3DF6A

The thermo- and acido-stable orf-99 from the archaeal virus afv1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
DTHEFHKLLIKVVDLFLEDRIKEFEMKLNTTLDELEFEELIGKPDSSNSAENNGIFIDEYSYDASENAMKKLFVEYVRQPEFKYTVLSIKGVNDWVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, unknown function
molecule keywords ORF99
publication title The thermo- and acido-stable ORF-99 from the archaeal virus AFV1
pubmed doi rcsb
source organism Acidianus filamentous virus 1
total genus 27
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07118 DUF1374 Protein of unknown function (DUF1374)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.300 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3df6A00
3DF6A 3DJWA 2H36X
chains in the Genus database with same CATH superfamily
2L2MA 2YWQA 1IMUA 4P78A 2YT4A 3C4BA 1FKAE 1ZAAC 1N32E 2UXBE 2IHR1 4WXCA 4HEIA 2EN3A 1PJSA 2MKNA 5AE1A 2L3CA 2I9IA 4B3ME 4RHBB 4R2RA 3HQ1A 4DKKA 1ZU1A 2VF1A 1G2DC 2VQFE 2L92A 2YTJA 2CT1A 1T39A 2F8BA 1XMQE 4WFTA 4JI2E 1PJQA 2ENCA 3JU0A 4I8OA 5FLXC 3IWBA 1DGCA 4JV5E 1IQSA 2EOMA 2EPOA 2VE7C 2EQ3A 4JI4E 1MEYC 2GLIA 1ZBQA 1BBOA 4WX9A 4BBYA 3MHHC 1PKPA 1Z1BA 1TF6A 1X5WA 1PDAA 3ADJA 2J7JA 4X8WA 4JI8E 1HNXE 4DV0E 4R2DA 4WSGA 5A6AA 1TN9A 2LRSA 2EOOA 3KWRA 4B3SE 3J81C 3OTOE 1A1HA 3LMLA 1T4NA 4Q28A 3BF2A 4DR7E 1KYQA 2EJ4A 4MLQA 3KZYA 4GZNC 2NUEA 2YRKA 2BB8A 2L2KB 2EOSA 2V89A 2I13A 2E1MA 1N36E 3EPHA 1KJKA 5AASA 1WHQA 4LTYA 2ENHA 1EH7A 4R2EA 1ZBTA 2HC5A 3DF6A 2DMYA 1MGTA 2EMIA 2EPPA 2MC6A 1A1IA 4DUYE 2EPXA 1G2FC 4F2JC 2CSHA 1GQEA 3AV0A 2WBUA 1AH5A 5IXMB 2YTIA 2WZOA 2YU5A 5KL6A 2EN4A 1WRJA 4DR4E 3T1YE 4KZSA 1B69A 4M0VA 3AUZA 2DMIA 1IQOA 2YTFA 2EMHA 4M2ZA 1LLMC 2EPZA 1UN6B 1F2IG 2YSOA 2R1FA 2V88A 2L6MA 3MSWA 3P1XA 2EMCA 4LFCE 5DNYA 2EL4A 2EOHA 1XNRE 4F9CB 2E72A 2EMKA 3J7AG 4L5NC 2ELYA 2EM4A 4LU9A 4LF4E 4JI7E 5CFFE 2NA2A 4X65E 2LJUA 4O24A 2EM0A 3VYXA 5F3WA 5BR8E 2EQ0A 4DV7E 2DRPA 1L4SA 2YZTA 2GPIA 4AQYE 1FJGE 1JK2A 4R03A 3HPZA 2YU8A 4O5GA 4RH8A 3THOB 1GTKA 2BBGA 4LF9E 1BB8A 4X9JA 3C4TA 2UU9E 2N8XA 4BHBA 4LFBE 1A1FA 4R8OA 2EN6A 2V87A 4L8NA 2FTXB 4ZYHA 4DR6E 1RC7A 4LF8E 2EOFA 5AC4A 1IBKE 2DGCA 4X62E 3FIGA 4IS1C 1QU6A 3VHTB 2EMZA 3KZZA 2K4VA 1WJPA 4WSPA 2UUBE 2YTNA 1YZ9A 4YY3E 3H09A 3C6MA 1X6HA 2EMXA 1J5EE 2UUCE 5IT9C 4WPYA 2ENAA 5AE2A 1NEIA 2H36X 3ADLA 1EH6A 5A6BA 1YYWA 2CTDA 3ADGA 5AE3A 2EM8A 3HTXA 4O43A 4BCAA 4KWYA 2NABA 4IJDA 3J80C 3C6KA 4R2QA 5A6JA 5IWAE 1YUIA 2N3HA 4GKKE 2FGGA 1STUA 3JTZA 2LT7A 4M30A 4BS9A 2YRHA 2V83A 3HPSA 1EKZA 4DR2E 1IBLE 2FV4B 2EOJA 2JPAA 3UK3C 4WYQB 2JVAA 2DIXA 1X48A 1O0WA 4X66E 4DUZE 4JI0E 2LV2A 2L8TA 4O4KA 1P47A 2LTRA 3THNA 3OMLA 2ODRD 1X3CA 2EPMX 4DV5E 3ZOQB 2L2NA 1T38A 2EMAA 3IWCA 4DV2E 2EN7A 3K6QA 4LF6E 1T4LB 4R2SA 5TSEA 2YTPA 2JXPA 2M9AA 3F6GA 1YPNA 2LJHA 1UILA 2WCC3 2LTSA 2KONA 2RQLA 2CPNA 4DR1E 3ECRA 4NZVA 1ZR9A 4N4RB 5A2QC 2RS7A 2YTEA 2VRDA 1JK1A 1A1GA 1YUJA 2EN1A 2UXDE 2DB2A 2LUQA 2EOXA 2EOZA 3IWDA 2DLKA 4JYAE 1HNWE 3EQ1A 2EM5A 1YFHA 4NXME 5AC5A 2MC5A 2F4VE 2HHHE 1DQ3A 1X6EA 2EOQA 4TUGA 5ADZA 5LL6R 5KL4A 1X49A 2EPCA 5LLQA 1SR9A 4JI5E 2ELZA 2YPNA 2EWLA 2UUAE 5KL7A 1WXRA 2NUFA 2EPLX 4FK5C 2MKDA 2YTQA 4KHPE 5KL3A 3T1HE 4LFAE 2HGHA 1NCSA 2R76A 4BHCA 4NXNE 2UXCE 4DV4E 4Q35B 4F6NA 1GZ6A 2LCEA 4TUIA 2LBSB 3VK6A 2K7IA 3QG5C 4DV1E 3RMPA 3VYYA 3L00A 2JR1A 2B7VA 2EPAA 2VQEE 1X6FA 2V85A 2EP3A 2EORA 3BIDA 2RPCA 1XNQE 2L33A 2JY9A 1BBGA 3F6HA 1RMDA 2WBTA 5LMUE 2M4IA 4JI6E 1HR0E 4X64E 4MLVA 1I94E 4BC7A 4DMIA 2YTDA 5A6BD 2EM7A 4R2CA 4ZYDA 4DV6E 2LVHA 2YTOA 4LF7E 1N3GA 2B3TB 4BMJA 4OOGC 4DR5E 2D9HA 2YRMA 5LMNE 1YYOA 4NHRA 2YTGA 2B7TA 5IV8B 1DI2A 2EM2A 1EH8A 2V8QB 1X47A 2JOXA 3EPKA 1YSAC 2RTXA 4LF5E 1RQ0A 4JI3E 2EE8A 2EL5A 2PRTA 4HTGA 3HXLA 2G7HA 1A1JA 1QNTA 2JYAA 4R2PA 4P7DA 4WXDA 1J26A 1UHZA 2EMLA 2ODRC 4K0KE 4GEQB 1YYKA 3BGHA 2Q8UA 3JAMC 1PJTA 1HNZE 2EN2A 1N34E 2EM9A 2RS6A 2V86A 2L3JA 2EMGA 2EMBA 5KL5A 2EQ1A 5KL2A 4R2AA 2EMYA 5A69A 2B9DA 2HJJA 2KOUA 4J8ZA 4GKJE 3LLHA 3TQMA 2EM3A 2NUGA 2JOBA 4ZYGA 1XMOE 1IBME 4DR3E 2RSIA 2KHXA 4OX9E 3M99B 2DSYA 2EOYA 4BC9A 2DLQA 2EPUA 3DJWA 3MHSC 1A1KA 2EL6A 2JWOA 2EOEA 4M9VC 2EZ6A 4F54A 4F9BB 2EPNA 2JP9A 2YSPA 4ZYEA 2ZM6E 2LUPB 1WHNA 3J7Yp 1A1LA 2RSMA 2EN8A 3BBGA 2EPKX 4JI1E 2LE2A 2LMZA 2M7QA 5A6KA 3EPLA 2EM6A 2GHFA 2A25A 4YHHE 1T4OA 2N3GA 2M1SA 2EMWA 4DV3E 5T6JA 1SFEA 2EMFA 1UBDC 2WBSA 3ADIA 2EPRA 2MDRA 4B3RE 4F6MA 4B3TE 2LO3A 2ADRA 1AAYA 3EPJA 1N33E 1TF3A 2E5LE 4F9AB 2MDGA 2EOIA
chains in the Genus database with same CATH topology
2L2MA 1O0WA 4X66E 4DV6E 4DUZE 3T1YE 4JI0E 4P78A 4KZSA 2YT4A 2L8TA 3AUZA 3C4BA 4M0VA 1FKAE 2LTRA 4LF7E 3OMLA 2ODRD 1N32E 4M2ZA 2B3TB 4DV5E 4BMJA 4OOGC 2UXBE 3ZOQB 4DR5E 2L2NA 2IHR1 5LMNE 3IWCA 4DV2E 2V88A 1YYOA 2L6MA 3K6QA 4LF6E 1T4LB 3MSWA 5AE1A 2B7TA 3P1XA 2L3CA 4B3ME 4LFCE 1DI2A 5DNYA 3HQ1A 4DKKA 2V8QB 2VF1A 1X47A 1XNRE 4F9CB 3F6GA 2VQFE 2JOXA 2L92A 3J7AG 4L5NC 2LJHA 2F8BA 2RTXA 1UILA 4LU9A 1XMQE 4LF4E 4LF5E 4JI7E 4WFTA 1RQ0A 2NA2A 2LTSA 5CFFE 4X65E 4JI3E 4JI2E 2KONA 3VYXA 5F3WA 5BR8E 3JU0A 3HXLA 2G7HA 4DV7E 2CPNA 4I8OA 2YZTA 5FLXC 4DR1E 3IWBA 4AQYE 1FJGE 4JV5E 4P7DA 1J26A 1UHZA 2ODRC 4K0KE 4GEQB 2RS7A 2VE7C 3HPZA 4R03A 5A2QC 4JI4E 1YYKA 1ZBQA 3JAMC 4LF9E 1HNZE 2UXDE 4BBYA 2DB2A 1N34E 3C4TA 2LUQA 2UU9E 1PKPA 2RS6A 2V86A 2L3JA 4LFBE 3IWDA 4R8OA 2V87A 4JYAE 4L8NA 2FTXB 1HNWE 4DR6E 1RC7A 4LF8E 4NXME 2MC5A 2F4VE 1IBKE 1DQ3A 3ADJA 4X8WA 2HHHE 4JI8E 1HNXE 2B9DA 4DV0E 4TUGA 4X62E 5ADZA 2KOUA 3FIGA 4J8ZA 1QU6A 5LL6R 1X49A 4GKJE 3LLHA 1SR9A 4JI5E 2NUGA 2JOBA 2EWLA 1XMOE 1IBME 2K4VA 4WSPA 4DR3E 2UUAE 2LRSA 2UUBE 1WXRA 1YZ9A 2NUFA 3KWRA 4YY3E 4B3SE 3H09A 2KHXA 3J81C 3OTOE 4KHPE 4OX9E 3T1HE 3LMLA 4LFAE 1T4NA 2DSYA 1J5EE 4Q28A 2UUCE 4BC9A 4DR7E 5IT9C 4WPYA 5AE2A 4NXNE 2UXCE 3DJWA 2H36X 4DV4E 3ADLA 2JWOA 2EZ6A 2NUEA 1GZ6A 4F54A 4F9BB 2L2KB 1YYWA 3ADGA 5AE3A 4TUIA 2LBSB 3VK6A 3HTXA 2V89A 4BCAA 2ZM6E 1WHNA 2E1MA 3J7Yp 2LUPB 4DV1E 3RMPA 1N36E 2RSMA 5AASA 3J80C 4JI1E 1WHQA 4LTYA 3VYYA 2JR1A 2LE2A 2LMZA 2M7QA 2B7VA 5IWAE 2N3HA 2VQEE 4GKKE 4YHHE 1T4OA 2FGGA 2N3GA 2V85A 1ZBTA 1STUA 2M1SA 3JTZA 3DF6A 2DMYA 4M30A 4DV3E 5T6JA 4BS9A 2MC6A 4DUYE 3ADIA 2V83A 1XNQE 4DR4E 3HPSA 1EKZA 2L33A 2MDRA 2JY9A 4B3RE 3F6HA 4B3TE 4DR2E 1IBLE 2FV4B 1GQEA 5LMUE 2M4IA 3AV0A 4JI6E 1HR0E 4X64E 1I94E 4BC7A 4DMIA 1N33E 4WYQB 2JVAA 2WZOA 2E5LE 2DIXA 4F9AB 1X48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DF6 A;  3DJW A;  2H36 X; 
#chains in the Genus database with same CATH topology
 2L2M A;  2YWQ A;  1IMU A;  4P78 A;  2YT4 A;  3C4B A;  1FKA E;  1ZAA C;  1N32 E;  2UXB E;  2IHR 1;  4WXC A;  4HEI A;  2EN3 A;  1PJS A;  2MKN A;  5AE1 A;  2L3C A;  2I9I A;  4B3M E;  4RHB B;  4R2R A;  3HQ1 A;  4DKK A;  1ZU1 A;  2VF1 A;  1G2D C;  2VQF E;  2L92 A;  2YTJ A;  2CT1 A;  1T39 A;  2F8B A;  1XMQ E;  4WFT A;  4JI2 E;  1PJQ A;  2ENC A;  3JU0 A;  4I8O A;  5FLX C;  3IWB A;  1DGC A;  4JV5 E;  1IQS A;  2EOM A;  2EPO A;  2VE7 C;  2EQ3 A;  4JI4 E;  1MEY C;  2GLI A;  1ZBQ A;  1BBO A;  4WX9 A;  4BBY A;  3MHH C;  1PKP A;  1Z1B A;  1TF6 A;  1X5W A;  1PDA A;  3ADJ A;  2J7J A;  4X8W A;  4JI8 E;  1HNX E;  4DV0 E;  4R2D A;  4WSG A;  5A6A A;  1TN9 A;  2LRS A;  2EOO A;  3KWR A;  4B3S E;  3J81 C;  3OTO E;  1A1H A;  3LML A;  1T4N A;  4Q28 A;  3BF2 A;  4DR7 E;  1KYQ A;  2EJ4 A;  4MLQ A;  3KZY A;  4GZN C;  2NUE A;  2YRK A;  2BB8 A;  2L2K B;  2EOS A;  2V89 A;  2I13 A;  2E1M A;  1N36 E;  3EPH A;  1KJK A;  5AAS A;  1WHQ A;  4LTY A;  2ENH A;  1EH7 A;  4R2E A;  1ZBT A;  2HC5 A;  3DF6 A;  2DMY A;  1MGT A;  2EMI A;  2EPP A;  2MC6 A;  1A1I A;  4DUY E;  2EPX A;  1G2F C;  4F2J C;  2CSH A;  1GQE A;  3AV0 A;  2WBU A;  1AH5 A;  5IXM B;  2YTI A;  2WZO A;  2YU5 A;  5KL6 A;  2EN4 A;  1WRJ A;  4DR4 E;  3T1Y E;  4KZS A;  1B69 A;  4M0V A;  3AUZ A;  2DMI A;  1IQO A;  2YTF A;  2EMH A;  4M2Z A;  1LLM C;  2EPZ A;  1UN6 B;  1F2I G;  2YSO A;  2R1F A;  2V88 A;  2L6M A;  3MSW A;  3P1X A;  2EMC A;  4LFC E;  5DNY A;  2EL4 A;  2EOH A;  1XNR E;  4F9C B;  2E72 A;  2EMK A;  3J7A G;  4L5N C;  2ELY A;  2EM4 A;  4LU9 A;  4LF4 E;  4JI7 E;  5CFF E;  2NA2 A;  4X65 E;  2LJU A;  4O24 A;  2EM0 A;  3VYX A;  5F3W A;  5BR8 E;  2EQ0 A;  4DV7 E;  2DRP A;  1L4S A;  2YZT A;  2GPI A;  4AQY E;  1FJG E;  1JK2 A;  4R03 A;  3HPZ A;  2YU8 A;  4O5G A;  4RH8 A;  3THO B;  1GTK A;  2BBG A;  4LF9 E;  1BB8 A;  4X9J A;  3C4T A;  2UU9 E;  2N8X A;  4BHB A;  4LFB E;  1A1F A;  4R8O A;  2EN6 A;  2V87 A;  4L8N A;  2FTX B;  4ZYH A;  4DR6 E;  1RC7 A;  4LF8 E;  2EOF A;  5AC4 A;  1IBK E;  2DGC A;  4X62 E;  3FIG A;  4IS1 C;  1QU6 A;  3VHT B;  2EMZ A;  3KZZ A;  2K4V A;  1WJP A;  4WSP A;  2UUB E;  2YTN A;  1YZ9 A;  4YY3 E;  3H09 A;  3C6M A;  1X6H A;  2EMX A;  1J5E E;  2UUC E;  5IT9 C;  4WPY A;  2ENA A;  5AE2 A;  1NEI A;  2H36 X;  3ADL A;  1EH6 A;  5A6B A;  1YYW A;  2CTD A;  3ADG A;  5AE3 A;  2EM8 A;  3HTX A;  4O43 A;  4BCA A;  4KWY A;  2NAB A;  4IJD A;  3J80 C;  3C6K A;  4R2Q A;  5A6J A;  5IWA E;  1YUI A;  2N3H A;  4GKK E;  2FGG A;  1STU A;  3JTZ A;  2LT7 A;  4M30 A;  4BS9 A;  2YRH A;  2V83 A;  3HPS A;  1EKZ A;  4DR2 E;  1IBL E;  2FV4 B;  2EOJ A;  2JPA A;  3UK3 C;  4WYQ B;  2JVA A;  2DIX A;  1X48 A;  1O0W A;  4X66 E;  4DUZ E;  4JI0 E;  2LV2 A;  2L8T A;  4O4K A;  1P47 A;  2LTR A;  3THN A;  3OML A;  2ODR D;  1X3C A;  2EPM X;  4DV5 E;  3ZOQ B;  2L2N A;  1T38 A;  2EMA A;  3IWC A;  4DV2 E;  2EN7 A;  3K6Q A;  4LF6 E;  1T4L B;  4R2S A;  5TSE A;  2YTP A;  2JXP A;  2M9A A;  3F6G A;  1YPN A;  2LJH A;  1UIL A;  2WCC 3;  2LTS A;  2KON A;  2RQL A;  2CPN A;  4DR1 E;  3ECR A;  4NZV A;  1ZR9 A;  4N4R B;  5A2Q C;  2RS7 A;  2YTE A;  2VRD A;  1JK1 A;  1A1G A;  1YUJ A;  2EN1 A;  2UXD E;  2DB2 A;  2LUQ A;  2EOX A;  2EOZ A;  3IWD A;  2DLK A;  4JYA E;  1HNW E;  3EQ1 A;  2EM5 A;  1YFH A;  4NXM E;  5AC5 A;  2MC5 A;  2F4V E;  2HHH E;  1DQ3 A;  1X6E A;  2EOQ A;  4TUG A;  5ADZ A;  5LL6 R;  5KL4 A;  1X49 A;  2EPC A;  5LLQ A;  1SR9 A;  4JI5 E;  2ELZ A;  2YPN A;  2EWL A;  2UUA E;  5KL7 A;  1WXR A;  2NUF A;  2EPL X;  4FK5 C;  2MKD A;  2YTQ A;  4KHP E;  5KL3 A;  3T1H E;  4LFA E;  2HGH A;  1NCS A;  2R76 A;  4BHC A;  4NXN E;  2UXC E;  4DV4 E;  4Q35 B;  4F6N A;  1GZ6 A;  2LCE A;  4TUI A;  2LBS B;  3VK6 A;  2K7I A;  3QG5 C;  4DV1 E;  3RMP A;  3VYY A;  3L00 A;  2JR1 A;  2B7V A;  2EPA A;  2VQE E;  1X6F A;  2V85 A;  2EP3 A;  2EOR A;  3BID A;  2RPC A;  1XNQ E;  2L33 A;  2JY9 A;  1BBG A;  3F6H A;  1RMD A;  2WBT A;  5LMU E;  2M4I A;  4JI6 E;  1HR0 E;  4X64 E;  4MLV A;  1I94 E;  4BC7 A;  4DMI A;  2YTD A;  5A6B D;  2EM7 A;  4R2C A;  4ZYD A;  4DV6 E;  2LVH A;  2YTO A;  4LF7 E;  1N3G A;  2B3T B;  4BMJ A;  4OOG C;  4DR5 E;  2D9H A;  2YRM A;  5LMN E;  1YYO A;  4NHR A;  2YTG A;  2B7T A;  5IV8 B;  1DI2 A;  2EM2 A;  1EH8 A;  2V8Q B;  1X47 A;  2JOX A;  3EPK A;  1YSA C;  2RTX A;  4LF5 E;  1RQ0 A;  4JI3 E;  2EE8 A;  2EL5 A;  2PRT A;  4HTG A;  3HXL A;  2G7H A;  1A1J A;  1QNT A;  2JYA A;  4R2P A;  4P7D A;  4WXD A;  1J26 A;  1UHZ A;  2EML A;  2ODR C;  4K0K E;  4GEQ B;  1YYK A;  3BGH A;  2Q8U A;  3JAM C;  1PJT A;  1HNZ E;  2EN2 A;  1N34 E;  2EM9 A;  2RS6 A;  2V86 A;  2L3J A;  2EMG A;  2EMB A;  5KL5 A;  2EQ1 A;  5KL2 A;  4R2A A;  2EMY A;  5A69 A;  2B9D A;  2HJJ A;  2KOU A;  4J8Z A;  4GKJ E;  3LLH A;  3TQM A;  2EM3 A;  2NUG A;  2JOB A;  4ZYG A;  1XMO E;  1IBM E;  4DR3 E;  2RSI A;  2KHX A;  4OX9 E;  3M99 B;  2DSY A;  2EOY A;  4BC9 A;  2DLQ A;  2EPU A;  3DJW A;  3MHS C;  1A1K A;  2EL6 A;  2JWO A;  2EOE A;  4M9V C;  2EZ6 A;  4F54 A;  4F9B B;  2EPN A;  2JP9 A;  2YSP A;  4ZYE A;  2ZM6 E;  2LUP B;  1WHN A;  3J7Y p;  1A1L A;  2RSM A;  2EN8 A;  3BBG A;  2EPK X;  4JI1 E;  2LE2 A;  2LMZ A;  2M7Q A;  5A6K A;  3EPL A;  2EM6 A;  2GHF A;  2A25 A;  4YHH E;  1T4O A;  2N3G A;  2M1S A;  2EMW A;  4DV3 E;  5T6J A;  1SFE A;  2EMF A;  1UBD C;  2WBS A;  3ADI A;  2EPR A;  2MDR A;  4B3R E;  4F6M A;  4B3T E;  2LO3 A;  2ADR A;  1AAY A;  3EPJ A;  1N33 E;  1TF3 A;  2E5L E;  4F9A B;  2MDG A;  2EOI A; 
#chains in the Genus database with same CATH homology
 2L2M A;  1O0W A;  4X66 E;  4DV6 E;  4DUZ E;  3T1Y E;  4JI0 E;  4P78 A;  4KZS A;  2YT4 A;  2L8T A;  3AUZ A;  3C4B A;  4M0V A;  1FKA E;  2LTR A;  4LF7 E;  3OML A;  2ODR D;  1N32 E;  4M2Z A;  2B3T B;  4DV5 E;  4BMJ A;  4OOG C;  2UXB E;  3ZOQ B;  4DR5 E;  2L2N A;  2IHR 1;  5LMN E;  3IWC A;  4DV2 E;  2V88 A;  1YYO A;  2L6M A;  3K6Q A;  4LF6 E;  1T4L B;  3MSW A;  5AE1 A;  2B7T A;  3P1X A;  2L3C A;  4B3M E;  4LFC E;  1DI2 A;  5DNY A;  3HQ1 A;  4DKK A;  2V8Q B;  2VF1 A;  1X47 A;  1XNR E;  4F9C B;  3F6G A;  2VQF E;  2JOX A;  2L92 A;  3J7A G;  4L5N C;  2LJH A;  2F8B A;  2RTX A;  1UIL A;  4LU9 A;  1XMQ E;  4LF4 E;  4LF5 E;  4JI7 E;  4WFT A;  1RQ0 A;  2NA2 A;  2LTS A;  5CFF E;  4X65 E;  4JI3 E;  4JI2 E;  2KON A;  3VYX A;  5F3W A;  5BR8 E;  3JU0 A;  3HXL A;  2G7H A;  4DV7 E;  2CPN A;  4I8O A;  2YZT A;  5FLX C;  4DR1 E;  3IWB A;  4AQY E;  1FJG E;  4JV5 E;  4P7D A;  1J26 A;  1UHZ A;  2ODR C;  4K0K E;  4GEQ B;  2RS7 A;  2VE7 C;  3HPZ A;  4R03 A;  5A2Q C;  4JI4 E;  1YYK A;  1ZBQ A;  3JAM C;  4LF9 E;  1HNZ E;  2UXD E;  4BBY A;  2DB2 A;  1N34 E;  3C4T A;  2LUQ A;  2UU9 E;  1PKP A;  2RS6 A;  2V86 A;  2L3J A;  4LFB E;  3IWD A;  4R8O A;  2V87 A;  4JYA E;  4L8N A;  2FTX B;  1HNW E;  4DR6 E;  1RC7 A;  4LF8 E;  4NXM E;  2MC5 A;  2F4V E;  1IBK E;  1DQ3 A;  3ADJ A;  4X8W A;  2HHH E;  4JI8 E;  1HNX E;  2B9D A;  4DV0 E;  4TUG A;  4X62 E;  5ADZ A;  2KOU A;  3FIG A;  4J8Z A;  1QU6 A;  5LL6 R;  1X49 A;  4GKJ E;  3LLH A;  1SR9 A;  4JI5 E;  2NUG A;  2JOB A;  2EWL A;  1XMO E;  1IBM E;  2K4V A;  4WSP A;  4DR3 E;  2UUA E;  2LRS A;  2UUB E;  1WXR A;  1YZ9 A;  2NUF A;  3KWR A;  4YY3 E;  4B3S E;  3H09 A;  2KHX A;  3J81 C;  3OTO E;  4KHP E;  4OX9 E;  3T1H E;  3LML A;  4LFA E;  1T4N A;  2DSY A;  1J5E E;  4Q28 A;  2UUC E;  4BC9 A;  4DR7 E;  5IT9 C;  4WPY A;  5AE2 A;  4NXN E;  2UXC E;  3DJW A;  2H36 X;  4DV4 E;  3ADL A;  2JWO A;  2EZ6 A;  2NUE A;  1GZ6 A;  4F54 A;  4F9B B;  2L2K B;  1YYW A;  3ADG A;  5AE3 A;  4TUI A;  2LBS B;  3VK6 A;  3HTX A;  2V89 A;  4BCA A;  2ZM6 E;  1WHN A;  2E1M A;  3J7Y p;  2LUP B;  4DV1 E;  3RMP A;  1N36 E;  2RSM A;  5AAS A;  3J80 C;  4JI1 E;  1WHQ A;  4LTY A;  3VYY A;  2JR1 A;  2LE2 A;  2LMZ A;  2M7Q A;  2B7V A;  5IWA E;  2N3H A;  2VQE E;  4GKK E;  4YHH E;  1T4O A;  2FGG A;  2N3G A;  2V85 A;  1ZBT A;  1STU A;  2M1S A;  3JTZ A;  3DF6 A;  2DMY A;  4M30 A;  4DV3 E;  5T6J A;  4BS9 A;  2MC6 A;  4DUY E;  3ADI A;  2V83 A;  1XNQ E;  4DR4 E;  3HPS A;  1EKZ A;  2L33 A;  2MDR A;  2JY9 A;  4B3R E;  3F6H A;  4B3T E;  4DR2 E;  1IBL E;  2FV4 B;  1GQE A;  5LMU E;  2M4I A;  3AV0 A;  4JI6 E;  1HR0 E;  4X64 E;  1I94 E;  4BC7 A;  4DMI A;  1N33 E;  4WYQ B;  2JVA A;  2WZO A;  2E5L E;  2DIX A;  4F9A B;  1X48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...