2EN8A

Solution structure of the c2h2 type zinc finger (region 171-203) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKSHTCDECGKNFCYISALRIHQRVHMGEKCSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 171-203) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en8A01
2EOHA 1TN9A 2EN3A 2EOFA 2DLQA 2EPXA 2WBTA 1X6EA 2EQ3A 1X5WA 1ZAAC 1ZR9A 2DRPA 1AAYA 4WSGA 2VRDA 3EPJA 1UN6B 2RPCA 2EPAA 2MDGA 2EMHA 2EL6A 2ELZA 2GHFA 2EPRA 1A1IA 2YSOA 2YTIA 2YU5A 3VHTB 2PRTA 2EOQA 2YTPA 1X6FA 4R2SA 3MHSC 1TF3A 4M9VC 2EM3A 2JPAA 2EMAA 3EPLA 4F6MA 2WBSA 1KJKA 2EMKA 2EM8A 4IJDA 1G2DC 2LV2A 2YTDA 2EMFA 1X6HA 4R2QA 2ENHA 2I13A 2EN4A 4R2PA 3MHHC 2EORA 2EPPA 2EMIA 2EMGA 2EPCA 2BB8A 2YTOA 5KL6A 2JP9A 2ADRA 5KL3A 1P47A 2EPUA 2EMZA 3UK3C 2WBUA 4R2CA 2CTDA 2EE8A 2LVHA 2CT1A 4F6NA 1F2IG 2A25A 2EN2A 4F2JC 4IS1C 4R2AA 1JK1A 2HGHA 1BB8A 2EOXA 2EMYA 2YTNA 4R2RA 2R1FA 2EM5A 2YTFA 1NCSA 1ZU1A 2EMBA 2EM7A 1A1GA 2EM2A 2RSIA 2M9AA 1A1HA 2EM6A 5KL2A 1A1KA 3M99B 2EJ4A 2LO3A 1A1LA 2EM9A 2GLIA 2EP3A 2CSHA 4X9JA 2DLKA 2ENAA 2YRHA 1MEYC 1YUIA 1BBOA 2ENCA 2YRKA 2EN8A 2EOIA 2YTQA 3EPHA 2DMIA 1JK2A 1DGCA 1UBDC 2EPZA 2EOYA 2EN7A 2YU8A 4R2DA 2EMCA 1WJPA 5KL5A 2ELYA 1A1FA 2EOOA 2EM4A 4R2EA 2WCC3 2D9HA 1B69A 2EQ0A 2DGCA 2EMWA 2EN6A 2E72A 2LCEA 2YTJA 2EOSA 2EOJA 2EOZA 3EPKA 1RMDA 4FK5C 2LT7A 2EMXA 2J7JA 2EM0A 2NABA 5KL4A 1Z1BA 2YTEA 2EMLA 2YTGA 1A1JA 2EL5A 2EL4A 1YSAC 2MKNA 2EOMA 2EN1A 1X3CA 1G2FC 2MKDA 1TF6A 1YUJA 2YSPA 2YRMA 5KL7A 2EQ1A 1LLMC 4GZNC 2EOEA
chains in the Genus database with same CATH superfamily
2V87A 4O4KA 1QNTA 1XNQE 2M7QA 1WXRA 2EOFA 4HTGA 1X6EA 2LBSB 1RQ0A 2EQ3A 4NZVA 2DRPA 4WSPA 2K4VA 4P7DA 2RTXA 4YY3E 2L33A 2MDGA 2RQLA 4BMJA 3P1XA 2YSOA 4NXME 3VHTB 4DUZE 3AV0A 4ZYEA 1X6FA 2B3TB 2ODRD 3ADJA 2EM3A 2V85A 4X65E 4B3SE 3L00A 3ADLA 2EM8A 2LUQA 2JYAA 1YYWA 5AC4A 4DV1E 2Q8UA 3KWRA 4OX9E 2EMFA 4BHBA 2YZTA 4R2QA 4GEQB 2I13A 4R2PA 2FV4B 4DKKA 1YFHA 3IWDA 5LLQA 2EPUA 2V8QB 1GZ6A 3UK3C 4ZYGA 1F2IG 4F2JC 2VQEE 3RMPA 4OOGC 1T39A 4DR6E 2EMYA 2LTRA 4R2RA 2EPNA 1ZU1A 1WHQA 4AQYE 1A1GA 1RC7A 1A1KA 2N3GA 4DV2E 5A69A 2F8BA 1IBME 2YRKA 2EN8A 4LFBE 2ZM6E 4YHHE 1STUA 2DMIA 4JI3E 1PJSA 2M1SA 2MC5A 2EPZA 3TQMA 2K7IA 5KL5A 1IQSA 2ELYA 3F6HA 2VQFE 2HC5A 4GKJE 2WCC3 2EQ0A 1MGTA 4LF9E 1T4LB 2E72A 4JV5E 2JWOA 1RMDA 4TUIA 3MSWA 3J7Yp 1Z1BA 4LF6E 1IQOA 3VYYA 2EMLA 2NA2A 4NXNE 5A6KA 1IBLE 2MKNA 2UXBE 1NEIA 3LMLA 5AE3A 5A2QC 2MKDA 5KL7A 4LU9A 4M30A 3ADIA 2V89A 2KONA 1XNRE 3FIGA 2F4VE 4B3TE 1TN9A 3THOB 2UXCE 4NHRA 2UUBE 1AAYA 4JI6E 2FTXB 4WSGA 2VRDA 5LMNE 5A6JA 1UN6B 2EMHA 2EL6A 2ELZA 1AH5A 2EPRA 1A1IA 4MLVA 4M0VA 1HR0E 2YU5A 2PRTA 3THNA 2M4IA 3BGHA 2UUAE 1IMUA 2V86A 2EMAA 2JPAA 1DQ3A 4L8NA 2EPMX 2WBSA 4F6MA 3J80C 1YYKA 2IHR1 2EMKA 2LRSA 2YTDA 2E5LE 4DV7E 2JXPA 3C6KA 2LJUA 3MHHC 2EPPA 2JY9A 2EPCA 1GTKA 2YTOA 3T1YE 3VK6A 4WXDA 2EMZA 2CTDA 2CT1A 2A25A 3IWCA 2NUGA 4IS1C 1JK1A 1BB8A 4RHBB 2JR1A 4F9AB 5CFFE 2EM2A 2L2MA 2EM6A 2NUFA 2LO3A 1WHNA 2EM9A 4GKKE 2EP3A 4DV4E 4X9JA 2DLKA 1MEYC 1BBOA 4WPYA 3BIDA 2EOIA 4BCAA 1UBDC 1JK2A 1DGCA 1PDAA 2EN7A 2YU8A 4R2DA 2YWQA 4JI2E 2EOOA 4R2EA 5IV8B 2D9HA 2EMWA 4DMIA 2YTJA 2L8TA 4L5NC 3KZYA 3JTZA 2EOZA 4KHPE 2EMXA 1PKPA 2DB2A 4Q28A 1FJGE 4F54A 2EOMA 3IWBA 2DSYA 1FKAE 4JI0E 2RS6A 4X62E 2UU9E 2N3HA 4Q35B 5A6BA 2YSPA 1YPNA 2YRMA 4X64E 2I9IA 1ZBQA 1LLMC 4DR3E 3QG5C 4LFAE 2HJJA 5AE2A 4DV6E 3VYXA 2EN3A 4LF5E 2DLQA 2EPXA 4BC9A 5FLXC 2RSMA 1X5WA 4JI5E 5LMUE 3EPJA 4DR2E 3BF2A 3HQ1A 4HEIA 4J8ZA 2GHFA 4O5GA 1EH6A 2L3CA 1J5EE 3C4BA 2CPNA 4F9CB 1J26A 5DNYA 2YTIA 2MC6A 2EOQA 2NUEA 3MHSC 1TF3A 1I94E 4DR4E 3EPLA 1KJKA 4DUYE 1G2DC 4LF8E 1SR9A 3OTOE 3C6MA 2LJHA 2EN4A 2EORA 4F9BB 2JP9A 1P47A 4DV5E 4JYAE 2LVHA 3ECRA 5AASA 2RS7A 2EN2A 4N4RB 2HGHA 4R2AA 4JI1E 1ZBTA 1EH8A 2EPOA 2YTNA 3H09A 2R1FA 2EM5A 2DMYA 2LTSA 1O0WA 2GPIA 2M9AA 5A6AA 1BBGA 1IBKE 1N3GA 2EJ4A 4WXCA 1SFEA 1A1LA 2GLIA 3JAMC 1YUIA 2KOUA 2YTQA 3EPHA 2JVAA 2JOBA 4B3ME 4B3RE 2H36X 2EMCA 4JI7E 2DIXA 3J81C 2G7HA 5ADZA 1A1FA 2JOXA 2YT4A 2DGCA 4O24A 2EN6A 4LFCE 2B7TA 2LCEA 4BHCA 2L3JA 2EOSA 1XMQE 4DR7E 1T38A 2V83A 2LUPB 3EPKA 4X8WA 4FK5C 2MDRA 2EM0A 2NABA 2VF1A 4LF7E 5A6BD 2FGGA 2YTEA 2YTGA 1A1JA 2EL4A 3HPSA 4TUGA 1X3CA 2B9DA 1G2FC 3AUZA 1UILA 4JI8E 4DR5E 4P78A 2E1MA 3EQ1A 3HXLA 4R8OA 3F6GA 4GZNC 3LLHA 3K6QA 2EOHA 2WZOA 1N34E 1EH7A 2WBTA 4M2ZA 2KHXA 1UHZA 1T4NA 1HNXE 1WRJA 1ZAAC 1ZR9A 3KZZA 4LTYA 4BC7A 2L6MA 2LMZA 1YZ9A 4R03A 2RPCA 2EPAA 5LL6R 1HNWE 2UXDE 5AC5A 1X49A 1N36E 2B7VA 2YTPA 3DF6A 4R2SA 1N32E 4M9VC 3C4TA 4WX9A 1HNZE 2BBGA 4IJDA 4DV0E 4KZSA 1DI2A 1PJTA 2YPNA 2LV2A 3ZOQB 1X6HA 2V88A 4I8OA 1X48A 2ENHA 1T4OA 5TSEA 2EMIA 2EMGA 2R76A 2BB8A 2EPLX 5KL6A 2ADRA 3JU0A 5KL3A 4DR1E 2WBUA 4R2CA 2EE8A 3J7AG 4F6NA 4O43A 2L2KB 1X47A 3OMLA 2EOXA 2YTFA 4K0KE 1NCSA 2EMBA 2EM7A 4X66E 2RSIA 2UUCE 5IWAE 2N8XA 2ODRC 2HHHE 1A1HA 5KL2A 1N33E 3HPZA 4WFTA 2EZ6A 3M99B 2CSHA 1L4SA 5F3WA 5BR8E 4MLQA 2ENAA 2YRHA 3BBGA 2ENCA 4RH8A 4BBYA 3T1HE 1XMOE 3DJWA 5IT9C 4WYQB 2EOYA 2EWLA 1WJPA 4LF4E 5AE1A 4ZYDA 1PJQA 2EM4A 1EKZA 1B69A 3ADGA 2EPKX 4ZYHA 4KWYA 4JI4E 3HTXA 2EOJA 2L2NA 2VE7C 4BS9A 2LT7A 2J7JA 5KL4A 1KYQA 2LE2A 4DV3E 2EL5A 1QU6A 1GQEA 1YSAC 2EN1A 1TF6A 1YUJA 2L92A 5IXMB 2EQ1A 5T6JA 1YYOA 2EOEA
chains in the Genus database with same CATH topology
2EOHA 1TN9A 2EN3A 2EOFA 2DLQA 2EPXA 2WBTA 1X6EA 2EQ3A 1X5WA 1ZAAC 1ZR9A 2DRPA 1AAYA 4WSGA 2VRDA 3EPJA 1UN6B 2RPCA 2EPAA 2MDGA 2EMHA 2EL6A 2ELZA 2GHFA 2EPRA 1A1IA 2YSOA 2YTIA 2YU5A 3VHTB 2PRTA 2EOQA 2YTPA 1X6FA 4R2SA 3MHSC 1TF3A 4M9VC 2EM3A 2JPAA 2EMAA 3EPLA 4F6MA 2WBSA 1KJKA 2EMKA 2EM8A 4IJDA 1G2DC 2LV2A 2YTDA 2EMFA 1X6HA 4R2QA 2ENHA 2I13A 2EN4A 4R2PA 3MHHC 2EORA 2EPPA 2EMIA 2EMGA 2EPCA 2BB8A 2YTOA 5KL6A 2JP9A 2ADRA 5KL3A 1P47A 2EPUA 2EMZA 3UK3C 2WBUA 4R2CA 2CTDA 2EE8A 2LVHA 2CT1A 4F6NA 1F2IG 2A25A 2EN2A 4F2JC 4IS1C 4R2AA 1JK1A 2HGHA 1BB8A 2EOXA 2EMYA 2YTNA 4R2RA 2R1FA 2EM5A 2YTFA 1NCSA 1ZU1A 2EMBA 2EM7A 1A1GA 2EM2A 2RSIA 2M9AA 1A1HA 2EM6A 5KL2A 1A1KA 3M99B 2EJ4A 2LO3A 1A1LA 2EM9A 2GLIA 2EP3A 2CSHA 4X9JA 2DLKA 2ENAA 2YRHA 1MEYC 1YUIA 1BBOA 2ENCA 2YRKA 2EN8A 2EOIA 2YTQA 3EPHA 2DMIA 1JK2A 1DGCA 1UBDC 2EPZA 2EOYA 2EN7A 2YU8A 4R2DA 2EMCA 1WJPA 5KL5A 2ELYA 1A1FA 2EOOA 2EM4A 4R2EA 2WCC3 2D9HA 1B69A 2EQ0A 2DGCA 2EMWA 2EN6A 2E72A 2LCEA 2YTJA 2EOSA 2EOJA 2EOZA 3EPKA 1RMDA 4FK5C 2LT7A 2EMXA 2J7JA 2EM0A 2NABA 5KL4A 1Z1BA 2YTEA 2EMLA 2YTGA 1A1JA 2EL5A 2EL4A 1YSAC 2MKNA 2EOMA 2EN1A 1X3CA 1G2FC 2MKDA 1TF6A 1YUJA 2YSPA 2YRMA 5KL7A 2EQ1A 1LLMC 4GZNC 2EOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOH A;  1TN9 A;  2EN3 A;  2EOF A;  2DLQ A;  2EPX A;  2WBT A;  1X6E A;  2EQ3 A;  1X5W A;  1ZAA C;  1ZR9 A;  2DRP A;  1AAY A;  4WSG A;  2VRD A;  3EPJ A;  1UN6 B;  2RPC A;  2EPA A;  2MDG A;  2EMH A;  2EL6 A;  2ELZ A;  2GHF A;  2EPR A;  1A1I A;  2YSO A;  2YTI A;  2YU5 A;  3VHT B;  2PRT A;  2EOQ A;  2YTP A;  1X6F A;  4R2S A;  3MHS C;  1TF3 A;  4M9V C;  2EM3 A;  2JPA A;  2EMA A;  3EPL A;  4F6M A;  2WBS A;  1KJK A;  2EMK A;  2EM8 A;  4IJD A;  1G2D C;  2LV2 A;  2YTD A;  2EMF A;  1X6H A;  4R2Q A;  2ENH A;  2I13 A;  2EN4 A;  4R2P A;  3MHH C;  2EOR A;  2EPP A;  2EMI A;  2EMG A;  2EPC A;  2BB8 A;  2YTO A;  5KL6 A;  2JP9 A;  2ADR A;  5KL3 A;  1P47 A;  2EPU A;  2EMZ A;  3UK3 C;  2WBU A;  4R2C A;  2CTD A;  2EE8 A;  2LVH A;  2CT1 A;  4F6N A;  1F2I G;  2A25 A;  2EN2 A;  4F2J C;  4IS1 C;  4R2A A;  1JK1 A;  2HGH A;  1BB8 A;  2EOX A;  2EMY A;  2YTN A;  4R2R A;  2R1F A;  2EM5 A;  2YTF A;  1NCS A;  1ZU1 A;  2EMB A;  2EM7 A;  1A1G A;  2EM2 A;  2RSI A;  2M9A A;  1A1H A;  2EM6 A;  5KL2 A;  1A1K A;  3M99 B;  2EJ4 A;  2LO3 A;  1A1L A;  2EM9 A;  2GLI A;  2EP3 A;  2CSH A;  4X9J A;  2DLK A;  2ENA A;  2YRH A;  1MEY C;  1YUI A;  1BBO A;  2ENC A;  2YRK A;  2EN8 A;  2EOI A;  2YTQ A;  3EPH A;  2DMI A;  1JK2 A;  1DGC A;  1UBD C;  2EPZ A;  2EOY A;  2EN7 A;  2YU8 A;  4R2D A;  2EMC A;  1WJP A;  5KL5 A;  2ELY A;  1A1F A;  2EOO A;  2EM4 A;  4R2E A;  2WCC 3;  2D9H A;  1B69 A;  2EQ0 A;  2DGC A;  2EMW A;  2EN6 A;  2E72 A;  2LCE A;  2YTJ A;  2EOS A;  2EOJ A;  2EOZ A;  3EPK A;  1RMD A;  4FK5 C;  2LT7 A;  2EMX A;  2J7J A;  2EM0 A;  2NAB A;  5KL4 A;  1Z1B A;  2YTE A;  2EML A;  2YTG A;  1A1J A;  2EL5 A;  2EL4 A;  1YSA C;  2MKN A;  2EOM A;  2EN1 A;  1X3C A;  1G2F C;  2MKD A;  1TF6 A;  1YUJ A;  2YSP A;  2YRM A;  5KL7 A;  2EQ1 A;  1LLM C;  4GZN C;  2EOE A; 
#chains in the Genus database with same CATH topology
 2V87 A;  4O4K A;  1QNT A;  1XNQ E;  2M7Q A;  1WXR A;  2EOF A;  4HTG A;  1X6E A;  2LBS B;  1RQ0 A;  2EQ3 A;  4NZV A;  2DRP A;  4WSP A;  2K4V A;  4P7D A;  2RTX A;  4YY3 E;  2L33 A;  2MDG A;  2RQL A;  4BMJ A;  3P1X A;  2YSO A;  4NXM E;  3VHT B;  4DUZ E;  3AV0 A;  4ZYE A;  1X6F A;  2B3T B;  2ODR D;  3ADJ A;  2EM3 A;  2V85 A;  4X65 E;  4B3S E;  3L00 A;  3ADL A;  2EM8 A;  2LUQ A;  2JYA A;  1YYW A;  5AC4 A;  4DV1 E;  2Q8U A;  3KWR A;  4OX9 E;  2EMF A;  4BHB A;  2YZT A;  4R2Q A;  4GEQ B;  2I13 A;  4R2P A;  2FV4 B;  4DKK A;  1YFH A;  3IWD A;  5LLQ A;  2EPU A;  2V8Q B;  1GZ6 A;  3UK3 C;  4ZYG A;  1F2I G;  4F2J C;  2VQE E;  3RMP A;  4OOG C;  1T39 A;  4DR6 E;  2EMY A;  2LTR A;  4R2R A;  2EPN A;  1ZU1 A;  1WHQ A;  4AQY E;  1A1G A;  1RC7 A;  1A1K A;  2N3G A;  4DV2 E;  5A69 A;  2F8B A;  1IBM E;  2YRK A;  2EN8 A;  4LFB E;  2ZM6 E;  4YHH E;  1STU A;  2DMI A;  4JI3 E;  1PJS A;  2M1S A;  2MC5 A;  2EPZ A;  3TQM A;  2K7I A;  5KL5 A;  1IQS A;  2ELY A;  3F6H A;  2VQF E;  2HC5 A;  4GKJ E;  2WCC 3;  2EQ0 A;  1MGT A;  4LF9 E;  1T4L B;  2E72 A;  4JV5 E;  2JWO A;  1RMD A;  4TUI A;  3MSW A;  3J7Y p;  1Z1B A;  4LF6 E;  1IQO A;  3VYY A;  2EML A;  2NA2 A;  4NXN E;  5A6K A;  1IBL E;  2MKN A;  2UXB E;  1NEI A;  3LML A;  5AE3 A;  5A2Q C;  2MKD A;  5KL7 A;  4LU9 A;  4M30 A;  3ADI A;  2V89 A;  2KON A;  1XNR E;  3FIG A;  2F4V E;  4B3T E;  1TN9 A;  3THO B;  2UXC E;  4NHR A;  2UUB E;  1AAY A;  4JI6 E;  2FTX B;  4WSG A;  2VRD A;  5LMN E;  5A6J A;  1UN6 B;  2EMH A;  2EL6 A;  2ELZ A;  1AH5 A;  2EPR A;  1A1I A;  4MLV A;  4M0V A;  1HR0 E;  2YU5 A;  2PRT A;  3THN A;  2M4I A;  3BGH A;  2UUA E;  1IMU A;  2V86 A;  2EMA A;  2JPA A;  1DQ3 A;  4L8N A;  2EPM X;  2WBS A;  4F6M A;  3J80 C;  1YYK A;  2IHR 1;  2EMK A;  2LRS A;  2YTD A;  2E5L E;  4DV7 E;  2JXP A;  3C6K A;  2LJU A;  3MHH C;  2EPP A;  2JY9 A;  2EPC A;  1GTK A;  2YTO A;  3T1Y E;  3VK6 A;  4WXD A;  2EMZ A;  2CTD A;  2CT1 A;  2A25 A;  3IWC A;  2NUG A;  4IS1 C;  1JK1 A;  1BB8 A;  4RHB B;  2JR1 A;  4F9A B;  5CFF E;  2EM2 A;  2L2M A;  2EM6 A;  2NUF A;  2LO3 A;  1WHN A;  2EM9 A;  4GKK E;  2EP3 A;  4DV4 E;  4X9J A;  2DLK A;  1MEY C;  1BBO A;  4WPY A;  3BID A;  2EOI A;  4BCA A;  1UBD C;  1JK2 A;  1DGC A;  1PDA A;  2EN7 A;  2YU8 A;  4R2D A;  2YWQ A;  4JI2 E;  2EOO A;  4R2E A;  5IV8 B;  2D9H A;  2EMW A;  4DMI A;  2YTJ A;  2L8T A;  4L5N C;  3KZY A;  3JTZ A;  2EOZ A;  4KHP E;  2EMX A;  1PKP A;  2DB2 A;  4Q28 A;  1FJG E;  4F54 A;  2EOM A;  3IWB A;  2DSY A;  1FKA E;  4JI0 E;  2RS6 A;  4X62 E;  2UU9 E;  2N3H A;  4Q35 B;  5A6B A;  2YSP A;  1YPN A;  2YRM A;  4X64 E;  2I9I A;  1ZBQ A;  1LLM C;  4DR3 E;  3QG5 C;  4LFA E;  2HJJ A;  5AE2 A;  4DV6 E;  3VYX A;  2EN3 A;  4LF5 E;  2DLQ A;  2EPX A;  4BC9 A;  5FLX C;  2RSM A;  1X5W A;  4JI5 E;  5LMU E;  3EPJ A;  4DR2 E;  3BF2 A;  3HQ1 A;  4HEI A;  4J8Z A;  2GHF A;  4O5G A;  1EH6 A;  2L3C A;  1J5E E;  3C4B A;  2CPN A;  4F9C B;  1J26 A;  5DNY A;  2YTI A;  2MC6 A;  2EOQ A;  2NUE A;  3MHS C;  1TF3 A;  1I94 E;  4DR4 E;  3EPL A;  1KJK A;  4DUY E;  1G2D C;  4LF8 E;  1SR9 A;  3OTO E;  3C6M A;  2LJH A;  2EN4 A;  2EOR A;  4F9B B;  2JP9 A;  1P47 A;  4DV5 E;  4JYA E;  2LVH A;  3ECR A;  5AAS A;  2RS7 A;  2EN2 A;  4N4R B;  2HGH A;  4R2A A;  4JI1 E;  1ZBT A;  1EH8 A;  2EPO A;  2YTN A;  3H09 A;  2R1F A;  2EM5 A;  2DMY A;  2LTS A;  1O0W A;  2GPI A;  2M9A A;  5A6A A;  1BBG A;  1IBK E;  1N3G A;  2EJ4 A;  4WXC A;  1SFE A;  1A1L A;  2GLI A;  3JAM C;  1YUI A;  2KOU A;  2YTQ A;  3EPH A;  2JVA A;  2JOB A;  4B3M E;  4B3R E;  2H36 X;  2EMC A;  4JI7 E;  2DIX A;  3J81 C;  2G7H A;  5ADZ A;  1A1F A;  2JOX A;  2YT4 A;  2DGC A;  4O24 A;  2EN6 A;  4LFC E;  2B7T A;  2LCE A;  4BHC A;  2L3J A;  2EOS A;  1XMQ E;  4DR7 E;  1T38 A;  2V83 A;  2LUP B;  3EPK A;  4X8W A;  4FK5 C;  2MDR A;  2EM0 A;  2NAB A;  2VF1 A;  4LF7 E;  5A6B D;  2FGG A;  2YTE A;  2YTG A;  1A1J A;  2EL4 A;  3HPS A;  4TUG A;  1X3C A;  2B9D A;  1G2F C;  3AUZ A;  1UIL A;  4JI8 E;  4DR5 E;  4P78 A;  2E1M A;  3EQ1 A;  3HXL A;  4R8O A;  3F6G A;  4GZN C;  3LLH A;  3K6Q A;  2EOH A;  2WZO A;  1N34 E;  1EH7 A;  2WBT A;  4M2Z A;  2KHX A;  1UHZ A;  1T4N A;  1HNX E;  1WRJ A;  1ZAA C;  1ZR9 A;  3KZZ A;  4LTY A;  4BC7 A;  2L6M A;  2LMZ A;  1YZ9 A;  4R03 A;  2RPC A;  2EPA A;  5LL6 R;  1HNW E;  2UXD E;  5AC5 A;  1X49 A;  1N36 E;  2B7V A;  2YTP A;  3DF6 A;  4R2S A;  1N32 E;  4M9V C;  3C4T A;  4WX9 A;  1HNZ E;  2BBG A;  4IJD A;  4DV0 E;  4KZS A;  1DI2 A;  1PJT A;  2YPN A;  2LV2 A;  3ZOQ B;  1X6H A;  2V88 A;  4I8O A;  1X48 A;  2ENH A;  1T4O A;  5TSE A;  2EMI A;  2EMG A;  2R76 A;  2BB8 A;  2EPL X;  5KL6 A;  2ADR A;  3JU0 A;  5KL3 A;  4DR1 E;  2WBU A;  4R2C A;  2EE8 A;  3J7A G;  4F6N A;  4O43 A;  2L2K B;  1X47 A;  3OML A;  2EOX A;  2YTF A;  4K0K E;  1NCS A;  2EMB A;  2EM7 A;  4X66 E;  2RSI A;  2UUC E;  5IWA E;  2N8X A;  2ODR C;  2HHH E;  1A1H A;  5KL2 A;  1N33 E;  3HPZ A;  4WFT A;  2EZ6 A;  3M99 B;  2CSH A;  1L4S A;  5F3W A;  5BR8 E;  4MLQ A;  2ENA A;  2YRH A;  3BBG A;  2ENC A;  4RH8 A;  4BBY A;  3T1H E;  1XMO E;  3DJW A;  5IT9 C;  4WYQ B;  2EOY A;  2EWL A;  1WJP A;  4LF4 E;  5AE1 A;  4ZYD A;  1PJQ A;  2EM4 A;  1EKZ A;  1B69 A;  3ADG A;  2EPK X;  4ZYH A;  4KWY A;  4JI4 E;  3HTX A;  2EOJ A;  2L2N A;  2VE7 C;  4BS9 A;  2LT7 A;  2J7J A;  5KL4 A;  1KYQ A;  2LE2 A;  4DV3 E;  2EL5 A;  1QU6 A;  1GQE A;  1YSA C;  2EN1 A;  1TF6 A;  1YUJ A;  2L92 A;  5IXM B;  2EQ1 A;  5T6J A;  1YYO A;  2EOE A; 
#chains in the Genus database with same CATH homology
 2EOH A;  1TN9 A;  2EN3 A;  2EOF A;  2DLQ A;  2EPX A;  2WBT A;  1X6E A;  2EQ3 A;  1X5W A;  1ZAA C;  1ZR9 A;  2DRP A;  1AAY A;  4WSG A;  2VRD A;  3EPJ A;  1UN6 B;  2RPC A;  2EPA A;  2MDG A;  2EMH A;  2EL6 A;  2ELZ A;  2GHF A;  2EPR A;  1A1I A;  2YSO A;  2YTI A;  2YU5 A;  3VHT B;  2PRT A;  2EOQ A;  2YTP A;  1X6F A;  4R2S A;  3MHS C;  1TF3 A;  4M9V C;  2EM3 A;  2JPA A;  2EMA A;  3EPL A;  4F6M A;  2WBS A;  1KJK A;  2EMK A;  2EM8 A;  4IJD A;  1G2D C;  2LV2 A;  2YTD A;  2EMF A;  1X6H A;  4R2Q A;  2ENH A;  2I13 A;  2EN4 A;  4R2P A;  3MHH C;  2EOR A;  2EPP A;  2EMI A;  2EMG A;  2EPC A;  2BB8 A;  2YTO A;  5KL6 A;  2JP9 A;  2ADR A;  5KL3 A;  1P47 A;  2EPU A;  2EMZ A;  3UK3 C;  2WBU A;  4R2C A;  2CTD A;  2EE8 A;  2LVH A;  2CT1 A;  4F6N A;  1F2I G;  2A25 A;  2EN2 A;  4F2J C;  4IS1 C;  4R2A A;  1JK1 A;  2HGH A;  1BB8 A;  2EOX A;  2EMY A;  2YTN A;  4R2R A;  2R1F A;  2EM5 A;  2YTF A;  1NCS A;  1ZU1 A;  2EMB A;  2EM7 A;  1A1G A;  2EM2 A;  2RSI A;  2M9A A;  1A1H A;  2EM6 A;  5KL2 A;  1A1K A;  3M99 B;  2EJ4 A;  2LO3 A;  1A1L A;  2EM9 A;  2GLI A;  2EP3 A;  2CSH A;  4X9J A;  2DLK A;  2ENA A;  2YRH A;  1MEY C;  1YUI A;  1BBO A;  2ENC A;  2YRK A;  2EN8 A;  2EOI A;  2YTQ A;  3EPH A;  2DMI A;  1JK2 A;  1DGC A;  1UBD C;  2EPZ A;  2EOY A;  2EN7 A;  2YU8 A;  4R2D A;  2EMC A;  1WJP A;  5KL5 A;  2ELY A;  1A1F A;  2EOO A;  2EM4 A;  4R2E A;  2WCC 3;  2D9H A;  1B69 A;  2EQ0 A;  2DGC A;  2EMW A;  2EN6 A;  2E72 A;  2LCE A;  2YTJ A;  2EOS A;  2EOJ A;  2EOZ A;  3EPK A;  1RMD A;  4FK5 C;  2LT7 A;  2EMX A;  2J7J A;  2EM0 A;  2NAB A;  5KL4 A;  1Z1B A;  2YTE A;  2EML A;  2YTG A;  1A1J A;  2EL5 A;  2EL4 A;  1YSA C;  2MKN A;  2EOM A;  2EN1 A;  1X3C A;  1G2F C;  2MKD A;  1TF6 A;  1YUJ A;  2YSP A;  2YRM A;  5KL7 A;  2EQ1 A;  1LLM C;  4GZN C;  2EOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...