK A;  2JP9 A;  4OOG C;  5IWA E;  2M1S A;  4WX9 A;  4Q28 A;  2YTO A;  2D9H A;  3MHS C;  4F6N A;  2F4V E;  2EWL A;  4DV3 E;  4WSG A;  5AAS A;  4L8N A;  3HPS A;  3BF2 A;  1T4L B;  2MDR A;  1GQE A;  4WSP A;  2VQE E;  3HPZ A;  1HNX E;  2MKN A;  3AUZ A;  2ODR C;  2EL6 A;  2UU9 E;  1AH5 A;  3THN A;  2EJ4 A;  4LF9 E;  4YHH E;  5KL7 A;  1DI2 A;  4KZS A;  1I94 E;  2YTI A;  1J26 A;  1XMQ E;  1RMD A;  4B3M E;  5DNY A;  2JWO A;  2LJU A;  5F3W A;  5IXM B;  2JY9 A;  4X65 E;  2EPU A;  2EM3 A;  2WBU A;  2K7I A;  2HC5 A;  2FTX B;  1FJG E;  2EOX A;  2WBS A;  2BB8 A;  2WBT A;  2JOB A;  4HEI A;  4WPY A;  4P7D A;  4KHP E;  3EPL A;  2DLQ A;  4JI4 E;  4M9V C;  4BC9 A;  4ZYE A;  1YZ9 A;  2EOF A;  2HGH A;  2LJH A;  4DV0 E;  4BBY A;  2EM5 A;  1X6H A;  1T4O A;  3ADJ A;  2G7H A;  1A1I A;  5KL3 A;  2YTD A;  4DR2 E;  3C4T A;  1IBK E;  1WJP A;  4F9A B;  4DR3 E;  2EPA A;  2YU5 A;  2EOE A;  2I9I A;  2YTJ A;  1IMU A;  1IBL E;  4R2C A;  4DR4 E;  4F9C B;  2V85 A;  2EM6 A;  2MC5 A;  2PRT A;  3RMP A;  4OX9 E;  2YSP A;  2YPN A;  4JI2 E;  1SFE A;  2ENC A;  2YSO A;  4GZN C;  2CTD A;  3BID A;  4DKK A;  2DMI A;  1JK1 A;  4GKK E;  2JVA A;  1P47 A;  3BBG A;  4TUG A;  2EMC A;  5A6B D;  2B3T B;  1ZBT A;  3T1H E;  2YZT A;  2LMZ A;  4BHC A;  4R8O A;  2L6M A;  2L2K B;  1HNW E;  4DMI A;  1YUI A;  1IQS A;  1PJT A;  2E1M A;  2UUC E;  3C6M A;  1UIL A;  4RH8 A;  5A6J A;  3JU0 A;  4RHB B;  5LL6 R;  1WRJ A;  4JI3 E;  2YTP A;  4LFC E;  3J7A G;  1AAY A;  2RS7 A;  3VYY A;  4O43 A;  1ZU1 A;  2EPP A;  1T4N A;  2EP3 A;  4DR6 E;  4NXN E;  4R2A A;  2DRP A;  3UK3 C;  3C6K A;  2NUG A;  2IHR 1;  5AE1 A;  5KL6 A;  2NAB A;  4F54 A;  4F9B B;  4ZYG A;  2L8T A;  4R03 A;  2YRM A;  2EL5 A;  1N34 E;  2YWQ A;  4LF7 E;  1X5W A;  5T6J A;  4DV2 E;  4IJD A;  2EOO A;  2KON A;  5CFF E;  2EMK A;  4LF5 E;  1X3C A;  3EPH A;  4DV6 E;  4KWY A;  4LU9 A;  2EOR A;  5LMN E;  2EMB A;  1QU6 A;  2V83 A;  2LCE A;  1N3G A;  2MKD A;  2EOH A;  2EOM A;  2EOI A;  4J8Z A;  2NA2 A;  4LFA E;  3P1X A;  2EPZ A;  2DSY A;  3ADL A;  1KYQ A;  2B7V A;  4X64 E;  4BS9 A;  1ZBQ A;  1PJQ A;  2V88 A;  3JAM C;  2EMY A;  1O0W A;  2V87 A;  5AE3 A;  4R2E A;  1EKZ A;  2LT7 A;  2EM7 A;  2EOQ A;  2YTG A;  2LTS A;  1PKP A;  2NUF A;  4JYA E;  1L4S A;  3M99 B;  2FV4 B;  3C4B A;  3K6Q A;  1Z1B A;  3FIG A;  3HXL A;  2LTR A;  1WXR A;  1X49 A;  2L2N A;  4LFB E;  2E5L E;  2LBS B;  1G2F C;  1JK2 A;  5IV8 B;  2FGG A;  4YY3 E;  2UXC E;  2N8X A;  2UUB E;  2B7T A;  2CT1 A;  2L92 A;  2GHF A;  4BC7 A;  4DR1 E;  1XNQ E;  2UUA E;  1STU A;  2EN7 A;  2EMW A;  5A6A A;  3BGH A;  2EPN A;  2LRS A;  4I8O A;  1BBG A;  3VYX A;  3JTZ A;  2RQL A;  2EN3 A;  4O5G A;  2EMA A;  4B3S E;  2EMF A;  2M9A A;  3L00 A;  2CSH A;  4JV5 E;  2M7Q A;  3MSW A;  1N33 E;  2V86 A;  4DV4 E;  5BR8 E;  2ZM6 E;  1X6E A;  2ENA A;  2YU8 A;  1EH6 A;  2EQ3 A;  4LTY A;  1KJK A;  2GLI A;  4B3T E;  4TUI A;  1X6F A;  2A25 A;  2LV2 A;  3J7Y p;  3LML A;  2VQF E;  5AC4 A;  2EN8 A;  2HHH E;  2EN1 A;  2I13 A;  2E72 A;  4NZV A;  4M0V A;  2EN4 A;  3AV0 A;  1PJS A;  2EM4 A;  2JYA A;  2UXD E;  1YSA C;  4L5N C;  2RSI A;  3QG5 C;  3J81 C;  2LVH A;  2LUQ A;  2EM0 A;  5A6K A;  2EN6 A;  2EOZ A;  2YRH A;  2HJJ A;  1YFH A;  2JOX A;  1PDA A;  5A6B A;  5KL5 A;  4K0K E;  4WXC A;  1EH8 A;  2EMZ A;  1ZR9 A;  2J7J A;  2L2M A;  2K4V A;  2CPN A;  4ZYD A;  2DGC A;  1QNT A;  4GKJ E;  1UHZ A;  1NCS A;  2GPI A;  2R76 A;  1XNR E;  2V8Q B;  2LUP B;  2VRD A;  4MLV A;  3KWR A;  4LF8 E;  2YT4 A;  3TQM A;  4DUY E;  5FLX C;  1MEY C;  3HQ1 A;  2EPC A;  1GZ6 A;  4DR7 E;  2JR1 A;  1MGT A;  3F6H A;  2EOS A;  1YYK A;  1N32 E;  3MHH C;  1YUJ A;  2LE2 A;  2ENH A;  3THO B;  2VF1 A;  2N3G A;  1IQO A;  2YTF A;  2DIX A;  4B3R E;  2F8B A;  3ADG A;  4FK5 C;  4WXD A;  2EMX A;  3T1Y E;  1J5E E;  2RSM A;  2EMH A;  3DJW A;  2H36 X;  1RC7 A;  4M30 A;  2RTX A;  5A2Q C;  1X48 A;  1FKA E;  4M2Z A;  3VHT B;  2EPK X;  2NUE A;  4R2D A;  2MC6 A;  2V89 A;  2M4I A;  2WCC 3; 
#chains in the Genus database with same CATH homology
 3ZOQ B;  2WZO A;  2UUA E;  4LF6 E;  1STU A;  3LLH A;  1IBM E;  4TUG A;  2DB2 A;  4JI5 E;  4WFT A;  4BCA A;  1WHN A;  2B3T B;  4GEQ B;  1ZBT A;  2UXB E;  1HR0 E;  3T1H E;  2LRS A;  4I8O A;  2YZT A;  2LMZ A;  3HTX A;  3VYX A;  4R8O A;  2L6M A;  2L2K B;  1HNW E;  4DMI A;  3JTZ A;  4JI8 E;  4OOG C;  5IWA E;  2M1S A;  2E1M A;  2UUC E;  1UIL A;  3J80 C;  4B3S E;  4Q28 A;  3JU0 A;  5LL6 R;  2F4V E;  2EWL A;  4JI3 E;  4LFC E;  4DV5 E;  4JV5 E;  2M7Q A;  3J7A G;  4DV3 E;  3MSW A;  2RS7 A;  3VYY A;  5AAS A;  4JI1 E;  1N33 E;  4L8N A;  2V86 A;  1SR9 A;  4DV4 E;  1T4N A;  5BR8 E;  3HPS A;  2ZM6 E;  1T4L B;  2MDR A;  1GQE A;  2B9D A;  4LTY A;  4WSP A;  4DR6 E;  2DMY A;  4NXN E;  4B3T E;  4TUI A;  3HPZ A;  4BMJ A;  2VQE E;  4JI7 E;  1HNX E;  3AUZ A;  3J7Y p;  2ODR C;  3LML A;  2UU9 E;  2VQF E;  2NUG A;  2IHR 1;  5AE1 A;  2L33 A;  2HHH E;  4F54 A;  4F9B B;  4LF9 E;  4DUZ E;  2L8T A;  4NXM E;  4YHH E;  3ADI A;  4M0V A;  3OML A;  4R03 A;  1N34 E;  4DR5 E;  3AV0 A;  4LF7 E;  4KZS A;  1DI2 A;  4DV2 E;  5T6J A;  1I94 E;  1YYW A;  5LMU E;  2UXD E;  2KON A;  4L5N C;  5CFF E;  5ADZ A;  1J26 A;  4X8W A;  3IWB A;  4LF4 E;  4LF5 E;  1XMQ E;  2N3H A;  3J81 C;  3IWC A;  4DV6 E;  2LUQ A;  5DNY A;  4WYQ B;  2JWO A;  4LU9 A;  5LMN E;  4B3M E;  5F3W A;  1QU6 A;  2V83 A;  4J8Z A;  4LFA E;  2ODR D;  3OTO E;  1XMO E;  2NA2 A;  2JY9 A;  4X65 E;  4P78 A;  3P1X A;  4JI0 E;  1YYO A;  2JOX A;  2DSY A;  4K0K E;  3ADL A;  2FTX B;  2B7V A;  2L2M A;  1FJG E;  2K4V A;  4X64 E;  1X47 A;  2CPN A;  2KHX A;  1ZBQ A;  4BS9 A;  2JOB A;  4DV1 E;  1XNQ E;  4GKJ E;  4WPY A;  4P7D A;  1UHZ A;  4KHP E;  2V88 A;  3JAM C;  4JI4 E;  1O0W A;  5IT9 C;  4BC9 A;  2V87 A;  5AE3 A;  4X66 E;  2V8Q B;  3F6G A;  2LUP B;  1XNR E;  1YZ9 A;  1EKZ A;  2L3C A;  2LJH A;  4DV0 E;  2LTS A;  4BBY A;  1PKP A;  3KWR A;  2NUF A;  1T4O A;  3ADJ A;  2YT4 A;  4LF8 E;  2G7H A;  4JYA E;  4DUY E;  5FLX C;  1RQ0 A;  3HQ1 A;  1N36 E;  2FV4 B;  3C4B A;  3K6Q A;  1GZ6 A;  3VK6 A;  4DR2 E;  2JR1 A;  3FIG A;  4DR7 E;  3HXL A;  3C4T A;  3F6H A;  1DQ3 A;  2LTR A;  4F9A B;  1IBK E;  1WXR A;  1HNZ E;  1N32 E;  1YYK A;  4DR3 E;  1X49 A;  2L2N A;  2LE2 A;  3H09 A;  2VF1 A;  2EZ6 A;  4JI6 E;  4AQY E;  1IBL E;  4DR4 E;  2KOU A;  2N3G A;  4F9C B;  2DIX A;  2V85 A;  2F8B A;  3ADG A;  2E5L E;  4B3R E;  2LBS B;  1WHQ A;  2MC5 A;  4LFB E;  3T1Y E;  1J5E E;  2RSM A;  3RMP A;  4OX9 E;  3DJW A;  2H36 X;  2FGG A;  4M30 A;  4YY3 E;  2RTX A;  5A2Q C;  1X48 A;  3IWD A;  2L3J A;  1RC7 A;  4JI2 E;  2UXC E;  1FKA E;  3DF6 A;  2UUB E;  4M2Z A;  2B7T A;  4DKK A;  2VE7 C;  2L92 A;  2NUE A;  4BC7 A;  4GKK E;  2JVA A;  5AE2 A;  4DR1 E;  2RS6 A;  4DV7 E;  4X62 E;  2MC6 A;  2V89 A;  2M4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...