2EN8A

Solution structure of the c2h2 type zinc finger (region 171-203) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKSHTCDECGKNFCYISALRIHQRVHMGEKCSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 171-203) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en8A01
3MHSC 2EOQA 2EN4A 2YRKA 2GLIA 2CSHA 2YRMA 4R2RA 2MKDA 4FK5C 2EPAA 1NCSA 2EMBA 3EPJA 2WBTA 2DMIA 3MHHC 2EM9A 2EN6A 2YSPA 2MDGA 2YTJA 2EOSA 2WCC3 1X6FA 2RSIA 4F6NA 1Z1BA 2EL6A 2YTNA 3EPKA 2EN8A 2E72A 2EM0A 2YTDA 1YSAC 2YSOA 1A1HA 2EN3A 1BB8A 2CT1A 2EMAA 1G2FC 2EOMA 1A1GA 5KL3A 2DLKA 2EPXA 2JPAA 2EOEA 2EORA 2WBUA 2EMZA 1TN9A 2EMHA 2I13A 2MKNA 2YTQA 2YU5A 3EPHA 2YRHA 2CTDA 1BBOA 2EQ1A 2EOYA 2YU8A 2NABA 1LLMC 2EOOA 2EOJA 4F6MA 1P47A 1JK1A 1A1FA 1F2IG 2ADRA 2EL5A 3VHTB 2EJ4A 2J7JA 2ENCA 1ZR9A 2EM3A 4R2DA 2YTOA 1MEYC 1RMDA 3EPLA 1UBDC 1ZAAC 2EMIA 2EN2A 2R1FA 2RPCA 2EM6A 1X6HA 1A1IA 2A25A 2EPRA 3M99B 4IS1C 2LVHA 2JP9A 1ZU1A 2LV2A 1A1LA 2EMFA 2ELYA 2EP3A 2YTGA 4GZNC 1TF6A 1YUJA 2BB8A 2YTIA 1X3CA 2EOZA 4M9VC 2YTEA 1X5WA 2EQ3A 2EQ0A 2EMKA 4R2AA 2EMXA 4R2SA 2EMWA 1G2DC 4X9JA 1JK2A 2EM5A 2DGCA 4WSGA 5KL5A 2EN1A 1WJPA 2D9HA 2YTPA 2LT7A 4R2PA 2ELZA 4IJDA 1A1JA 1UN6B 2EM7A 1X6EA 2EM8A 2VRDA 4F2JC 2EPPA 1TF3A 1YUIA 2WBSA 2EOXA 4R2QA 2EPZA 4R2CA 2EOIA 2EMYA 4R2EA 1A1KA 1KJKA 2EM4A 2EMCA 2ENHA 2EOFA 5KL2A 1DGCA 1AAYA 2LO3A 2EM2A 2GHFA 3UK3C 1B69A 2EN7A 2EMLA 2EL4A 2EOHA 2DRPA 2EPCA 2LCEA 2EE8A 2DLQA 2PRTA 2YTFA 2EMGA 5KL6A 2ENAA 2M9AA 2EPUA 5KL7A 5KL4A 2HGHA
chains in the Genus database with same CATH superfamily
1PKPA 5F3WA 3JTZA 2GLIA 4RHBB 2MKDA 2L6MA 3EPJA 4HTGA 4B3TE 3ADIA 2CPNA 3JAMC 5A6JA 2YTJA 1X6FA 2EN8A 1WRJA 3AV0A 1N33E 1STUA 1MGTA 3F6HA 2WZOA 2YSOA 1BB8A 3J81C 2LUQA 2M7QA 2KONA 2M4IA 4ZYEA 2LJHA 1QNTA 2EPXA 5KL3A 1J26A 1TN9A 2WBUA 2EMZA 5LMNE 2EMHA 3MSWA 2I9IA 4BC9A 2CTDA 2M1SA 2NABA 3KZYA 4X8WA 2EOJA 4F6MA 1GZ6A 1NEIA 3QG5C 3RMPA 2EL5A 2EJ4A 2ZM6E 2ENCA 2EM3A 3OMLA 2UUCE 4N4RB 4TUIA 1MEYC 1RMDA 2R1FA 2EM6A 2N3GA 2A25A 3M99B 1XNQE 5LL6R 4LFBE 2EMFA 2YTGA 4GKKE 4MLVA 1DQ3A 4JI2E 2IHR1 2YTIA 1X3CA 4X65E 4M9VC 4WXCA 2EQ0A 2EMKA 3T1HE 3P1XA 1SFEA 5A2QC 1YPNA 2L2KB 2FTXB 1WJPA 2LT7A 4O4KA 1HNXE 2DMYA 2LTSA 4GKJE 1A1JA 5A6AA 2VRDA 2GPIA 4F54A 3IWCA 1L4SA 2N3HA 2UUBE 4R2QA 3F6GA 2EOIA 5IT9C 1XMOE 2HC5A 1KYQA 2BBGA 2Q8UA 2ENHA 1PJSA 1AAYA 1DI2A 2EN7A 2EL4A 2DRPA 2EPCA 2LCEA 2RS6A 4LF4E 2DLQA 2EMGA 2ODRC 2E1MA 2M9AA 2HGHA 2V8QB 2YRKA 3LLHA 1ZBTA 1RQ0A 4FK5C 2EPAA 1GQEA 2EMBA 2DMIA 2H36X 2JVAA 2K4VA 2YSPA 4BCAA 4OX9E 2MDRA 4DR3E 4O5GA 4JI3E 5AC5A 4LFAE 5LMUE 3EPKA 2E5LE 2KOUA 2EM0A 5FLXC 1A1HA 1J5EE 2CT1A 1G2FC 2EOMA 1A1GA 2LJUA 1N34E 2EORA 4DMIA 3FIGA 2YTQA 1PDAA 2V83A 2UU9E 4DR5E 2EQ1A 5A6BA 2YU8A 2EWLA 1P47A 2NUGA 3HPZA 3IWDA 4KWYA 2LMZA 4WFTA 1ZR9A 3LMLA 1XMQE 2YTOA 1FJGE 1X6HA 4O43A 4LF9E 4IS1C 1XNRE 2JP9A 2RSMA 2LV2A 4X64E 3C6MA 2EPMX 2ELYA 5T6JA 3HQ1A 1UILA 4P7DA 1X5WA 2EQ3A 2MC6A 3H09A 4M0VA 2EMXA 4R2AA 2G7HA 2EMWA 4R2SA 4LFCE 1UHZA 2EZ6A 1IBLE 3BIDA 4WSGA 4LF7E 4BS9A 2EPLX 2LRSA 4LF6E 5KL5A 3TQMA 2EN1A 2D9HA 2YTPA 4R2PA 1T4NA 4WXDA 3C6KA 4JI4E 2VF1A 2YWQA 1EH8A 4YHHE 4F2JC 2EPPA 3VYYA 3K6QA 4L8NA 2EPOA 4Q28A 3THNA 4DV7E 1QU6A 1IQOA 1A1KA 1IBKE 1X48A 1IMUA 1O0WA 2RS7A 5KL2A 5DNYA 4DKKA 2NUFA 2GHFA 3UK3C 1B69A 2VQFE 1BBGA 2DIXA 2B9DA 2FGGA 2YT4A 2YTFA 4R03A 2MC5A 2ENAA 4GEQB 2R76A 4X66E 1T39A 3MHSC 1I94E 2EOQA 5LLQA 4OOGC 2EN4A 3HTXA 2YRMA 5AE1A 4R2RA 1NCSA 3JU0A 4JI1E 2LBSB 2EM9A 5CFFE 2MDGA 2WCC3 1IBME 4HEIA 1Z1BA 2EL6A 1SR9A 2YTNA 2E72A 5IV8B 1YSAC 3J7AG 2JR1A 2EN3A 4NHRA 4LTYA 4BBYA 4DR2E 2EMAA 2B7TA 5AE3A 4B3SE 2MKNA 2EOEA 2I13A 2KHXA 4LF5E 1HNZE 1X49A 3T1YE 2YU5A 5A6BD 2YRHA 4NXME 5A6KA 1LLMC 4JI6E 2B7VA 1JK1A 2LE2A 2ADRA 4DUYE 4TUGA 4R2DA 3HPSA 3EPLA 1UBDC 2EMIA 2EN2A 1PJQA 5IWAE 2EPNA 3J7Yp 2LVHA 1X47A 1ZU1A 1YFHA 2JYAA 3KWRA 4K0KE 1TF6A 4GZNC 4F9AB 2UXCE 4ZYHA 3L00A 2V87A 2DB2A 2YTEA 2LTRA 2UXBE 1G2DC 4B3RE 4LU9A 4X9JA 2RTXA 1JK2A 2L3JA 2YZTA 1T4OA 2EM5A 5IXMB 2DGCA 1YYKA 2JWOA 4DV2E 4YY3E 1YZ9A 4DUZE 1UN6B 2EM7A 2FV4B 1X6EA 2EM8A 2ODRD 4DV0E 1YUIA 4L5NC 2WBSA 2EOXA 5BR8E 2NUEA 4R2EA 2EMYA 1YYOA 3ZOQB 4X62E 2EMCA 3DF6A 4B3ME 4JI8E 1N32E 1DGCA 2UUAE 2LO3A 2EM2A 3C4BA 3OTOE 4DV6E 4WSPA 2EMLA 3BBGA 4BHCA 3VK6A 5ADZA 2PRTA 2EPKX 4BHBA 3KZZA 3ADGA 1WHQA 2UXDE 1EH7A 5KL7A 2EPUA 4DR1E 2L92A 3HXLA 4WPYA 4JI0E 4BC7A 5TSEA 2CSHA 4I8OA 2V89A 4JV5E 2WBTA 2HJJA 4BMJA 3MHHC 2EN6A 3DJWA 2EOSA 2RSIA 3EQ1A 4P78A 4F6NA 4F9BB 4AQYE 4DV5E 4DR6E 2YTDA 1WXRA 4NXNE 2F4VE 4DV1E 2HHHE 2DLKA 2JPAA 3EPHA 1FKAE 1BBOA 3IWBA 2EOYA 4DV4E 2EOOA 4RH8A 1A1FA 4JI7E 1T4LB 1F2IG 3VHTB 2JXPA 2J7JA 5AE2A 5A69A 1ZAAC 2RPCA 1PJTA 2YPNA 3BGHA 2B3TB 4DV3E 1A1IA 2EPRA 1EKZA 4ZYDA 3C4TA 1A1LA 1YUJA 2EP3A 2V88A 3ECRA 2L2MA 2BB8A 2JY9A 2LUPB 2N8XA 2EOZA 3ADLA 2V85A 4DR7E 3THOB 5AASA 1HNWE 4LF8E 4KHPE 1HR0E 2K7IA 4WYQB 2VQEE 4M30A 4KZSA 4WX9A 1N3GA 2L3CA 3BF2A 2ELZA 4IJDA 2DSYA 1RC7A 4JYAE 2L2NA 1EH6A 2VE7C 2L33A 4M2ZA 4MLQA 4JI5E 1TF3A 2NA2A 4O24A 2V86A 4DR4E 2EPZA 3ADJA 3AUZA 4J8ZA 1ZBQA 4R2CA 2L8TA 2RQLA 1KJKA 1WHNA 2EM4A 4F9CB 3J80C 1YYWA 1AH5A 4Q35B 2EOFA 1T38A 1N36E 3VYXA 1IQSA 2EOHA 2JOBA 4NZVA 4ZYGA 2F8BA 2EE8A 5AC4A 1GTKA 5KL6A 4R8OA 2JOXA 5KL4A
chains in the Genus database with same CATH topology
3MHSC 2EOQA 2EN4A 2YRKA 2GLIA 2CSHA 2YRMA 4R2RA 2MKDA 4FK5C 2EPAA 1NCSA 2EMBA 3EPJA 2WBTA 2DMIA 3MHHC 2EM9A 2EN6A 2YSPA 2MDGA 2YTJA 2EOSA 2WCC3 1X6FA 2RSIA 4F6NA 1Z1BA 2EL6A 2YTNA 3EPKA 2EN8A 2E72A 2EM0A 2YTDA 1YSAC 2YSOA 1A1HA 2EN3A 1BB8A 2CT1A 2EMAA 1G2FC 2EOMA 1A1GA 5KL3A 2DLKA 2EPXA 2JPAA 2EOEA 2EORA 2WBUA 2EMZA 1TN9A 2EMHA 2I13A 2MKNA 2YTQA 2YU5A 3EPHA 2YRHA 2CTDA 1BBOA 2EQ1A 2EOYA 2YU8A 2NABA 1LLMC 2EOOA 2EOJA 4F6MA 1P47A 1JK1A 1A1FA 1F2IG 2ADRA 2EL5A 3VHTB 2EJ4A 2J7JA 2ENCA 1ZR9A 2EM3A 4R2DA 2YTOA 1MEYC 1RMDA 3EPLA 1UBDC 1ZAAC 2EMIA 2EN2A 2R1FA 2RPCA 2EM6A 1X6HA 1A1IA 2A25A 2EPRA 3M99B 4IS1C 2LVHA 2JP9A 1ZU1A 2LV2A 1A1LA 2EMFA 2ELYA 2EP3A 2YTGA 4GZNC 1TF6A 1YUJA 2BB8A 2YTIA 1X3CA 2EOZA 4M9VC 2YTEA 1X5WA 2EQ3A 2EQ0A 2EMKA 4R2AA 2EMXA 4R2SA 2EMWA 1G2DC 4X9JA 1JK2A 2EM5A 2DGCA 4WSGA 5KL5A 2EN1A 1WJPA 2D9HA 2YTPA 2LT7A 4R2PA 2ELZA 4IJDA 1A1JA 1UN6B 2EM7A 1X6EA 2EM8A 2VRDA 4F2JC 2EPPA 1TF3A 1YUIA 2WBSA 2EOXA 4R2QA 2EPZA 4R2CA 2EOIA 2EMYA 4R2EA 1A1KA 1KJKA 2EM4A 2EMCA 2ENHA 2EOFA 5KL2A 1DGCA 1AAYA 2LO3A 2EM2A 2GHFA 3UK3C 1B69A 2EN7A 2EMLA 2EL4A 2EOHA 2DRPA 2EPCA 2LCEA 2EE8A 2DLQA 2PRTA 2YTFA 2EMGA 5KL6A 2ENAA 2M9AA 2EPUA 5KL7A 5KL4A 2HGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS C;  2EOQ A;  2EN4 A;  2YRK A;  2GLI A;  2CSH A;  2YRM A;  4R2R A;  2MKD A;  4FK5 C;  2EPA A;  1NCS A;  2EMB A;  3EPJ A;  2WBT A;  2DMI A;  3MHH C;  2EM9 A;  2EN6 A;  2YSP A;  2MDG A;  2YTJ A;  2EOS A;  2WCC 3;  1X6F A;  2RSI A;  4F6N A;  1Z1B A;  2EL6 A;  2YTN A;  3EPK A;  2EN8 A;  2E72 A;  2EM0 A;  2YTD A;  1YSA C;  2YSO A;  1A1H A;  2EN3 A;  1BB8 A;  2CT1 A;  2EMA A;  1G2F C;  2EOM A;  1A1G A;  5KL3 A;  2DLK A;  2EPX A;  2JPA A;  2EOE A;  2EOR A;  2WBU A;  2EMZ A;  1TN9 A;  2EMH A;  2I13 A;  2MKN A;  2YTQ A;  2YU5 A;  3EPH A;  2YRH A;  2CTD A;  1BBO A;  2EQ1 A;  2EOY A;  2YU8 A;  2NAB A;  1LLM C;  2EOO A;  2EOJ A;  4F6M A;  1P47 A;  1JK1 A;  1A1F A;  1F2I G;  2ADR A;  2EL5 A;  3VHT B;  2EJ4 A;  2J7J A;  2ENC A;  1ZR9 A;  2EM3 A;  4R2D A;  2YTO A;  1MEY C;  1RMD A;  3EPL A;  1UBD C;  1ZAA C;  2EMI A;  2EN2 A;  2R1F A;  2RPC A;  2EM6 A;  1X6H A;  1A1I A;  2A25 A;  2EPR A;  3M99 B;  4IS1 C;  2LVH A;  2JP9 A;  1ZU1 A;  2LV2 A;  1A1L A;  2EMF A;  2ELY A;  2EP3 A;  2YTG A;  4GZN C;  1TF6 A;  1YUJ A;  2BB8 A;  2YTI A;  1X3C A;  2EOZ A;  4M9V C;  2YTE A;  1X5W A;  2EQ3 A;  2EQ0 A;  2EMK A;  4R2A A;  2EMX A;  4R2S A;  2EMW A;  1G2D C;  4X9J A;  1JK2 A;  2EM5 A;  2DGC A;  4WSG A;  5KL5 A;  2EN1 A;  1WJP A;  2D9H A;  2YTP A;  2LT7 A;  4R2P A;  2ELZ A;  4IJD A;  1A1J A;  1UN6 B;  2EM7 A;  1X6E A;  2EM8 A;  2VRD A;  4F2J C;  2EPP A;  1TF3 A;  1YUI A;  2WBS A;  2EOX A;  4R2Q A;  2EPZ A;  4R2C A;  2EOI A;  2EMY A;  4R2E A;  1A1K A;  1KJK A;  2EM4 A;  2EMC A;  2ENH A;  2EOF A;  5KL2 A;  1DGC A;  1AAY A;  2LO3 A;  2EM2 A;  2GHF A;  3UK3 C;  1B69 A;  2EN7 A;  2EML A;  2EL4 A;  2EOH A;  2DRP A;  2EPC A;  2LCE A;  2EE8 A;  2DLQ A;  2PRT A;  2YTF A;  2EMG A;  5KL6 A;  2ENA A;  2M9A A;  2EPU A;  5KL7 A;  5KL4 A;  2HGH A; 
#chains in the Genus database with same CATH topology
 1PKP A;  5F3W A;  3JTZ A;  2GLI A;  4RHB B;  2MKD A;  2L6M A;  3EPJ A;  4HTG A;  4B3T E;  3ADI A;  2CPN A;  3JAM C;  5A6J A;  2YTJ A;  1X6F A;  2EN8 A;  1WRJ A;  3AV0 A;  1N33 E;  1STU A;  1MGT A;  3F6H A;  2WZO A;  2YSO A;  1BB8 A;  3J81 C;  2LUQ A;  2M7Q A;  2KON A;  2M4I A;  4ZYE A;  2LJH A;  1QNT A;  2EPX A;  5KL3 A;  1J26 A;  1TN9 A;  2WBU A;  2EMZ A;  5LMN E;  2EMH A;  3MSW A;  2I9I A;  4BC9 A;  2CTD A;  2M1S A;  2NAB A;  3KZY A;  4X8W A;  2EOJ A;  4F6M A;  1GZ6 A;  1NEI A;  3QG5 C;  3RMP A;  2EL5 A;  2EJ4 A;  2ZM6 E;  2ENC A;  2EM3 A;  3OML A;  2UUC E;  4N4R B;  4TUI A;  1MEY C;  1RMD A;  2R1F A;  2EM6 A;  2N3G A;  2A25 A;  3M99 B;  1XNQ E;  5LL6 R;  4LFB E;  2EMF A;  2YTG A;  4GKK E;  4MLV A;  1DQ3 A;  4JI2 E;  2IHR 1;  2YTI A;  1X3C A;  4X65 E;  4M9V C;  4WXC A;  2EQ0 A;  2EMK A;  3T1H E;  3P1X A;  1SFE A;  5A2Q C;  1YPN A;  2L2K B;  2FTX B;  1WJP A;  2LT7 A;  4O4K A;  1HNX E;  2DMY A;  2LTS A;  4GKJ E;  1A1J A;  5A6A A;  2VRD A;  2GPI A;  4F54 A;  3IWC A;  1L4S A;  2N3H A;  2UUB E;  4R2Q A;  3F6G A;  2EOI A;  5IT9 C;  1XMO E;  2HC5 A;  1KYQ A;  2BBG A;  2Q8U A;  2ENH A;  1PJS A;  1AAY A;  1DI2 A;  2EN7 A;  2EL4 A;  2DRP A;  2EPC A;  2LCE A;  2RS6 A;  4LF4 E;  2DLQ A;  2EMG A;  2ODR C;  2E1M A;  2M9A A;  2HGH A;  2V8Q B;  2YRK A;  3LLH A;  1ZBT A;  1RQ0 A;  4FK5 C;  2EPA A;  1GQE A;  2EMB A;  2DMI A;  2H36 X;  2JVA A;  2K4V A;  2YSP A;  4BCA A;  4OX9 E;  2MDR A;  4DR3 E;  4O5G A;  4JI3 E;  5AC5 A;  4LFA E;  5LMU E;  3EPK A;  2E5L E;  2KOU A;  2EM0 A;  5FLX C;  1A1H A;  1J5E E;  2CT1 A;  1G2F C;  2EOM A;  1A1G A;  2LJU A;  1N34 E;  2EOR A;  4DMI A;  3FIG A;  2YTQ A;  1PDA A;  2V83 A;  2UU9 E;  4DR5 E;  2EQ1 A;  5A6B A;  2YU8 A;  2EWL A;  1P47 A;  2NUG A;  3HPZ A;  3IWD A;  4KWY A;  2LMZ A;  4WFT A;  1ZR9 A;  3LML A;  1XMQ E;  2YTO A;  1FJG E;  1X6H A;  4O43 A;  4LF9 E;  4IS1 C;  1XNR E;  2JP9 A;  2RSM A;  2LV2 A;  4X64 E;  3C6M A;  2EPM X;  2ELY A;  5T6J A;  3HQ1 A;  1UIL A;  4P7D A;  1X5W A;  2EQ3 A;  2MC6 A;  3H09 A;  4M0V A;  2EMX A;  4R2A A;  2G7H A;  2EMW A;  4R2S A;  4LFC E;  1UHZ A;  2EZ6 A;  1IBL E;  3BID A;  4WSG A;  4LF7 E;  4BS9 A;  2EPL X;  2LRS A;  4LF6 E;  5KL5 A;  3TQM A;  2EN1 A;  2D9H A;  2YTP A;  4R2P A;  1T4N A;  4WXD A;  3C6K A;  4JI4 E;  2VF1 A;  2YWQ A;  1EH8 A;  4YHH E;  4F2J C;  2EPP A;  3VYY A;  3K6Q A;  4L8N A;  2EPO A;  4Q28 A;  3THN A;  4DV7 E;  1QU6 A;  1IQO A;  1A1K A;  1IBK E;  1X48 A;  1IMU A;  1O0W A;  2RS7 A;  5KL2 A;  5DNY A;  4DKK A;  2NUF A;  2GHF A;  3UK3 C;  1B69 A;  2VQF E;  1BBG A;  2DIX A;  2B9D A;  2FGG A;  2YT4 A;  2YTF A;  4R03 A;  2MC5 A;  2ENA A;  4GEQ B;  2R76 A;  4X66 E;  1T39 A;  3MHS C;  1I94 E;  2EOQ A;  5LLQ A;  4OOG C;  2EN4 A;  3HTX A;  2YRM A;  5AE1 A;  4R2R A;  1NCS A;  3JU0 A;  4JI1 E;  2LBS B;  2EM9 A;  5CFF E;  2MDG A;  2WCC 3;  1IBM E;  4HEI A;  1Z1B A;  2EL6 A;  1SR9 A;  2YTN A;  2E72 A;  5IV8 B;  1YSA C;  3J7A G;  2JR1 A;  2EN3 A;  4NHR A;  4LTY A;  4BBY A;  4DR2 E;  2EMA A;  2B7T A;  5AE3 A;  4B3S E;  2MKN A;  2EOE A;  2I13 A;  2KHX A;  4LF5 E;  1HNZ E;  1X49 A;  3T1Y E;  2YU5 A;  5A6B D;  2YRH A;  4NXM E;  5A6K A;  1LLM C;  4JI6 E;  2B7V A;  1JK1 A;  2LE2 A;  2ADR A;  4DUY E;  4TUG A;  4R2D A;  3HPS A;  3EPL A;  1UBD C;  2EMI A;  2EN2 A;  1PJQ A;  5IWA E;  2EPN A;  3J7Y p;  2LVH A;  1X47 A;  1ZU1 A;  1YFH A;  2JYA A;  3KWR A;  4K0K E;  1TF6 A;  4GZN C;  4F9A B;  2UXC E;  4ZYH A;  3L00 A;  2V87 A;  2DB2 A;  2YTE A;  2LTR A;  2UXB E;  1G2D C;  4B3R E;  4LU9 A;  4X9J A;  2RTX A;  1JK2 A;  2L3J A;  2YZT A;  1T4O A;  2EM5 A;  5IXM B;  2DGC A;  1YYK A;  2JWO A;  4DV2 E;  4YY3 E;  1YZ9 A;  4DUZ E;  1UN6 B;  2EM7 A;  2FV4 B;  1X6E A;  2EM8 A;  2ODR D;  4DV0 E;  1YUI A;  4L5N C;  2WBS A;  2EOX A;  5BR8 E;  2NUE A;  4R2E A;  2EMY A;  1YYO A;  3ZOQ B;  4X62 E;  2EMC A;  3DF6 A;  4B3M E;  4JI8 E;  1N32 E;  1DGC A;  2UUA E;  2LO3 A;  2EM2 A;  3C4B A;  3OTO E;  4DV6 E;  4WSP A;  2EML A;  3BBG A;  4BHC A;  3VK6 A;  5ADZ A;  2PRT A;  2EPK X;  4BHB A;  3KZZ A;  3ADG A;  1WHQ A;  2UXD E;  1EH7 A;  5KL7 A;  2EPU A;  4DR1 E;  2L92 A;  3HXL A;  4WPY A;  4JI0 E;  4BC7 A;  5TSE A;  2CSH A;  4I8O A;  2V89 A;  4JV5 E;  2WBT A;  2HJJ A;  4BMJ A;  3MHH C;  2EN6 A;  3DJW A;  2EOS A;  2RSI A;  3EQ1 A;  4P78 A;  4F6N A;  4F9B B;  4AQY E;  4DV5 E;  4DR6 E;  2YTD A;  1WXR A;  4NXN E;  2F4V E;  4DV1 E;  2HHH E;  2DLK A;  2JPA A;  3EPH A;  1FKA E;  1BBO A;  3IWB A;  2EOY A;  4DV4 E;  2EOO A;  4RH8 A;  1A1F A;  4JI7 E;  1T4L B;  1F2I G;  3VHT B;  2JXP A;  2J7J A;  5AE2 A;  5A69 A;  1ZAA C;  2RPC A;  1PJT A;  2YPN A;  3BGH A;  2B3T B;  4DV3 E;  1A1I A;  2EPR A;  1EKZ A;  4ZYD A;  3C4T A;  1A1L A;  1YUJ A;  2EP3 A;  2V88 A;  3ECR A;  2L2M A;  2BB8 A;  2JY9 A;  2LUP B;  2N8X A;  2EOZ A;  3ADL A;  2V85 A;  4DR7 E;  3THO B;  5AAS A;  1HNW E;  4LF8 E;  4KHP E;  1HR0 E;  2K7I A;  4WYQ B;  2VQE E;  4M30 A;  4KZS A;  4WX9 A;  1N3G A;  2L3C A;  3BF2 A;  2ELZ A;  4IJD A;  2DSY A;  1RC7 A;  4JYA E;  2L2N A;  1EH6 A;  2VE7 C;  2L33 A;  4M2Z A;  4MLQ A;  4JI5 E;  1TF3 A;  2NA2 A;  4O24 A;  2V86 A;  4DR4 E;  2EPZ A;  3ADJ A;  3AUZ A;  4J8Z A;  1ZBQ A;  4R2C A;  2L8T A;  2RQL A;  1KJK A;  1WHN A;  2EM4 A;  4F9C B;  3J80 C;  1YYW A;  1AH5 A;  4Q35 B;  2EOF A;  1T38 A;  1N36 E;  3VYX A;  1IQS A;  2EOH A;  2JOB A;  4NZV A;  4ZYG A;  2F8B A;  2EE8 A;  5AC4 A;  1GTK A;  5KL6 A;  4R8O A;  2JOX A;  5KL4 A; 
#chains in the Genus database with same CATH homology
 3MHS C;  2EOQ A;  2EN4 A;  2YRK A;  2GLI A;  2CSH A;  2YRM A;  4R2R A;  2MKD A;  4FK5 C;  2EPA A;  1NCS A;  2EMB A;  3EPJ A;  2WBT A;  2DMI A;  3MHH C;  2EM9 A;  2EN6 A;  2YSP A;  2MDG A;  2YTJ A;  2EOS A;  2WCC 3;  1X6F A;  2RSI A;  4F6N A;  1Z1B A;  2EL6 A;  2YTN A;  3EPK A;  2EN8 A;  2E72 A;  2EM0 A;  2YTD A;  1YSA C;  2YSO A;  1A1H A;  2EN3 A;  1BB8 A;  2CT1 A;  2EMA A;  1G2F C;  2EOM A;  1A1G A;  5KL3 A;  2DLK A;  2EPX A;  2JPA A;  2EOE A;  2EOR A;  2WBU A;  2EMZ A;  1TN9 A;  2EMH A;  2I13 A;  2MKN A;  2YTQ A;  2YU5 A;  3EPH A;  2YRH A;  2CTD A;  1BBO A;  2EQ1 A;  2EOY A;  2YU8 A;  2NAB A;  1LLM C;  2EOO A;  2EOJ A;  4F6M A;  1P47 A;  1JK1 A;  1A1F A;  1F2I G;  2ADR A;  2EL5 A;  3VHT B;  2EJ4 A;  2J7J A;  2ENC A;  1ZR9 A;  2EM3 A;  4R2D A;  2YTO A;  1MEY C;  1RMD A;  3EPL A;  1UBD C;  1ZAA C;  2EMI A;  2EN2 A;  2R1F A;  2RPC A;  2EM6 A;  1X6H A;  1A1I A;  2A25 A;  2EPR A;  3M99 B;  4IS1 C;  2LVH A;  2JP9 A;  1ZU1 A;  2LV2 A;  1A1L A;  2EMF A;  2ELY A;  2EP3 A;  2YTG A;  4GZN C;  1TF6 A;  1YUJ A;  2BB8 A;  2YTI A;  1X3C A;  2EOZ A;  4M9V C;  2YTE A;  1X5W A;  2EQ3 A;  2EQ0 A;  2EMK A;  4R2A A;  2EMX A;  4R2S A;  2EMW A;  1G2D C;  4X9J A;  1JK2 A;  2EM5 A;  2DGC A;  4WSG A;  5KL5 A;  2EN1 A;  1WJP A;  2D9H A;  2YTP A;  2LT7 A;  4R2P A;  2ELZ A;  4IJD A;  1A1J A;  1UN6 B;  2EM7 A;  1X6E A;  2EM8 A;  2VRD A;  4F2J C;  2EPP A;  1TF3 A;  1YUI A;  2WBS A;  2EOX A;  4R2Q A;  2EPZ A;  4R2C A;  2EOI A;  2EMY A;  4R2E A;  1A1K A;  1KJK A;  2EM4 A;  2EMC A;  2ENH A;  2EOF A;  5KL2 A;  1DGC A;  1AAY A;  2LO3 A;  2EM2 A;  2GHF A;  3UK3 C;  1B69 A;  2EN7 A;  2EML A;  2EL4 A;  2EOH A;  2DRP A;  2EPC A;  2LCE A;  2EE8 A;  2DLQ A;  2PRT A;  2YTF A;  2EMG A;  5KL6 A;  2ENA A;  2M9A A;  2EPU A;  5KL7 A;  5KL4 A;  2HGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...