2EN8A

Solution structure of the c2h2 type zinc finger (region 171-203) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKSHTCDECGKNFCYISALRIHQRVHMGEKCSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 171-203) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en8A01
1JK1A 2YRKA 2EPUA 4F2JC 2YTJA 2EN8A 2EN6A 1A1JA 2EORA 4F6NA 4FK5C 2ENCA 2R1FA 2EMIA 5KL7A 2HGHA 2EL5A 2MKDA 2J7JA 2M9AA 2A25A 2DLKA 4M9VC 1LLMC 1X3CA 2YTEA 2EOXA 2EPXA 2GHFA 2YTIA 2LO3A 2RPCA 3UK3C 3EPKA 2EP3A 2EMZA 2EOJA 2YTNA 4R2CA 1AAYA 1UBDC 2JPAA 2EM3A 5KL3A 4R2PA 2EPZA 1WJPA 2CSHA 2EMLA 2EQ1A 5KL5A 2WCC3 2YSOA 2EOQA 2EM0A 2PRTA 2LT7A 2EOIA 5KL2A 1A1KA 2EQ3A 1G2FC 1ZU1A 2EPAA 2EMCA 2EMWA 4IS1C 1ZAAC 2BB8A 1YUIA 5KL6A 1TN9A 2EOMA 1TF6A 3EPHA 1A1FA 1X6HA 2ADRA 1Z1BA 2EL6A 2YTGA 4R2AA 2EOEA 4R2EA 2EMXA 4F6MA 2EM4A 2LCEA 2VRDA 2ENAA 2CTDA 2YTDA 2EOHA 2EQ0A 2YRHA 3VHTB 2EN1A 2EM6A 2DMIA 4IJDA 2DRPA 1G2DC 2WBTA 2DGCA 4GZNC 2WBSA 2I13A 1P47A 3MHHC 1DGCA 4R2SA 2EPCA 2EN4A 2EE8A 2EN3A 4X9JA 2YRMA 1JK2A 2EJ4A 1UN6B 2CT1A 2YSPA 2YU5A 2JP9A 2MDGA 2EMBA 2EM2A 4R2DA 1ZR9A 2EOZA 1X6EA 2EMAA 2ELYA 2EM7A 2EOFA 3EPLA 1RMDA 4WSGA 2EOYA 2EN7A 2RSIA 2MKNA 1A1IA 4R2RA 2EMFA 2EMYA 1A1GA 2EPRA 1A1HA 1A1LA 2ELZA 2YU8A 2EMKA 2LV2A 2EOOA 4R2QA 1YSAC 1X5WA 2YTQA 1X6FA 2EPPA 2EL4A 2EOSA 2GLIA 2EMHA 3M99B 1B69A 2ENHA 1BBOA 1F2IG 3EPJA 2EN2A 1NCSA 2EM8A 2EM5A 2YTOA 3MHSC 5KL4A 1TF3A 2EM9A 2DLQA 2NABA 2YTFA 1YUJA 1BB8A 2EMGA 2LVHA 2D9HA 2E72A 2WBUA 1MEYC 2YTPA 1KJKA
chains in the Genus database with same CATH superfamily
1WRJA 2LTRA 2YRKA 2LRSA 4KWYA 1O0WA 5TSEA 2RS6A 2EORA 5AE2A 4FK5C 4JI3E 4O24A 2ENCA 1YYOA 2L2NA 4DV2E 3VK6A 1EH8A 1PJQA 4TUGA 5KL7A 1X48A 2A25A 2DLKA 1LLMC 2YTEA 4F9CB 2EPXA 2GHFA 2YTIA 2JY9A 3HPZA 2RPCA 3UK3C 2V89A 3EPKA 4R2CA 2EOJA 1XMQE 2G7HA 4R2PA 4F9BB 1WJPA 3ZOQB 2CSHA 2MDRA 4LTYA 2PRTA 4GKKE 4JV5E 1PJSA 2EMCA 4IS1C 2YZTA 1YUIA 5KL6A 1ZBQA 1T39A 2YWQA 2KOUA 2M1SA 3EPHA 1L4SA 4DV4E 4BCAA 4DV0E 4RH8A 2EL6A 4R2AA 2EPNA 4R2EA 4B3ME 2JOBA 2CTDA 2B3TB 2UU9E 2YTDA 3VHTB 3FIGA 1GZ6A 3THOB 4ZYDA 2B9DA 2N8XA 5DNYA 4P7DA 1DGCA 2EPCA 1GQEA 2YRMA 5IT9C 1UN6B 2YSPA 3C6MA 2JP9A 4DR6E 1STUA 4OOGC 2NUEA 2EMAA 2ELYA 2EM7A 1HNXE 2HHHE 4WSGA 4R03A 3L00A 2MKNA 1N32E 2EPOA 4MLVA 2R76A 4OX9E 4GEQB 1A1HA 2ELZA 2YU8A 2M4IA 2LV2A 5CFFE 1YYKA 3P1XA 4X8WA 2N3GA 3M99B 3T1HE 4JI7E 3MSWA 2L2MA 2JXPA 3EPJA 2EM8A 2EM5A 2YTOA 5KL4A 4DUZE 4JI2E 1YYWA 1NEIA 2EM9A 2DMYA 4JI8E 4DR3E 1HR0E 4B3TE 2KONA 1GTKA 4I8OA 1I94E 1UILA 4O43A 4KHPE 2NUGA 2K4VA 3T1YE 4JYAE 2MKDA 1PJTA 4JI4E 2CPNA 2LJUA 4DV7E 2VE7C 1IBME 4WPYA 1YPNA 2YTNA 1AAYA 5LMNE 2ODRD 2EWLA 2EM3A 5KL3A 2EPZA 2B7TA 5KL5A 2WCC3 3KZYA 2EM0A 1N3GA 2LT7A 4MLQA 5KL2A 5A2QC 3J7AG 4BMJA 1G2FC 2ZM6E 4X65E 1ZAAC 4DR1E 2V83A 5AE3A 1X47A 2EOMA 2V86A 1BBGA 3HPSA 4WFTA 4RHBB 3OTOE 1XMOE 1Z1BA 4KZSA 4DKKA 1XNQE 4F6MA 1T4LB 2EM4A 4LF5E 2VRDA 2L3CA 2NA2A 2YRHA 2Q8UA 4IJDA 2DMIA 2JVAA 5AC5A 1HNZE 1EH6A 3ADJA 2WBSA 4HTGA 2RQLA 3BIDA 1EKZA 2JR1A 2UUAE 4WXCA 2YU5A 4O4KA 2H36X 2MDGA 3F6HA 4X66E 4DR7E 5A6JA 2EOFA 2LJHA 3VYXA 2DSYA 3EPLA 2RSIA 4DV5E 4F54A 3JU0A 2EMFA 4LF4E 3IWDA 1A1LA 3LMLA 2E72A 2WZOA 1YSAC 4B3RE 2UXCE 1HNWE 1X6FA 5AE1A 4M30A 2JOXA 2EZ6A 4JI5E 2KHXA 2FTXB 1EH7A 2VQFE 2EN2A 1NCSA 1IQSA 1TF3A 2F4VE 4P78A 1YUJA 1SR9A 2EMGA 2MC5A 2VQEE 3DJWA 4NXME 2B7VA 2WBUA 1JK2A 2YTPA 1A1FA 1KJKA 4BC9A 2DIXA 2EPUA 2E5LE 3J7Yp 4LF7E 4ZYEA 4F2JC 2YTJA 2BBGA 2UUCE 3RMPA 1A1JA 3DF6A 4F9AB 4F6NA 2L2KB 3HTXA 3ADGA 2EMIA 1AH5A 5IXMB 4Q28A 2HGHA 2EL5A 1RQ0A 4LFBE 4M9VC 2V88A 2EOXA 2MC6A 2RSMA 4WX9A 4X62E 2EMZA 1UBDC 2EPLX 2HJJA 2LE2A 2EMLA 2EQ1A 3BF2A 2YSOA 3IWCA 2EOQA 2L92A 2EOIA 2LUQA 1PKPA 1FKAE 3AV0A 1WHNA 4JI0E 2BB8A 3BBGA 3QG5C 1DI2A 1TN9A 4X64E 2LTSA 4NHRA 4AQYE 3HXLA 1X6HA 2GPIA 4LF9E 1MEYC 2E1MA 2LCEA 2ENAA 2EPMX 3LLHA 4LFAE 2EQ0A 2L33A 2EM6A 2DRPA 1G2DC 4GZNC 3K6QA 5IV8B 4R2SA 1WXRA 4X9JA 3AUZA 3JAMC 2NUFA 4R2DA 1T4NA 3C4TA 2EOZA 2I9IA 5A6BD 4DMIA 2EN7A 4DV6E 2K7IA 3ECRA 1QNTA 4R2RA 4N4RB 4WSPA 1A1GA 2EPRA 4BS9A 3HQ1A 4R2QA 1X5WA 4NXNE 2EPPA 4B3SE 5ADZA 4J8ZA 2IHR1 5A6BA 4YHHE 1B69A 2ENHA 2FV4B 1F2IG 1MGTA 1N34E 1UHZA 4NZVA 4WXDA 1WHQA 2YTFA 1BB8A 2EPKX 4R8OA 3J80C 2V87A 3KWRA 1JK1A 1XNRE 3J81C 3KZZA 3THNA 2JYAA 3BGHA 1RC7A 2RTXA 4HEIA 2EN8A 2EN6A 1DQ3A 4DV3E 2R1FA 4O5GA 1PDAA 2M7QA 2J7JA 4BHCA 4JI1E 2DB2A 2M9AA 1T38A 2LUPB 4BHBA 2UXBE 1X3CA 2UXDE 1YZ9A 2JWOA 2LO3A 1SFEA 4LF8E 2EP3A 2JPAA 1IQOA 2HC5A 5FLXC 2YT4A 4DUYE 5A6AA 1A1KA 3ADIA 1QU6A 2UUBE 2EQ3A 2L3JA 4DV1E 1ZU1A 2EPAA 3JTZA 2EMWA 4ZYHA 2LBSB 3C4BA 4DR2E 4LU9A 1TF6A 4BBYA 1N33E 2LMZA 4GKJE 2RS7A 2ADRA 4DR5E 5IWAE 2YTGA 1IMUA 2EOEA 2EMXA 2F8BA 3VYYA 2FGGA 5A6KA 3OMLA 5AC4A 2EOHA 4ZYGA 2EN1A 2DGCA 2WBTA 4L8NA 1FJGE 1KYQA 2V85A 2I13A 4YY3E 1P47A 3MHHC 1J5EE 2EN4A 2VF1A 2EE8A 2EN3A 3C6KA 5LLQA 1ZBTA 1YFHA 4BC7A 2EJ4A 4LFCE 2CT1A 2V8QB 4M0VA 5T6JA 2EMBA 2EM2A 3F6GA 1X6EA 4JI6E 1RMDA 5AASA 2EOYA 4Q35B 1T4OA 1A1IA 4TUIA 1X49A 2EMYA 4K0KE 2YPNA 2ODRC 5LMUE 2EMKA 2EOOA 5LL6R 3EQ1A 2YTQA 4LF6E 4M2ZA 4WYQB 2EL4A 2EOSA 2GLIA 2EMHA 5F3WA 3H09A 5A69A 1BBOA 1N36E 2L8TA 3MHSC 5BR8E 1IBLE 3ADLA 4L5NC 4DR4E 2DLQA 2NABA 3TQMA 2LVHA 3IWBA 2D9HA 1J26A 1IBKE 1ZR9A 2N3HA 2L6MA
chains in the Genus database with same CATH topology
1JK1A 2YRKA 2EPUA 4F2JC 2YTJA 2EN8A 2EN6A 1A1JA 2EORA 4F6NA 4FK5C 2ENCA 2R1FA 2EMIA 5KL7A 2HGHA 2EL5A 2MKDA 2J7JA 2M9AA 2A25A 2DLKA 4M9VC 1LLMC 1X3CA 2YTEA 2EOXA 2EPXA 2GHFA 2YTIA 2LO3A 2RPCA 3UK3C 3EPKA 2EP3A 2EMZA 2EOJA 2YTNA 4R2CA 1AAYA 1UBDC 2JPAA 2EM3A 5KL3A 4R2PA 2EPZA 1WJPA 2CSHA 2EMLA 2EQ1A 5KL5A 2WCC3 2YSOA 2EOQA 2EM0A 2PRTA 2LT7A 2EOIA 5KL2A 1A1KA 2EQ3A 1G2FC 1ZU1A 2EPAA 2EMCA 2EMWA 4IS1C 1ZAAC 2BB8A 1YUIA 5KL6A 1TN9A 2EOMA 1TF6A 3EPHA 1A1FA 1X6HA 2ADRA 1Z1BA 2EL6A 2YTGA 4R2AA 2EOEA 4R2EA 2EMXA 4F6MA 2EM4A 2LCEA 2VRDA 2ENAA 2CTDA 2YTDA 2EOHA 2EQ0A 2YRHA 3VHTB 2EN1A 2EM6A 2DMIA 4IJDA 2DRPA 1G2DC 2WBTA 2DGCA 4GZNC 2WBSA 2I13A 1P47A 3MHHC 1DGCA 4R2SA 2EPCA 2EN4A 2EE8A 2EN3A 4X9JA 2YRMA 1JK2A 2EJ4A 1UN6B 2CT1A 2YSPA 2YU5A 2JP9A 2MDGA 2EMBA 2EM2A 4R2DA 1ZR9A 2EOZA 1X6EA 2EMAA 2ELYA 2EM7A 2EOFA 3EPLA 1RMDA 4WSGA 2EOYA 2EN7A 2RSIA 2MKNA 1A1IA 4R2RA 2EMFA 2EMYA 1A1GA 2EPRA 1A1HA 1A1LA 2ELZA 2YU8A 2EMKA 2LV2A 2EOOA 4R2QA 1YSAC 1X5WA 2YTQA 1X6FA 2EPPA 2EL4A 2EOSA 2GLIA 2EMHA 3M99B 1B69A 2ENHA 1BBOA 1F2IG 3EPJA 2EN2A 1NCSA 2EM8A 2EM5A 2YTOA 3MHSC 5KL4A 1TF3A 2EM9A 2DLQA 2NABA 2YTFA 1YUJA 1BB8A 2EMGA 2LVHA 2D9HA 2E72A 2WBUA 1MEYC 2YTPA 1KJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JK1 A;  2YRK A;  2EPU A;  4F2J C;  2YTJ A;  2EN8 A;  2EN6 A;  1A1J A;  2EOR A;  4F6N A;  4FK5 C;  2ENC A;  2R1F A;  2EMI A;  5KL7 A;  2HGH A;  2EL5 A;  2MKD A;  2J7J A;  2M9A A;  2A25 A;  2DLK A;  4M9V C;  1LLM C;  1X3C A;  2YTE A;  2EOX A;  2EPX A;  2GHF A;  2YTI A;  2LO3 A;  2RPC A;  3UK3 C;  3EPK A;  2EP3 A;  2EMZ A;  2EOJ A;  2YTN A;  4R2C A;  1AAY A;  1UBD C;  2JPA A;  2EM3 A;  5KL3 A;  4R2P A;  2EPZ A;  1WJP A;  2CSH A;  2EML A;  2EQ1 A;  5KL5 A;  2WCC 3;  2YSO A;  2EOQ A;  2EM0 A;  2PRT A;  2LT7 A;  2EOI A;  5KL2 A;  1A1K A;  2EQ3 A;  1G2F C;  1ZU1 A;  2EPA A;  2EMC A;  2EMW A;  4IS1 C;  1ZAA C;  2BB8 A;  1YUI A;  5KL6 A;  1TN9 A;  2EOM A;  1TF6 A;  3EPH A;  1A1F A;  1X6H A;  2ADR A;  1Z1B A;  2EL6 A;  2YTG A;  4R2A A;  2EOE A;  4R2E A;  2EMX A;  4F6M A;  2EM4 A;  2LCE A;  2VRD A;  2ENA A;  2CTD A;  2YTD A;  2EOH A;  2EQ0 A;  2YRH A;  3VHT B;  2EN1 A;  2EM6 A;  2DMI A;  4IJD A;  2DRP A;  1G2D C;  2WBT A;  2DGC A;  4GZN C;  2WBS A;  2I13 A;  1P47 A;  3MHH C;  1DGC A;  4R2S A;  2EPC A;  2EN4 A;  2EE8 A;  2EN3 A;  4X9J A;  2YRM A;  1JK2 A;  2EJ4 A;  1UN6 B;  2CT1 A;  2YSP A;  2YU5 A;  2JP9 A;  2MDG A;  2EMB A;  2EM2 A;  4R2D A;  1ZR9 A;  2EOZ A;  1X6E A;  2EMA A;  2ELY A;  2EM7 A;  2EOF A;  3EPL A;  1RMD A;  4WSG A;  2EOY A;  2EN7 A;  2RSI A;  2MKN A;  1A1I A;  4R2R A;  2EMF A;  2EMY A;  1A1G A;  2EPR A;  1A1H A;  1A1L A;  2ELZ A;  2YU8 A;  2EMK A;  2LV2 A;  2EOO A;  4R2Q A;  1YSA C;  1X5W A;  2YTQ A;  1X6F A;  2EPP A;  2EL4 A;  2EOS A;  2GLI A;  2EMH A;  3M99 B;  1B69 A;  2ENH A;  1BBO A;  1F2I G;  3EPJ A;  2EN2 A;  1NCS A;  2EM8 A;  2EM5 A;  2YTO A;  3MHS C;  5KL4 A;  1TF3 A;  2EM9 A;  2DLQ A;  2NAB A;  2YTF A;  1YUJ A;  1BB8 A;  2EMG A;  2LVH A;  2D9H A;  2E72 A;  2WBU A;  1MEY C;  2YTP A;  1KJK A; 
#chains in the Genus database with same CATH topology
 1WRJ A;  2LTR A;  2YRK A;  2LRS A;  4KWY A;  1O0W A;  5TSE A;  2RS6 A;  2EOR A;  5AE2 A;  4FK5 C;  4JI3 E;  4O24 A;  2ENC A;  1YYO A;  2L2N A;  4DV2 E;  3VK6 A;  1EH8 A;  1PJQ A;  4TUG A;  5KL7 A;  1X48 A;  2A25 A;  2DLK A;  1LLM C;  2YTE A;  4F9C B;  2EPX A;  2GHF A;  2YTI A;  2JY9 A;  3HPZ A;  2RPC A;  3UK3 C;  2V89 A;  3EPK A;  4R2C A;  2EOJ A;  1XMQ E;  2G7H A;  4R2P A;  4F9B B;  1WJP A;  3ZOQ B;  2CSH A;  2MDR A;  4LTY A;  2PRT A;  4GKK E;  4JV5 E;  1PJS A;  2EMC A;  4IS1 C;  2YZT A;  1YUI A;  5KL6 A;  1ZBQ A;  1T39 A;  2YWQ A;  2KOU A;  2M1S A;  3EPH A;  1L4S A;  4DV4 E;  4BCA A;  4DV0 E;  4RH8 A;  2EL6 A;  4R2A A;  2EPN A;  4R2E A;  4B3M E;  2JOB A;  2CTD A;  2B3T B;  2UU9 E;  2YTD A;  3VHT B;  3FIG A;  1GZ6 A;  3THO B;  4ZYD A;  2B9D A;  2N8X A;  5DNY A;  4P7D A;  1DGC A;  2EPC A;  1GQE A;  2YRM A;  5IT9 C;  1UN6 B;  2YSP A;  3C6M A;  2JP9 A;  4DR6 E;  1STU A;  4OOG C;  2NUE A;  2EMA A;  2ELY A;  2EM7 A;  1HNX E;  2HHH E;  4WSG A;  4R03 A;  3L00 A;  2MKN A;  1N32 E;  2EPO A;  4MLV A;  2R76 A;  4OX9 E;  4GEQ B;  1A1H A;  2ELZ A;  2YU8 A;  2M4I A;  2LV2 A;  5CFF E;  1YYK A;  3P1X A;  4X8W A;  2N3G A;  3M99 B;  3T1H E;  4JI7 E;  3MSW A;  2L2M A;  2JXP A;  3EPJ A;  2EM8 A;  2EM5 A;  2YTO A;  5KL4 A;  4DUZ E;  4JI2 E;  1YYW A;  1NEI A;  2EM9 A;  2DMY A;  4JI8 E;  4DR3 E;  1HR0 E;  4B3T E;  2KON A;  1GTK A;  4I8O A;  1I94 E;  1UIL A;  4O43 A;  4KHP E;  2NUG A;  2K4V A;  3T1Y E;  4JYA E;  2MKD A;  1PJT A;  4JI4 E;  2CPN A;  2LJU A;  4DV7 E;  2VE7 C;  1IBM E;  4WPY A;  1YPN A;  2YTN A;  1AAY A;  5LMN E;  2ODR D;  2EWL A;  2EM3 A;  5KL3 A;  2EPZ A;  2B7T A;  5KL5 A;  2WCC 3;  3KZY A;  2EM0 A;  1N3G A;  2LT7 A;  4MLQ A;  5KL2 A;  5A2Q C;  3J7A G;  4BMJ A;  1G2F C;  2ZM6 E;  4X65 E;  1ZAA C;  4DR1 E;  2V83 A;  5AE3 A;  1X47 A;  2EOM A;  2V86 A;  1BBG A;  3HPS A;  4WFT A;  4RHB B;  3OTO E;  1XMO E;  1Z1B A;  4KZS A;  4DKK A;  1XNQ E;  4F6M A;  1T4L B;  2EM4 A;  4LF5 E;  2VRD A;  2L3C A;  2NA2 A;  2YRH A;  2Q8U A;  4IJD A;  2DMI A;  2JVA A;  5AC5 A;  1HNZ E;  1EH6 A;  3ADJ A;  2WBS A;  4HTG A;  2RQL A;  3BID A;  1EKZ A;  2JR1 A;  2UUA E;  4WXC A;  2YU5 A;  4O4K A;  2H36 X;  2MDG A;  3F6H A;  4X66 E;  4DR7 E;  5A6J A;  2EOF A;  2LJH A;  3VYX A;  2DSY A;  3EPL A;  2RSI A;  4DV5 E;  4F54 A;  3JU0 A;  2EMF A;  4LF4 E;  3IWD A;  1A1L A;  3LML A;  2E72 A;  2WZO A;  1YSA C;  4B3R E;  2UXC E;  1HNW E;  1X6F A;  5AE1 A;  4M30 A;  2JOX A;  2EZ6 A;  4JI5 E;  2KHX A;  2FTX B;  1EH7 A;  2VQF E;  2EN2 A;  1NCS A;  1IQS A;  1TF3 A;  2F4V E;  4P78 A;  1YUJ A;  1SR9 A;  2EMG A;  2MC5 A;  2VQE E;  3DJW A;  4NXM E;  2B7V A;  2WBU A;  1JK2 A;  2YTP A;  1A1F A;  1KJK A;  4BC9 A;  2DIX A;  2EPU A;  2E5L E;  3J7Y p;  4LF7 E;  4ZYE A;  4F2J C;  2YTJ A;  2BBG A;  2UUC E;  3RMP A;  1A1J A;  3DF6 A;  4F9A B;  4F6N A;  2L2K B;  3HTX A;  3ADG A;  2EMI A;  1AH5 A;  5IXM B;  4Q28 A;  2HGH A;  2EL5 A;  1RQ0 A;  4LFB E;  4M9V C;  2V88 A;  2EOX A;  2MC6 A;  2RSM A;  4WX9 A;  4X62 E;  2EMZ A;  1UBD C;  2EPL X;  2HJJ A;  2LE2 A;  2EML A;  2EQ1 A;  3BF2 A;  2YSO A;  3IWC A;  2EOQ A;  2L92 A;  2EOI A;  2LUQ A;  1PKP A;  1FKA E;  3AV0 A;  1WHN A;  4JI0 E;  2BB8 A;  3BBG A;  3QG5 C;  1DI2 A;  1TN9 A;  4X64 E;  2LTS A;  4NHR A;  4AQY E;  3HXL A;  1X6H A;  2GPI A;  4LF9 E;  1MEY C;  2E1M A;  2LCE A;  2ENA A;  2EPM X;  3LLH A;  4LFA E;  2EQ0 A;  2L33 A;  2EM6 A;  2DRP A;  1G2D C;  4GZN C;  3K6Q A;  5IV8 B;  4R2S A;  1WXR A;  4X9J A;  3AUZ A;  3JAM C;  2NUF A;  4R2D A;  1T4N A;  3C4T A;  2EOZ A;  2I9I A;  5A6B D;  4DMI A;  2EN7 A;  4DV6 E;  2K7I A;  3ECR A;  1QNT A;  4R2R A;  4N4R B;  4WSP A;  1A1G A;  2EPR A;  4BS9 A;  3HQ1 A;  4R2Q A;  1X5W A;  4NXN E;  2EPP A;  4B3S E;  5ADZ A;  4J8Z A;  2IHR 1;  5A6B A;  4YHH E;  1B69 A;  2ENH A;  2FV4 B;  1F2I G;  1MGT A;  1N34 E;  1UHZ A;  4NZV A;  4WXD A;  1WHQ A;  2YTF A;  1BB8 A;  2EPK X;  4R8O A;  3J80 C;  2V87 A;  3KWR A;  1JK1 A;  1XNR E;  3J81 C;  3KZZ A;  3THN A;  2JYA A;  3BGH A;  1RC7 A;  2RTX A;  4HEI A;  2EN8 A;  2EN6 A;  1DQ3 A;  4DV3 E;  2R1F A;  4O5G A;  1PDA A;  2M7Q A;  2J7J A;  4BHC A;  4JI1 E;  2DB2 A;  2M9A A;  1T38 A;  2LUP B;  4BHB A;  2UXB E;  1X3C A;  2UXD E;  1YZ9 A;  2JWO A;  2LO3 A;  1SFE A;  4LF8 E;  2EP3 A;  2JPA A;  1IQO A;  2HC5 A;  5FLX C;  2YT4 A;  4DUY E;  5A6A A;  1A1K A;  3ADI A;  1QU6 A;  2UUB E;  2EQ3 A;  2L3J A;  4DV1 E;  1ZU1 A;  2EPA A;  3JTZ A;  2EMW A;  4ZYH A;  2LBS B;  3C4B A;  4DR2 E;  4LU9 A;  1TF6 A;  4BBY A;  1N33 E;  2LMZ A;  4GKJ E;  2RS7 A;  2ADR A;  4DR5 E;  5IWA E;  2YTG A;  1IMU A;  2EOE A;  2EMX A;  2F8B A;  3VYY A;  2FGG A;  5A6K A;  3OML A;  5AC4 A;  2EOH A;  4ZYG A;  2EN1 A;  2DGC A;  2WBT A;  4L8N A;  1FJG E;  1KYQ A;  2V85 A;  2I13 A;  4YY3 E;  1P47 A;  3MHH C;  1J5E E;  2EN4 A;  2VF1 A;  2EE8 A;  2EN3 A;  3C6K A;  5LLQ A;  1ZBT A;  1YFH A;  4BC7 A;  2EJ4 A;  4LFC E;  2CT1 A;  2V8Q B;  4M0V A;  5T6J A;  2EMB A;  2EM2 A;  3F6G A;  1X6E A;  4JI6 E;  1RMD A;  5AAS A;  2EOY A;  4Q35 B;  1T4O A;  1A1I A;  4TUI A;  1X49 A;  2EMY A;  4K0K E;  2YPN A;  2ODR C;  5LMU E;  2EMK A;  2EOO A;  5LL6 R;  3EQ1 A;  2YTQ A;  4LF6 E;  4M2Z A;  4WYQ B;  2EL4 A;  2EOS A;  2GLI A;  2EMH A;  5F3W A;  3H09 A;  5A69 A;  1BBO A;  1N36 E;  2L8T A;  3MHS C;  5BR8 E;  1IBL E;  3ADL A;  4L5N C;  4DR4 E;  2DLQ A;  2NAB A;  3TQM A;  2LVH A;  3IWB A;  2D9H A;  1J26 A;  1IBK E;  1ZR9 A;  2N3H A;  2L6M A; 
#chains in the Genus database with same CATH homology
 1JK1 A;  2YRK A;  2EPU A;  4F2J C;  2YTJ A;  2EN8 A;  2EN6 A;  1A1J A;  2EOR A;  4F6N A;  4FK5 C;  2ENC A;  2R1F A;  2EMI A;  5KL7 A;  2HGH A;  2EL5 A;  2MKD A;  2J7J A;  2M9A A;  2A25 A;  2DLK A;  4M9V C;  1LLM C;  1X3C A;  2YTE A;  2EOX A;  2EPX A;  2GHF A;  2YTI A;  2LO3 A;  2RPC A;  3UK3 C;  3EPK A;  2EP3 A;  2EMZ A;  2EOJ A;  2YTN A;  4R2C A;  1AAY A;  1UBD C;  2JPA A;  2EM3 A;  5KL3 A;  4R2P A;  2EPZ A;  1WJP A;  2CSH A;  2EML A;  2EQ1 A;  5KL5 A;  2WCC 3;  2YSO A;  2EOQ A;  2EM0 A;  2PRT A;  2LT7 A;  2EOI A;  5KL2 A;  1A1K A;  2EQ3 A;  1G2F C;  1ZU1 A;  2EPA A;  2EMC A;  2EMW A;  4IS1 C;  1ZAA C;  2BB8 A;  1YUI A;  5KL6 A;  1TN9 A;  2EOM A;  1TF6 A;  3EPH A;  1A1F A;  1X6H A;  2ADR A;  1Z1B A;  2EL6 A;  2YTG A;  4R2A A;  2EOE A;  4R2E A;  2EMX A;  4F6M A;  2EM4 A;  2LCE A;  2VRD A;  2ENA A;  2CTD A;  2YTD A;  2EOH A;  2EQ0 A;  2YRH A;  3VHT B;  2EN1 A;  2EM6 A;  2DMI A;  4IJD A;  2DRP A;  1G2D C;  2WBT A;  2DGC A;  4GZN C;  2WBS A;  2I13 A;  1P47 A;  3MHH C;  1DGC A;  4R2S A;  2EPC A;  2EN4 A;  2EE8 A;  2EN3 A;  4X9J A;  2YRM A;  1JK2 A;  2EJ4 A;  1UN6 B;  2CT1 A;  2YSP A;  2YU5 A;  2JP9 A;  2MDG A;  2EMB A;  2EM2 A;  4R2D A;  1ZR9 A;  2EOZ A;  1X6E A;  2EMA A;  2ELY A;  2EM7 A;  2EOF A;  3EPL A;  1RMD A;  4WSG A;  2EOY A;  2EN7 A;  2RSI A;  2MKN A;  1A1I A;  4R2R A;  2EMF A;  2EMY A;  1A1G A;  2EPR A;  1A1H A;  1A1L A;  2ELZ A;  2YU8 A;  2EMK A;  2LV2 A;  2EOO A;  4R2Q A;  1YSA C;  1X5W A;  2YTQ A;  1X6F A;  2EPP A;  2EL4 A;  2EOS A;  2GLI A;  2EMH A;  3M99 B;  1B69 A;  2ENH A;  1BBO A;  1F2I G;  3EPJ A;  2EN2 A;  1NCS A;  2EM8 A;  2EM5 A;  2YTO A;  3MHS C;  5KL4 A;  1TF3 A;  2EM9 A;  2DLQ A;  2NAB A;  2YTF A;  1YUJ A;  1BB8 A;  2EMG A;  2LVH A;  2D9H A;  2E72 A;  2WBU A;  1MEY C;  2YTP A;  1KJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...