3DF6A

The thermo- and acido-stable orf-99 from the archaeal virus afv1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
DTHEFHKLLIKVVDLFLEDRIKEFEMKLNTTLDELEFEELIGKPDSSNSAENNGIFIDEYSYDASENAMKKLFVEYVRQPEFKYTVLSIKGVNDWVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF99
publication title The thermo- and acido-stable ORF-99 from the archaeal virus AFV1
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Viral protein, unknown function
total genus 27
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07118 DUF1374 Protein of unknown function (DUF1374)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.300 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3df6A00
2H36X 3DF6A 3DJWA
chains in the Genus database with same CATH superfamily
2CTDA 2ODRC 2V88A 4WSPA 2ODRD 5AE1A 5LLQA 4R2DA 2DB2A 4DV7E 4KHPE 2EPNA 2UUAE 2JOBA 1YYKA 1UN6B 4O5GA 1J5EE 2E72A 2EM3A 2N3GA 2L3CA 2EE8A 2EM5A 3P1XA 1EH6A 2YTOA 3ADGA 1WXRA 4B3TE 2VE7C 3ECRA 1EH8A 4X62E 4BMJA 1X6FA 2EOYA 2HGHA 5KL5A 2EPCA 1T39A 1XNQE 3EPJA 2EMFA 5AC5A 1N3GA 1XMOE 2HC5A 3OTOE 1XMQE 1T4OA 2DSYA 2L2NA 1T4NA 1UILA 4WXCA 1A1FA 4F9CB 1PDAA 2FV4B 1N33E 1ZBTA 2K4VA 2LRSA 2WBUA 2LMZA 3ADIA 1TF6A 2LE2A 4GZNC 2LJHA 4DMIA 2HHHE 1YUJA 2E1MA 3JAMC 2JXPA 2N8XA 4GKJE 2EQ0A 3VYYA 4KWYA 1X48A 2EN3A 4NXNE 4F9BB 3TQMA 3C6KA 1EKZA 4JI8E 2R76A 3J7Yp 2YWQA 2MDGA 2JP9A 4LF5E 3C6MA 2YTFA 2NUGA 2CSHA 2EMXA 1YFHA 2VQEE 4DR1E 2JWOA 3LMLA 2MC6A 2EM0A 2M1SA 3THNA 2EPMX 2D9HA 4JI4E 1PJTA 2UXCE 2RPCA 3JU0A 2EM6A 3THOB 1TF3A 2EN2A 1X3CA 2EMLA 4NXME 4JI6E 2UXDE 4LFBE 4YHHE 4DUZE 4R2PA 4R8OA 4DV0E 2B7VA 2HJJA 1LLMC 2UXBE 1IBLE 4RHBB 5A6JA 2YTEA 2EMWA 3L00A 2K7IA 1HR0E 2EN6A 2LUPB 2L2KB 1UHZA 3RMPA 1MEYC 1G2FC 1YUIA 2F8BA 4R2CA 2EM2A 4GKKE 4F6NA 5A6KA 2CT1A 1N36E 4DV6E 2WZOA 2KHXA 3QG5C 2EMYA 1X6EA 2EMBA 4WX9A 5IT9C 2L6MA 5A69A 4DR3E 5T6JA 1SFEA 1UBDC 4JI0E 2DLQA 2WBTA 3HPZA 2LVHA 4L8NA 2UU9E 4P7DA 4Q28A 2N3HA 4M30A 2LT7A 3T1YE 2EMCA 4I8OA 1YSAC 2VQFE 2V85A 2EL5A 4R2EA 1YPNA 4X65E 5A6BA 4DV1E 3HXLA 2DMYA 1BB8A 2B3TB 2EOOA 2M9AA 2EN1A 3F6GA 3VHTB 1HNZE 4F2JC 4BC7A 5KL7A 1NCSA 1ZBQA 2I13A 2YTPA 5A6BD 2VRDA 3EQ1A 1DGCA 2GPIA 2BB8A 4F6MA 3DF6A 2YRKA 1QU6A 5F3WA 2EWLA 2EPOA 4Q35B 2UUBE 2YSPA 2EM7A 5IWAE 2MC5A 5AE2A 2J7JA 2DLKA 5IV8B 5AC4A 2EOHA 2NUFA 1HNWE 3FIGA 1B69A 2MKDA 4M9VC 2I9IA 3H09A 2L8TA 4JI1E 2V83A 2EMIA 4JI2E 4MLQA 1T4LB 3J81C 2DRPA 2ENAA 4X8WA 2Q8UA 3J80C 2B9DA 2FTXB 4P78A 3AUZA 2L33A 1WRJA 5KL6A 4IJDA 1RMDA 2EZ6A 2DIXA 4B3RE 4K0KE 2EPUA 1MGTA 1YZ9A 2EQ1A 3ZOQB 3LLHA 2EOSA 2M4IA 4DR4E 2DMIA 3EPHA 4MLVA 1X6HA 5CFFE 4BCAA 2EM9A 5IXMB 2B7TA 2NUEA 4KZSA 4M0VA 1G2DC 2MKNA 1RQ0A 1IMUA 3VK6A 4TUGA 2YTQA 2EPXA 3BIDA 1F2IG 4O4KA 2RSIA 1HNXE 4YY3E 1J26A 4DV5E 4BS9A 4M2ZA 4LF6E 5LMNE 2RSMA 1NEIA 3KWRA 1A1GA 4R2QA 4LF4E 1ZR9A 2VF1A 2ZM6E 1PJQA 4F54A 4J8ZA 2EPPA 4OOGC 4DUYE 1Z1BA 4N4RB 3UK3C 3IWCA 2MDRA 2YU8A 1WHQA 3C4TA 2ENCA 1EH7A 2YTNA 2RQLA 5A2QC 1GQEA 3BBGA 2EOZA 2LTSA 5TSEA 2EOJA 3IWDA 1TN9A 4WFTA 2E5LE 2CPNA 4LFCE 3J7AG 2V87A 1ZAAC 1IQOA 2JR1A 2IHR1 4JI5E 5A6AA 1KYQA 3KZYA 4WSGA 2EN4A 2LBSB 2V86A 1IQSA 3DJWA 4JI7E 2KONA 2YSOA 2PRTA 2ENHA 3EPKA 4LFAE 2ELZA 3C4BA 2EMGA 1A1KA 4GEQB 5DNYA 1ZU1A 2F4VE 2YTIA 5BR8E 4LF9E 1WJPA 2JOXA 3ADJA 3F6HA 3ADLA 4JV5E 4X66E 3HQ1A 5AASA 3BGHA 1RC7A 2JVAA 3M99B 4DV2E 3HPSA 2NA2A 1IBKE 4ZYDA 5LL6R 1XNRE 2EN7A 4WXDA 1X47A 2WBSA 1GTKA 4F9AB 2EOQA 3KZZA 3MHSC 1AH5A 4TUIA 1X5WA 4X64E 3T1HE 1A1JA 2EOEA 3VYXA 2G7HA 4NZVA 1JK1A 2RS6A 1AAYA 1N32E 2YT4A 2YTJA 5FLXC 4ZYHA 5KL3A 2L92A 2YPNA 1X49A 2KOUA 4BC9A 4ZYEA 2LV2A 4JYAE 4ZYGA 1SR9A 2EPRA 4LF8E 4DR2E 2H36X 1KJKA 4BHCA 4HTGA 3BF2A 5AE3A 2EP3A 3HTXA 2EM4A 2EOXA 2EMZA 1PJSA 5KL4A 2L3JA 1GZ6A 2EOFA 5LMUE 1JK2A 2EMKA 5KL2A 3JTZA 4WPYA 1BBOA 2R1FA 2EJ4A 2YZTA 1DQ3A 4RH8A 2LTRA 2YTGA 2NABA 2EPKX 2GLIA 1I94E 3MSWA 2LCEA 2EQ3A 2GHFA 2EMAA 2V89A 4WYQB 4DV3E 1STUA 2L2MA 4NHRA 1YYWA 1YYOA 2YRMA 4R2RA 2EL4A 2ELYA 2UUCE 1DI2A 1FKAE 4LU9A 4HEIA 4DR7E 2JYAA 3K6QA 4R2AA 2M7QA 2JY9A 2EL6A 4R2SA 1T38A 4BBYA 2EORA 4AQYE 2A25A 4DV4E 4B3ME 2ADRA 2BBGA 1WHNA 2LJUA 3OMLA 2RS7A 1FJGE 1A1IA 2DGCA 4O24A 4X9JA 1P47A 4R03A 4DR5E 4DKKA 2LO3A 1IBME 2EPLX 4LF7E 3EPLA 2LUQA 1A1LA 4B3SE 4L5NC 2EPAA 2RTXA 3IWBA 2YTDA 2EOIA 2EN8A 4JI3E 4BHBA 2YRHA 1PKPA 2V8QB 3AV0A 2WCC3 2EOMA 1N34E 1O0WA 4LTYA 2EMHA 1QNTA 2YU5A 4DR6E 2FGGA 4OX9E 5ADZA 3MHHC 2EPZA 4IS1C 1L4SA 4O43A 4FK5C 1A1HA 2EM8A 1BBGA 2JPAA
chains in the Genus database with same CATH topology
3AUZA 2L33A 2ODRC 2V88A 1IBLE 2UXBE 2RS6A 2EZ6A 2DIXA 4B3RE 4K0KE 4WSPA 2ODRD 1YZ9A 1N32E 5AE1A 2YT4A 2DB2A 3LLHA 3ZOQB 5FLXC 4DV7E 1HR0E 2M4IA 2L92A 4KHPE 4DR4E 1X49A 2KOUA 4BC9A 2JOBA 2UUAE 4JYAE 2LUPB 1SR9A 4LF8E 5CFFE 2L2KB 1YYKA 4BCAA 4DR2E 1UHZA 2H36X 3RMPA 2B7TA 2NUEA 1J5EE 4KZSA 4M0VA 5AE3A 3HTXA 1RQ0A 2F8BA 3VK6A 4TUGA 2L3JA 1GZ6A 2N3GA 5LMUE 4GKKE 2L3CA 3P1XA 1HNXE 4YY3E 1J26A 3ADGA 4DV5E 3JTZA 4BS9A 1WXRA 4WPYA 1N36E 4B3TE 4DV6E 4M2ZA 4LF6E 2WZOA 2KHXA 2VE7C 4X62E 5LMNE 2RSMA 2YZTA 4BMJA 1DQ3A 3KWRA 2LTRA 4LF4E 2VF1A 1I94E 3MSWA 2ZM6E 5IT9C 4F54A 4J8ZA 4OOGC 2L6MA 2V89A 4WYQB 1XNQE 4DUYE 4DV3E 1STUA 4DR3E 5T6JA 1XMOE 2L2MA 3IWCA 4JI0E 2MDRA 1WHQA 3OTOE 3C4TA 1XMQE 3HPZA 2UU9E 4L8NA 5A2QC 1YYWA 1T4OA 1GQEA 2DSYA 2L2NA 4P7DA 4Q28A 1YYOA 1T4NA 2N3HA 4M30A 1UILA 2UUCE 2LTSA 3T1YE 4I8OA 3IWDA 1DI2A 4F9CB 1FKAE 4LU9A 4WFTA 2FV4B 2E5LE 2CPNA 2VQFE 4LFCE 2V85A 1N33E 1ZBTA 3J7AG 2K4VA 2LRSA 4X65E 2LMZA 4DR7E 3ADIA 4DV1E 2LE2A 2V87A 3HXLA 2DMYA 3K6QA 2M7QA 2B3TB 2JY9A 2LJHA 4DMIA 2HHHE 2JR1A 2IHR1 3F6GA 4JI5E 2E1MA 1HNZE 3JAMC 4BBYA 4BC7A 4AQYE 4GKJE 2LBSB 3VYYA 1ZBQA 2V86A 1X48A 3DJWA 4DV4E 4JI7E 4NXNE 2KONA 4F9BB 4B3ME 1WHNA 2RS7A 3OMLA 1EKZA 4JI8E 4LFAE 3J7Yp 3C4BA 1FJGE 4GEQB 5DNYA 4LF5E 2F4VE 3DF6A 2NUGA 4R03A 5BR8E 4DR5E 4DKKA 2VQEE 4DR1E 1QU6A 5F3WA 2JWOA 3LMLA 1IBME 2EWLA 2MC6A 4LF9E 4LF7E 2M1SA 2UUBE 2JOXA 3ADJA 2LUQA 3F6HA 5IWAE 4B3SE 3ADLA 2MC5A 4X66E 4L5NC 3HQ1A 5AASA 5AE2A 3IWBA 2RTXA 4JV5E 4JI4E 1RC7A 2JVAA 4DV2E 2UXCE 3HPSA 4JI3E 2NA2A 1IBKE 2NUFA 5LL6R 3JU0A 1PKPA 2V8QB 1HNWE 1XNRE 3AV0A 3FIGA 1X47A 1N34E 1O0WA 4NXME 4LTYA 4F9AB 4DR6E 3H09A 3VYXA 4JI6E 2UXDE 2L8TA 4LFBE 4JI1E 2FGGA 2V83A 4YHHE 4OX9E 5ADZA 4JI2E 4DUZE 1T4LB 4TUIA 4R8OA 3J81C 4X8WA 4X64E 4DV0E 3J80C 2B7VA 3T1HE 2B9DA 2FTXB 2G7HA 4P78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H36 X;  3DF6 A;  3DJW A; 
#chains in the Genus database with same CATH topology
 2CTD A;  2ODR C;  2V88 A;  4WSP A;  2ODR D;  5AE1 A;  5LLQ A;  4R2D A;  2DB2 A;  4DV7 E;  4KHP E;  2EPN A;  2UUA E;  2JOB A;  1YYK A;  1UN6 B;  4O5G A;  1J5E E;  2E72 A;  2EM3 A;  2N3G A;  2L3C A;  2EE8 A;  2EM5 A;  3P1X A;  1EH6 A;  2YTO A;  3ADG A;  1WXR A;  4B3T E;  2VE7 C;  3ECR A;  1EH8 A;  4X62 E;  4BMJ A;  1X6F A;  2EOY A;  2HGH A;  5KL5 A;  2EPC A;  1T39 A;  1XNQ E;  3EPJ A;  2EMF A;  5AC5 A;  1N3G A;  1XMO E;  2HC5 A;  3OTO E;  1XMQ E;  1T4O A;  2DSY A;  2L2N A;  1T4N A;  1UIL A;  4WXC A;  1A1F A;  4F9C B;  1PDA A;  2FV4 B;  1N33 E;  1ZBT A;  2K4V A;  2LRS A;  2WBU A;  2LMZ A;  3ADI A;  1TF6 A;  2LE2 A;  4GZN C;  2LJH A;  4DMI A;  2HHH E;  1YUJ A;  2E1M A;  3JAM C;  2JXP A;  2N8X A;  4GKJ E;  2EQ0 A;  3VYY A;  4KWY A;  1X48 A;  2EN3 A;  4NXN E;  4F9B B;  3TQM A;  3C6K A;  1EKZ A;  4JI8 E;  2R76 A;  3J7Y p;  2YWQ A;  2MDG A;  2JP9 A;  4LF5 E;  3C6M A;  2YTF A;  2NUG A;  2CSH A;  2EMX A;  1YFH A;  2VQE E;  4DR1 E;  2JWO A;  3LML A;  2MC6 A;  2EM0 A;  2M1S A;  3THN A;  2EPM X;  2D9H A;  4JI4 E;  1PJT A;  2UXC E;  2RPC A;  3JU0 A;  2EM6 A;  3THO B;  1TF3 A;  2EN2 A;  1X3C A;  2EML A;  4NXM E;  4JI6 E;  2UXD E;  4LFB E;  4YHH E;  4DUZ E;  4R2P A;  4R8O A;  4DV0 E;  2B7V A;  2HJJ A;  1LLM C;  2UXB E;  1IBL E;  4RHB B;  5A6J A;  2YTE A;  2EMW A;  3L00 A;  2K7I A;  1HR0 E;  2EN6 A;  2LUP B;  2L2K B;  1UHZ A;  3RMP A;  1MEY C;  1G2F C;  1YUI A;  2F8B A;  4R2C A;  2EM2 A;  4GKK E;  4F6N A;  5A6K A;  2CT1 A;  1N36 E;  4DV6 E;  2WZO A;  2KHX A;  3QG5 C;  2EMY A;  1X6E A;  2EMB A;  4WX9 A;  5IT9 C;  2L6M A;  5A69 A;  4DR3 E;  5T6J A;  1SFE A;  1UBD C;  4JI0 E;  2DLQ A;  2WBT A;  3HPZ A;  2LVH A;  4L8N A;  2UU9 E;  4P7D A;  4Q28 A;  2N3H A;  4M30 A;  2LT7 A;  3T1Y E;  2EMC A;  4I8O A;  1YSA C;  2VQF E;  2V85 A;  2EL5 A;  4R2E A;  1YPN A;  4X65 E;  5A6B A;  4DV1 E;  3HXL A;  2DMY A;  1BB8 A;  2B3T B;  2EOO A;  2M9A A;  2EN1 A;  3F6G A;  3VHT B;  1HNZ E;  4F2J C;  4BC7 A;  5KL7 A;  1NCS A;  1ZBQ A;  2I13 A;  2YTP A;  5A6B D;  2VRD A;  3EQ1 A;  1DGC A;  2GPI A;  2BB8 A;  4F6M A;  3DF6 A;  2YRK A;  1QU6 A;  5F3W A;  2EWL A;  2EPO A;  4Q35 B;  2UUB E;  2YSP A;  2EM7 A;  5IWA E;  2MC5 A;  5AE2 A;  2J7J A;  2DLK A;  5IV8 B;  5AC4 A;  2EOH A;  2NUF A;  1HNW E;  3FIG A;  1B69 A;  2MKD A;  4M9V C;  2I9I A;  3H09 A;  2L8T A;  4JI1 E;  2V83 A;  2EMI A;  4JI2 E;  4MLQ A;  1T4L B;  3J81 C;  2DRP A;  2ENA A;  4X8W A;  2Q8U A;  3J80 C;  2B9D A;  2FTX B;  4P78 A;  3AUZ A;  2L33 A;  1WRJ A;  5KL6 A;  4IJD A;  1RMD A;  2EZ6 A;  2DIX A;  4B3R E;  4K0K E;  2EPU A;  1MGT A;  1YZ9 A;  2EQ1 A;  3ZOQ B;  3LLH A;  2EOS A;  2M4I A;  4DR4 E;  2DMI A;  3EPH A;  4MLV A;  1X6H A;  5CFF E;  4BCA A;  2EM9 A;  5IXM B;  2B7T A;  2NUE A;  4KZS A;  4M0V A;  1G2D C;  2MKN A;  1RQ0 A;  1IMU A;  3VK6 A;  4TUG A;  2YTQ A;  2EPX A;  3BID A;  1F2I G;  4O4K A;  2RSI A;  1HNX E;  4YY3 E;  1J26 A;  4DV5 E;  4BS9 A;  4M2Z A;  4LF6 E;  5LMN E;  2RSM A;  1NEI A;  3KWR A;  1A1G A;  4R2Q A;  4LF4 E;  1ZR9 A;  2VF1 A;  2ZM6 E;  1PJQ A;  4F54 A;  4J8Z A;  2EPP A;  4OOG C;  4DUY E;  1Z1B A;  4N4R B;  3UK3 C;  3IWC A;  2MDR A;  2YU8 A;  1WHQ A;  3C4T A;  2ENC A;  1EH7 A;  2YTN A;  2RQL A;  5A2Q C;  1GQE A;  3BBG A;  2EOZ A;  2LTS A;  5TSE A;  2EOJ A;  3IWD A;  1TN9 A;  4WFT A;  2E5L E;  2CPN A;  4LFC E;  3J7A G;  2V87 A;  1ZAA C;  1IQO A;  2JR1 A;  2IHR 1;  4JI5 E;  5A6A A;  1KYQ A;  3KZY A;  4WSG A;  2EN4 A;  2LBS B;  2V86 A;  1IQS A;  3DJW A;  4JI7 E;  2KON A;  2YSO A;  2PRT A;  2ENH A;  3EPK A;  4LFA E;  2ELZ A;  3C4B A;  2EMG A;  1A1K A;  4GEQ B;  5DNY A;  1ZU1 A;  2F4V E;  2YTI A;  5BR8 E;  4LF9 E;  1WJP A;  2JOX A;  3ADJ A;  3F6H A;  3ADL A;  4JV5 E;  4X66 E;  3HQ1 A;  5AAS A;  3BGH A;  1RC7 A;  2JVA A;  3M99 B;  4DV2 E;  3HPS A;  2NA2 A;  1IBK E;  4ZYD A;  5LL6 R;  1XNR E;  2EN7 A;  4WXD A;  1X47 A;  2WBS A;  1GTK A;  4F9A B;  2EOQ A;  3KZZ A;  3MHS C;  1AH5 A;  4TUI A;  1X5W A;  4X64 E;  3T1H E;  1A1J A;  2EOE A;  3VYX A;  2G7H A;  4NZV A;  1JK1 A;  2RS6 A;  1AAY A;  1N32 E;  2YT4 A;  2YTJ A;  5FLX C;  4ZYH A;  5KL3 A;  2L92 A;  2YPN A;  1X49 A;  2KOU A;  4BC9 A;  4ZYE A;  2LV2 A;  4JYA E;  4ZYG A;  1SR9 A;  2EPR A;  4LF8 E;  4DR2 E;  2H36 X;  1KJK A;  4BHC A;  4HTG A;  3BF2 A;  5AE3 A;  2EP3 A;  3HTX A;  2EM4 A;  2EOX A;  2EMZ A;  1PJS A;  5KL4 A;  2L3J A;  1GZ6 A;  2EOF A;  5LMU E;  1JK2 A;  2EMK A;  5KL2 A;  3JTZ A;  4WPY A;  1BBO A;  2R1F A;  2EJ4 A;  2YZT A;  1DQ3 A;  4RH8 A;  2LTR A;  2YTG A;  2NAB A;  2EPK X;  2GLI A;  1I94 E;  3MSW A;  2LCE A;  2EQ3 A;  2GHF A;  2EMA A;  2V89 A;  4WYQ B;  4DV3 E;  1STU A;  2L2M A;  4NHR A;  1YYW A;  1YYO A;  2YRM A;  4R2R A;  2EL4 A;  2ELY A;  2UUC E;  1DI2 A;  1FKA E;  4LU9 A;  4HEI A;  4DR7 E;  2JYA A;  3K6Q A;  4R2A A;  2M7Q A;  2JY9 A;  2EL6 A;  4R2S A;  1T38 A;  4BBY A;  2EOR A;  4AQY E;  2A25 A;  4DV4 E;  4B3M E;  2ADR A;  2BBG A;  1WHN A;  2LJU A;  3OML A;  2RS7 A;  1FJG E;  1A1I A;  2DGC A;  4O24 A;  4X9J A;  1P47 A;  4R03 A;  4DR5 E;  4DKK A;  2LO3 A;  1IBM E;  2EPL X;  4LF7 E;  3EPL A;  2LUQ A;  1A1L A;  4B3S E;  4L5N C;  2EPA A;  2RTX A;  3IWB A;  2YTD A;  2EOI A;  2EN8 A;  4JI3 E;  4BHB A;  2YRH A;  1PKP A;  2V8Q B;  3AV0 A;  2WCC 3;  2EOM A;  1N34 E;  1O0W A;  4LTY A;  2EMH A;  1QNT A;  2YU5 A;  4DR6 E;  2FGG A;  4OX9 E;  5ADZ A;  3MHH C;  2EPZ A;  4IS1 C;  1L4S A;  4O43 A;  4FK5 C;  1A1H A;  2EM8 A;  1BBG A;  2JPA A; 
#chains in the Genus database with same CATH homology
 3AUZ A;  2L33 A;  2ODR C;  2V88 A;  1IBL E;  2UXB E;  2RS6 A;  2EZ6 A;  2DIX A;  4B3R E;  4K0K E;  4WSP A;  2ODR D;  1YZ9 A;  1N32 E;  5AE1 A;  2YT4 A;  2DB2 A;  3LLH A;  3ZOQ B;  5FLX C;  4DV7 E;  1HR0 E;  2M4I A;  2L92 A;  4KHP E;  4DR4 E;  1X49 A;  2KOU A;  4BC9 A;  2JOB A;  2UUA E;  4JYA E;  2LUP B;  1SR9 A;  4LF8 E;  5CFF E;  2L2K B;  1YYK A;  4BCA A;  4DR2 E;  1UHZ A;  2H36 X;  3RMP A;  2B7T A;  2NUE A;  1J5E E;  4KZS A;  4M0V A;  5AE3 A;  3HTX A;  1RQ0 A;  2F8B A;  3VK6 A;  4TUG A;  2L3J A;  1GZ6 A;  2N3G A;  5LMU E;  4GKK E;  2L3C A;  3P1X A;  1HNX E;  4YY3 E;  1J26 A;  3ADG A;  4DV5 E;  3JTZ A;  4BS9 A;  1WXR A;  4WPY A;  1N36 E;  4B3T E;  4DV6 E;  4M2Z A;  4LF6 E;  2WZO A;  2KHX A;  2VE7 C;  4X62 E;  5LMN E;  2RSM A;  2YZT A;  4BMJ A;  1DQ3 A;  3KWR A;  2LTR A;  4LF4 E;  2VF1 A;  1I94 E;  3MSW A;  2ZM6 E;  5IT9 C;  4F54 A;  4J8Z A;  4OOG C;  2L6M A;  2V89 A;  4WYQ B;  1XNQ E;  4DUY E;  4DV3 E;  1STU A;  4DR3 E;  5T6J A;  1XMO E;  2L2M A;  3IWC A;  4JI0 E;  2MDR A;  1WHQ A;  3OTO E;  3C4T A;  1XMQ E;  3HPZ A;  2UU9 E;  4L8N A;  5A2Q C;  1YYW A;  1T4O A;  1GQE A;  2DSY A;  2L2N A;  4P7D A;  4Q28 A;  1YYO A;  1T4N A;  2N3H A;  4M30 A;  1UIL A;  2UUC E;  2LTS A;  3T1Y E;  4I8O A;  3IWD A;  1DI2 A;  4F9C B;  1FKA E;  4LU9 A;  4WFT A;  2FV4 B;  2E5L E;  2CPN A;  2VQF E;  4LFC E;  2V85 A;  1N33 E;  1ZBT A;  3J7A G;  2K4V A;  2LRS A;  4X65 E;  2LMZ A;  4DR7 E;  3ADI A;  4DV1 E;  2LE2 A;  2V87 A;  3HXL A;  2DMY A;  3K6Q A;  2M7Q A;  2B3T B;  2JY9 A;  2LJH A;  4DMI A;  2HHH E;  2JR1 A;  2IHR 1;  3F6G A;  4JI5 E;  2E1M A;  1HNZ E;  3JAM C;  4BBY A;  4BC7 A;  4AQY E;  4GKJ E;  2LBS B;  3VYY A;  1ZBQ A;  2V86 A;  1X48 A;  3DJW A;  4DV4 E;  4JI7 E;  4NXN E;  2KON A;  4F9B B;  4B3M E;  1WHN A;  2RS7 A;  3OML A;  1EKZ A;  4JI8 E;  4LFA E;  3J7Y p;  3C4B A;  1FJG E;  4GEQ B;  5DNY A;  4LF5 E;  2F4V E;  3DF6 A;  2NUG A;  4R03 A;  5BR8 E;  4DR5 E;  4DKK A;  2VQE E;  4DR1 E;  1QU6 A;  5F3W A;  2JWO A;  3LML A;  1IBM E;  2EWL A;  2MC6 A;  4LF9 E;  4LF7 E;  2M1S A;  2UUB E;  2JOX A;  3ADJ A;  2LUQ A;  3F6H A;  5IWA E;  4B3S E;  3ADL A;  2MC5 A;  4X66 E;  4L5N C;  3HQ1 A;  5AAS A;  5AE2 A;  3IWB A;  2RTX A;  4JV5 E;  4JI4 E;  1RC7 A;  2JVA A;  4DV2 E;  2UXC E;  3HPS A;  4JI3 E;  2NA2 A;  1IBK E;  2NUF A;  5LL6 R;  3JU0 A;  1PKP A;  2V8Q B;  1HNW E;  1XNR E;  3AV0 A;  3FIG A;  1X47 A;  1N34 E;  1O0W A;  4NXM E;  4LTY A;  4F9A B;  4DR6 E;  3H09 A;  3VYX A;  4JI6 E;  2UXD E;  2L8T A;  4LFB E;  4JI1 E;  2FGG A;  2V83 A;  4YHH E;  4OX9 E;  5ADZ A;  4JI2 E;  4DUZ E;  1T4L B;  4TUI A;  4R8O A;  3J81 C;  4X8W A;  4X64 E;  4DV0 E;  3J80 C;  2B7V A;  3T1H E;  2B9D A;  2FTX B;  2G7H A;  4P78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...