2EN8A

Solution structure of the c2h2 type zinc finger (region 171-203) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKSHTCDECGKNFCYISALRIHQRVHMGEKCSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 171-203) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en8A01
2EQ3A 2WBUA 1X3CA 1DGCA 4R2EA 3MHHC 2EPRA 1TF3A 2EPPA 2LVHA 2EOSA 1X5WA 2DGCA 2ELYA 2LV2A 2EE8A 2RSIA 2YSPA 4R2QA 2WBTA 2YTFA 2EM7A 2EOFA 2EMCA 5KL6A 2EMGA 2A25A 2EMKA 2ENAA 2EPUA 2JPAA 4F6MA 1X6EA 2E72A 2NABA 3MHSC 5KL5A 2CT1A 2EMIA 2EM3A 1TN9A 2CSHA 2EQ0A 5KL4A 2EMXA 1JK2A 2ADRA 2M9AA 2BB8A 4F2JC 2GLIA 5KL7A 1X6HA 2EOEA 2EM4A 1BBOA 2EPCA 2DLQA 4FK5C 2GHFA 2MDGA 2YTEA 3UK3C 1P47A 2EPZA 2MKNA 2EMAA 1UN6B 1JK1A 3EPKA 2J7JA 2DLKA 4WSGA 1A1GA 1AAYA 2WCC3 4GZNC 1A1IA 2EM5A 2DRPA 2LT7A 1YSAC 1BB8A 1ZR9A 1RMDA 4R2PA 2YTIA 2EMYA 2CTDA 2YTNA 1ZU1A 2EM2A 3M99B 4R2DA 2EN2A 2EL5A 1YUIA 2YRKA 2EM8A 2MKDA 2EMFA 2EOHA 2YTQA 2JP9A 1NCSA 2EOIA 2YTDA 2ELZA 2YTPA 1G2FC 1X6FA 3EPHA 2EN7A 1A1JA 2EOMA 2EPXA 2EJ4A 1G2DC 2YRMA 2PRTA 2I13A 2VRDA 2ENCA 4X9JA 2LCEA 5KL3A 2EPAA 4IS1C 3EPLA 2EN3A 2EOZA 1A1KA 1KJKA 5KL2A 1F2IG 2EM9A 2YRHA 2YSOA 2EN8A 1B69A 2EOOA 2YTOA 2EM0A 4F6NA 2EM6A 4R2RA 2EOYA 2EP3A 2YU8A 3VHTB 2ENHA 1ZAAC 2EOQA 4M9VC 2EN1A 4R2CA 2EMHA 1A1HA 1TF6A 2EQ1A 2R1FA 2DMIA 2EL6A 2EOXA 2HGHA 1WJPA 1A1FA 2D9HA 4IJDA 4R2AA 2EN4A 2YTJA 2EMBA 1LLMC 3EPJA 2EMLA 2WBSA 1UBDC 4R2SA 2EORA 2EMZA 2RPCA 1MEYC 2EOJA 1Z1BA 1A1LA 2EN6A 2YU5A 2YTGA 1YUJA 2EL4A 2EMWA 2LO3A
chains in the Genus database with same CATH superfamily
1X47A 3IWBA 2EQ3A 2EPMX 3C4TA 4ZYEA 1X48A 2LVHA 3T1HE 2YT4A 1J5EE 1T4NA 5CFFE 4P7DA 3THOB 2RTXA 2A25A 3F6GA 5BR8E 2L33A 2V86A 4F6MA 2LJHA 1GZ6A 2JOXA 1N32E 4O4KA 1TN9A 2LUPB 2EZ6A 2EQ0A 3DJWA 5KL4A 2EMXA 5AC5A 4B3RE 4GKKE 1IQSA 1RC7A 1UILA 2CPNA 2EOEA 2BBGA 2EWLA 2B3TB 4FK5C 1T39A 2F4VE 2KHXA 2GHFA 2YTEA 4Q28A 4TUGA 3P1XA 2N8XA 1BBGA 4BBYA 3BIDA 1EH6A 4GZNC 2B9DA 2EM5A 3KZZA 3QG5C 4DUYE 4LF8E 5A6BD 1RMDA 2YTIA 2EMYA 2YTNA 2CTDA 1IQOA 2EM2A 2N3GA 2UUCE 2EMFA 2H36X 2HHHE 2E1MA 5T6JA 2FTXB 3EPHA 4DV7E 2DSYA 3ADJA 4WYQB 2YRMA 5AE3A 4ZYDA 4O43A 2GPIA 1YPNA 3L00A 4LF6E 3VYXA 4AQYE 2JXPA 4DV0E 4DR1E 4NXME 3EPLA 2EN3A 1HNXE 1EKZA 2YRHA 5A2QC 1N36E 4F54A 2ENHA 1N34E 2YPNA 2EOQA 1FJGE 2EN1A 4R2CA 1T4LB 2EMHA 1A1HA 2IHR1 2UXBE 2MDRA 2R1FA 2ODRD 2DMIA 2EL6A 3H09A 1X49A 4JI7E 2LUQA 2V89A 3AV0A 2RSMA 4IJDA 4X66E 1KYQA 3ZOQB 4X65E 2NUEA 1FKAE 4HTGA 1UBDC 3J80C 2YU5A 5AE2A 2LJUA 1XNQE 2L92A 1YZ9A 1HNWE 2B7VA 2WBUA 4JI8E 4TUIA 4R2EA 2UU9E 5LMUE 2UXCE 1NEIA 3MHHC 2EOSA 1X5WA 1XNRE 2G7HA 4R2QA 4MLQA 2I9IA 3KWRA 2YTFA 4YHHE 2EM7A 5A6KA 5IT9C 2EMCA 2UUAE 1WHNA 2EMKA 2HJJA 1QNTA 2DIXA 2ENAA 5A6BA 1SR9A 1X6EA 2E72A 4B3SE 3JTZA 1AH5A 2NABA 4DR3E 2L6MA 2V87A 2UUBE 2FGGA 2LMZA 5A6JA 4KZSA 1DQ3A 4O5GA 3HXLA 1JK2A 2M9AA 4GKJE 1IMUA 4L8NA 4DUZE 4X64E 4Q35B 4WFTA 2L3CA 2B7TA 1WXRA 1RQ0A 2MDGA 4DV5E 1P47A 2EPZA 2EMAA 3EPKA 2VE7C 4M2ZA 1T4OA 5A6AA 1A1GA 1ZBTA 1A1IA 2EPNA 1IBME 2LTRA 1YSAC 3JU0A 1ZR9A 3LMLA 4WPYA 4R2PA 3M99B 4R2DA 2VQEE 4GEQB 5IV8B 1YUIA 2V88A 2EOHA 3VYYA 4O24A 1NCSA 2EOIA 1G2FC 2ELZA 5TSEA 1A1JA 2EOMA 2EPXA 4NXNE 1G2DC 3LLHA 2PRTA 2VRDA 2ENCA 4LFBE 4F9BB 2EOZA 4JI3E 1F2IG 1I94E 2NUGA 1B69A 4WXDA 5FLXC 4F6NA 3ADIA 2YU8A 1GQEA 1ZAAC 4M9VC 2WZOA 2JWOA 3C6KA 2M1SA 1DI2A 3AUZA 2HGHA 2NA2A 4F9CB 4JI5E 1N3GA 2EMBA 1LLMC 2WBSA 2EORA 2EMZA 4R03A 3TQMA 1MEYC 2V8QB 2DB2A 2EN6A 4B3ME 2K4VA 2YTGA 1IBKE 2EMWA 2LO3A 2R76A 3VK6A 1X3CA 3MSWA 3BBGA 3J7Yp 1DGCA 2EPPA 4DV2E 2LV2A 5AASA 4I8OA 2YSPA 1STUA 2NUFA 2EMGA 5AC4A 3ADLA 4DR2E 2JPAA 1PDAA 4BHBA 3IWDA 4B3TE 4MLVA 1YYWA 2EMIA 2CSHA 3DF6A 2L3JA 2MC6A 4F2JC 4LF7E 2UXDE 1BBOA 1HR0E 2EPCA 3ECRA 2DLQA 4JV5E 4ZYHA 3UK3C 4OOGC 2M7QA 1O0WA 1JK1A 1UN6B 2J7JA 1EH8A 2DLKA 1T38A 4JYAE 3FIGA 1AAYA 1GTKA 1ZBQA 2LT7A 1BB8A 1IBLE 4YY3E 4DV3E 2EPLX 5A69A 2L2NA 2JY9A 1ZU1A 2HC5A 2EN2A 4DV4E 4NZVA 1YYOA 2EM8A 2MKDA 4P78A 2YTQA 2JVAA 2JP9A 2YTDA 2YTPA 2EPOA 5IWAE 2EN7A 2YWQA 3C6MA 1PJSA 4J8ZA 2I13A 4X9JA 4X8WA 5KL3A 3RMPA 2F8BA 2V85A 1KJKA 2RS6A 5KL2A 4BMJA 3OTOE 4LF5E 2YSOA 1PKPA 3HPZA 4DMIA 3HPSA 2EM0A 2EOYA 4KWYA 3IWCA 4LFCE 4N4RB 2L2MA 1N33E 1TF6A 4KHPE 2EQ1A 1WRJA 4DV6E 1HNZE 1WJPA 4K0KE 2D9HA 2LRSA 2YTJA 4JI1E 2ODRC 3J81C 4LFAE 4NHRA 2Q8UA 4R2SA 2RS7A 5LLQA 2EOJA 1Z1BA 4JI2E 4LF4E 1XMOE 4WXCA 2EPKX 3ADGA 4DKKA 1TF3A 2EPRA 2DGCA 2ELYA 2EE8A 2RSIA 3OMLA 4F9AB 2WBTA 2EOFA 2JOBA 2LTSA 5KL6A 2KOUA 2EPUA 2L2KB 3J7AG 4DR6E 4BCAA 3MHSC 5KL5A 2M4IA 1XMQE 4JI6E 2CT1A 5F3WA 2EM3A 1WHQA 4LTYA 2L8TA 2V83A 2ADRA 5IXMB 3THNA 1YFHA 1SFEA 2BB8A 2GLIA 2DMYA 5KL7A 5DNYA 1X6HA 2LBSB 4LU9A 2EM4A 2JR1A 2FV4B 2MKNA 4BHCA 4WSGA 4R8OA 1QU6A 2WCC3 4DV1E 2DRPA 2VQFE 4RHBB 4DR4E 2RQLA 2ZM6E 4RH8A 4ZYGA 3EQ1A 2EL5A 4OX9E 3K6QA 3HTXA 2E5LE 2YRKA 1EH7A 1PJTA 1X6FA 5ADZA 4HEIA 2EJ4A 1YYKA 4JI4E 4WX9A 2LCEA 4BC9A 2EPAA 4IS1C 1A1KA 5AE1A 2JYAA 3BF2A 2EM9A 4M0VA 3KZYA 5LL6R 3JAMC 2EN8A 4DR7E 4DR5E 2EOOA 2YTOA 1MGTA 2EM6A 4M30A 3F6HA 2EP3A 4R2RA 3VHTB 4LF9E 4X62E 5LMNE 2LE2A 1L4SA 3BGHA 4L5NC 2YZTA 2VF1A 2KONA 2EOXA 2MC5A 1UHZA 3C4BA 1A1FA 4BC7A 2N3HA 3T1YE 4R2AA 2EN4A 4WSPA 3EPJA 2EMLA 3HQ1A 1PJQA 2RPCA 4JI0E 2K7IA 1J26A 1A1LA 1YUJA 2EL4A 4BS9A
chains in the Genus database with same CATH topology
2EQ3A 2WBUA 1X3CA 1DGCA 4R2EA 3MHHC 2EPRA 1TF3A 2EPPA 2LVHA 2EOSA 1X5WA 2DGCA 2ELYA 2LV2A 2EE8A 2RSIA 2YSPA 4R2QA 2WBTA 2YTFA 2EM7A 2EOFA 2EMCA 5KL6A 2EMGA 2A25A 2EMKA 2ENAA 2EPUA 2JPAA 4F6MA 1X6EA 2E72A 2NABA 3MHSC 5KL5A 2CT1A 2EMIA 2EM3A 1TN9A 2CSHA 2EQ0A 5KL4A 2EMXA 1JK2A 2ADRA 2M9AA 2BB8A 4F2JC 2GLIA 5KL7A 1X6HA 2EOEA 2EM4A 1BBOA 2EPCA 2DLQA 4FK5C 2GHFA 2MDGA 2YTEA 3UK3C 1P47A 2EPZA 2MKNA 2EMAA 1UN6B 1JK1A 3EPKA 2J7JA 2DLKA 4WSGA 1A1GA 1AAYA 2WCC3 4GZNC 1A1IA 2EM5A 2DRPA 2LT7A 1YSAC 1BB8A 1ZR9A 1RMDA 4R2PA 2YTIA 2EMYA 2CTDA 2YTNA 1ZU1A 2EM2A 3M99B 4R2DA 2EN2A 2EL5A 1YUIA 2YRKA 2EM8A 2MKDA 2EMFA 2EOHA 2YTQA 2JP9A 1NCSA 2EOIA 2YTDA 2ELZA 2YTPA 1G2FC 1X6FA 3EPHA 2EN7A 1A1JA 2EOMA 2EPXA 2EJ4A 1G2DC 2YRMA 2PRTA 2I13A 2VRDA 2ENCA 4X9JA 2LCEA 5KL3A 2EPAA 4IS1C 3EPLA 2EN3A 2EOZA 1A1KA 1KJKA 5KL2A 1F2IG 2EM9A 2YRHA 2YSOA 2EN8A 1B69A 2EOOA 2YTOA 2EM0A 4F6NA 2EM6A 4R2RA 2EOYA 2EP3A 2YU8A 3VHTB 2ENHA 1ZAAC 2EOQA 4M9VC 2EN1A 4R2CA 2EMHA 1A1HA 1TF6A 2EQ1A 2R1FA 2DMIA 2EL6A 2EOXA 2HGHA 1WJPA 1A1FA 2D9HA 4IJDA 4R2AA 2EN4A 2YTJA 2EMBA 1LLMC 3EPJA 2EMLA 2WBSA 1UBDC 4R2SA 2EORA 2EMZA 2RPCA 1MEYC 2EOJA 1Z1BA 1A1LA 2EN6A 2YU5A 2YTGA 1YUJA 2EL4A 2EMWA 2LO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ3 A;  2WBU A;  1X3C A;  1DGC A;  4R2E A;  3MHH C;  2EPR A;  1TF3 A;  2EPP A;  2LVH A;  2EOS A;  1X5W A;  2DGC A;  2ELY A;  2LV2 A;  2EE8 A;  2RSI A;  2YSP A;  4R2Q A;  2WBT A;  2YTF A;  2EM7 A;  2EOF A;  2EMC A;  5KL6 A;  2EMG A;  2A25 A;  2EMK A;  2ENA A;  2EPU A;  2JPA A;  4F6M A;  1X6E A;  2E72 A;  2NAB A;  3MHS C;  5KL5 A;  2CT1 A;  2EMI A;  2EM3 A;  1TN9 A;  2CSH A;  2EQ0 A;  5KL4 A;  2EMX A;  1JK2 A;  2ADR A;  2M9A A;  2BB8 A;  4F2J C;  2GLI A;  5KL7 A;  1X6H A;  2EOE A;  2EM4 A;  1BBO A;  2EPC A;  2DLQ A;  4FK5 C;  2GHF A;  2MDG A;  2YTE A;  3UK3 C;  1P47 A;  2EPZ A;  2MKN A;  2EMA A;  1UN6 B;  1JK1 A;  3EPK A;  2J7J A;  2DLK A;  4WSG A;  1A1G A;  1AAY A;  2WCC 3;  4GZN C;  1A1I A;  2EM5 A;  2DRP A;  2LT7 A;  1YSA C;  1BB8 A;  1ZR9 A;  1RMD A;  4R2P A;  2YTI A;  2EMY A;  2CTD A;  2YTN A;  1ZU1 A;  2EM2 A;  3M99 B;  4R2D A;  2EN2 A;  2EL5 A;  1YUI A;  2YRK A;  2EM8 A;  2MKD A;  2EMF A;  2EOH A;  2YTQ A;  2JP9 A;  1NCS A;  2EOI A;  2YTD A;  2ELZ A;  2YTP A;  1G2F C;  1X6F A;  3EPH A;  2EN7 A;  1A1J A;  2EOM A;  2EPX A;  2EJ4 A;  1G2D C;  2YRM A;  2PRT A;  2I13 A;  2VRD A;  2ENC A;  4X9J A;  2LCE A;  5KL3 A;  2EPA A;  4IS1 C;  3EPL A;  2EN3 A;  2EOZ A;  1A1K A;  1KJK A;  5KL2 A;  1F2I G;  2EM9 A;  2YRH A;  2YSO A;  2EN8 A;  1B69 A;  2EOO A;  2YTO A;  2EM0 A;  4F6N A;  2EM6 A;  4R2R A;  2EOY A;  2EP3 A;  2YU8 A;  3VHT B;  2ENH A;  1ZAA C;  2EOQ A;  4M9V C;  2EN1 A;  4R2C A;  2EMH A;  1A1H A;  1TF6 A;  2EQ1 A;  2R1F A;  2DMI A;  2EL6 A;  2EOX A;  2HGH A;  1WJP A;  1A1F A;  2D9H A;  4IJD A;  4R2A A;  2EN4 A;  2YTJ A;  2EMB A;  1LLM C;  3EPJ A;  2EML A;  2WBS A;  1UBD C;  4R2S A;  2EOR A;  2EMZ A;  2RPC A;  1MEY C;  2EOJ A;  1Z1B A;  1A1L A;  2EN6 A;  2YU5 A;  2YTG A;  1YUJ A;  2EL4 A;  2EMW A;  2LO3 A; 
#chains in the Genus database with same CATH topology
 1X47 A;  3IWB A;  2EQ3 A;  2EPM X;  3C4T A;  4ZYE A;  1X48 A;  2LVH A;  3T1H E;  2YT4 A;  1J5E E;  1T4N A;  5CFF E;  4P7D A;  3THO B;  2RTX A;  2A25 A;  3F6G A;  5BR8 E;  2L33 A;  2V86 A;  4F6M A;  2LJH A;  1GZ6 A;  2JOX A;  1N32 E;  4O4K A;  1TN9 A;  2LUP B;  2EZ6 A;  2EQ0 A;  3DJW A;  5KL4 A;  2EMX A;  5AC5 A;  4B3R E;  4GKK E;  1IQS A;  1RC7 A;  1UIL A;  2CPN A;  2EOE A;  2BBG A;  2EWL A;  2B3T B;  4FK5 C;  1T39 A;  2F4V E;  2KHX A;  2GHF A;  2YTE A;  4Q28 A;  4TUG A;  3P1X A;  2N8X A;  1BBG A;  4BBY A;  3BID A;  1EH6 A;  4GZN C;  2B9D A;  2EM5 A;  3KZZ A;  3QG5 C;  4DUY E;  4LF8 E;  5A6B D;  1RMD A;  2YTI A;  2EMY A;  2YTN A;  2CTD A;  1IQO A;  2EM2 A;  2N3G A;  2UUC E;  2EMF A;  2H36 X;  2HHH E;  2E1M A;  5T6J A;  2FTX B;  3EPH A;  4DV7 E;  2DSY A;  3ADJ A;  4WYQ B;  2YRM A;  5AE3 A;  4ZYD A;  4O43 A;  2GPI A;  1YPN A;  3L00 A;  4LF6 E;  3VYX A;  4AQY E;  2JXP A;  4DV0 E;  4DR1 E;  4NXM E;  3EPL A;  2EN3 A;  1HNX E;  1EKZ A;  2YRH A;  5A2Q C;  1N36 E;  4F54 A;  2ENH A;  1N34 E;  2YPN A;  2EOQ A;  1FJG E;  2EN1 A;  4R2C A;  1T4L B;  2EMH A;  1A1H A;  2IHR 1;  2UXB E;  2MDR A;  2R1F A;  2ODR D;  2DMI A;  2EL6 A;  3H09 A;  1X49 A;  4JI7 E;  2LUQ A;  2V89 A;  3AV0 A;  2RSM A;  4IJD A;  4X66 E;  1KYQ A;  3ZOQ B;  4X65 E;  2NUE A;  1FKA E;  4HTG A;  1UBD C;  3J80 C;  2YU5 A;  5AE2 A;  2LJU A;  1XNQ E;  2L92 A;  1YZ9 A;  1HNW E;  2B7V A;  2WBU A;  4JI8 E;  4TUI A;  4R2E A;  2UU9 E;  5LMU E;  2UXC E;  1NEI A;  3MHH C;  2EOS A;  1X5W A;  1XNR E;  2G7H A;  4R2Q A;  4MLQ A;  2I9I A;  3KWR A;  2YTF A;  4YHH E;  2EM7 A;  5A6K A;  5IT9 C;  2EMC A;  2UUA E;  1WHN A;  2EMK A;  2HJJ A;  1QNT A;  2DIX A;  2ENA A;  5A6B A;  1SR9 A;  1X6E A;  2E72 A;  4B3S E;  3JTZ A;  1AH5 A;  2NAB A;  4DR3 E;  2L6M A;  2V87 A;  2UUB E;  2FGG A;  2LMZ A;  5A6J A;  4KZS A;  1DQ3 A;  4O5G A;  3HXL A;  1JK2 A;  2M9A A;  4GKJ E;  1IMU A;  4L8N A;  4DUZ E;  4X64 E;  4Q35 B;  4WFT A;  2L3C A;  2B7T A;  1WXR A;  1RQ0 A;  2MDG A;  4DV5 E;  1P47 A;  2EPZ A;  2EMA A;  3EPK A;  2VE7 C;  4M2Z A;  1T4O A;  5A6A A;  1A1G A;  1ZBT A;  1A1I A;  2EPN A;  1IBM E;  2LTR A;  1YSA C;  3JU0 A;  1ZR9 A;  3LML A;  4WPY A;  4R2P A;  3M99 B;  4R2D A;  2VQE E;  4GEQ B;  5IV8 B;  1YUI A;  2V88 A;  2EOH A;  3VYY A;  4O24 A;  1NCS A;  2EOI A;  1G2F C;  2ELZ A;  5TSE A;  1A1J A;  2EOM A;  2EPX A;  4NXN E;  1G2D C;  3LLH A;  2PRT A;  2VRD A;  2ENC A;  4LFB E;  4F9B B;  2EOZ A;  4JI3 E;  1F2I G;  1I94 E;  2NUG A;  1B69 A;  4WXD A;  5FLX C;  4F6N A;  3ADI A;  2YU8 A;  1GQE A;  1ZAA C;  4M9V C;  2WZO A;  2JWO A;  3C6K A;  2M1S A;  1DI2 A;  3AUZ A;  2HGH A;  2NA2 A;  4F9C B;  4JI5 E;  1N3G A;  2EMB A;  1LLM C;  2WBS A;  2EOR A;  2EMZ A;  4R03 A;  3TQM A;  1MEY C;  2V8Q B;  2DB2 A;  2EN6 A;  4B3M E;  2K4V A;  2YTG A;  1IBK E;  2EMW A;  2LO3 A;  2R76 A;  3VK6 A;  1X3C A;  3MSW A;  3BBG A;  3J7Y p;  1DGC A;  2EPP A;  4DV2 E;  2LV2 A;  5AAS A;  4I8O A;  2YSP A;  1STU A;  2NUF A;  2EMG A;  5AC4 A;  3ADL A;  4DR2 E;  2JPA A;  1PDA A;  4BHB A;  3IWD A;  4B3T E;  4MLV A;  1YYW A;  2EMI A;  2CSH A;  3DF6 A;  2L3J A;  2MC6 A;  4F2J C;  4LF7 E;  2UXD E;  1BBO A;  1HR0 E;  2EPC A;  3ECR A;  2DLQ A;  4JV5 E;  4ZYH A;  3UK3 C;  4OOG C;  2M7Q A;  1O0W A;  1JK1 A;  1UN6 B;  2J7J A;  1EH8 A;  2DLK A;  1T38 A;  4JYA E;  3FIG A;  1AAY A;  1GTK A;  1ZBQ A;  2LT7 A;  1BB8 A;  1IBL E;  4YY3 E;  4DV3 E;  2EPL X;  5A69 A;  2L2N A;  2JY9 A;  1ZU1 A;  2HC5 A;  2EN2 A;  4DV4 E;  4NZV A;  1YYO A;  2EM8 A;  2MKD A;  4P78 A;  2YTQ A;  2JVA A;  2JP9 A;  2YTD A;  2YTP A;  2EPO A;  5IWA E;  2EN7 A;  2YWQ A;  3C6M A;  1PJS A;  4J8Z A;  2I13 A;  4X9J A;  4X8W A;  5KL3 A;  3RMP A;  2F8B A;  2V85 A;  1KJK A;  2RS6 A;  5KL2 A;  4BMJ A;  3OTO E;  4LF5 E;  2YSO A;  1PKP A;  3HPZ A;  4DMI A;  3HPS A;  2EM0 A;  2EOY A;  4KWY A;  3IWC A;  4LFC E;  4N4R B;  2L2M A;  1N33 E;  1TF6 A;  4KHP E;  2EQ1 A;  1WRJ A;  4DV6 E;  1HNZ E;  1WJP A;  4K0K E;  2D9H A;  2LRS A;  2YTJ A;  4JI1 E;  2ODR C;  3J81 C;  4LFA E;  4NHR A;  2Q8U A;  4R2S A;  2RS7 A;  5LLQ A;  2EOJ A;  1Z1B A;  4JI2 E;  4LF4 E;  1XMO E;  4WXC A;  2EPK X;  3ADG A;  4DKK A;  1TF3 A;  2EPR A;  2DGC A;  2ELY A;  2EE8 A;  2RSI A;  3OML A;  4F9A B;  2WBT A;  2EOF A;  2JOB A;  2LTS A;  5KL6 A;  2KOU A;  2EPU A;  2L2K B;  3J7A G;  4DR6 E;  4BCA A;  3MHS C;  5KL5 A;  2M4I A;  1XMQ E;  4JI6 E;  2CT1 A;  5F3W A;  2EM3 A;  1WHQ A;  4LTY A;  2L8T A;  2V83 A;  2ADR A;  5IXM B;  3THN A;  1YFH A;  1SFE A;  2BB8 A;  2GLI A;  2DMY A;  5KL7 A;  5DNY A;  1X6H A;  2LBS B;  4LU9 A;  2EM4 A;  2JR1 A;  2FV4 B;  2MKN A;  4BHC A;  4WSG A;  4R8O A;  1QU6 A;  2WCC 3;  4DV1 E;  2DRP A;  2VQF E;  4RHB B;  4DR4 E;  2RQL A;  2ZM6 E;  4RH8 A;  4ZYG A;  3EQ1 A;  2EL5 A;  4OX9 E;  3K6Q A;  3HTX A;  2E5L E;  2YRK A;  1EH7 A;  1PJT A;  1X6F A;  5ADZ A;  4HEI A;  2EJ4 A;  1YYK A;  4JI4 E;  4WX9 A;  2LCE A;  4BC9 A;  2EPA A;  4IS1 C;  1A1K A;  5AE1 A;  2JYA A;  3BF2 A;  2EM9 A;  4M0V A;  3KZY A;  5LL6 R;  3JAM C;  2EN8 A;  4DR7 E;  4DR5 E;  2EOO A;  2YTO A;  1MGT A;  2EM6 A;  4M30 A;  3F6H A;  2EP3 A;  4R2R A;  3VHT B;  4LF9 E;  4X62 E;  5LMN E;  2LE2 A;  1L4S A;  3BGH A;  4L5N C;  2YZT A;  2VF1 A;  2KON A;  2EOX A;  2MC5 A;  1UHZ A;  3C4B A;  1A1F A;  4BC7 A;  2N3H A;  3T1Y E;  4R2A A;  2EN4 A;  4WSP A;  3EPJ A;  2EML A;  3HQ1 A;  1PJQ A;  2RPC A;  4JI0 E;  2K7I A;  1J26 A;  1A1L A;  1YUJ A;  2EL4 A;  4BS9 A; 
#chains in the Genus database with same CATH homology
 2EQ3 A;  2WBU A;  1X3C A;  1DGC A;  4R2E A;  3MHH C;  2EPR A;  1TF3 A;  2EPP A;  2LVH A;  2EOS A;  1X5W A;  2DGC A;  2ELY A;  2LV2 A;  2EE8 A;  2RSI A;  2YSP A;  4R2Q A;  2WBT A;  2YTF A;  2EM7 A;  2EOF A;  2EMC A;  5KL6 A;  2EMG A;  2A25 A;  2EMK A;  2ENA A;  2EPU A;  2JPA A;  4F6M A;  1X6E A;  2E72 A;  2NAB A;  3MHS C;  5KL5 A;  2CT1 A;  2EMI A;  2EM3 A;  1TN9 A;  2CSH A;  2EQ0 A;  5KL4 A;  2EMX A;  1JK2 A;  2ADR A;  2M9A A;  2BB8 A;  4F2J C;  2GLI A;  5KL7 A;  1X6H A;  2EOE A;  2EM4 A;  1BBO A;  2EPC A;  2DLQ A;  4FK5 C;  2GHF A;  2MDG A;  2YTE A;  3UK3 C;  1P47 A;  2EPZ A;  2MKN A;  2EMA A;  1UN6 B;  1JK1 A;  3EPK A;  2J7J A;  2DLK A;  4WSG A;  1A1G A;  1AAY A;  2WCC 3;  4GZN C;  1A1I A;  2EM5 A;  2DRP A;  2LT7 A;  1YSA C;  1BB8 A;  1ZR9 A;  1RMD A;  4R2P A;  2YTI A;  2EMY A;  2CTD A;  2YTN A;  1ZU1 A;  2EM2 A;  3M99 B;  4R2D A;  2EN2 A;  2EL5 A;  1YUI A;  2YRK A;  2EM8 A;  2MKD A;  2EMF A;  2EOH A;  2YTQ A;  2JP9 A;  1NCS A;  2EOI A;  2YTD A;  2ELZ A;  2YTP A;  1G2F C;  1X6F A;  3EPH A;  2EN7 A;  1A1J A;  2EOM A;  2EPX A;  2EJ4 A;  1G2D C;  2YRM A;  2PRT A;  2I13 A;  2VRD A;  2ENC A;  4X9J A;  2LCE A;  5KL3 A;  2EPA A;  4IS1 C;  3EPL A;  2EN3 A;  2EOZ A;  1A1K A;  1KJK A;  5KL2 A;  1F2I G;  2EM9 A;  2YRH A;  2YSO A;  2EN8 A;  1B69 A;  2EOO A;  2YTO A;  2EM0 A;  4F6N A;  2EM6 A;  4R2R A;  2EOY A;  2EP3 A;  2YU8 A;  3VHT B;  2ENH A;  1ZAA C;  2EOQ A;  4M9V C;  2EN1 A;  4R2C A;  2EMH A;  1A1H A;  1TF6 A;  2EQ1 A;  2R1F A;  2DMI A;  2EL6 A;  2EOX A;  2HGH A;  1WJP A;  1A1F A;  2D9H A;  4IJD A;  4R2A A;  2EN4 A;  2YTJ A;  2EMB A;  1LLM C;  3EPJ A;  2EML A;  2WBS A;  1UBD C;  4R2S A;  2EOR A;  2EMZ A;  2RPC A;  1MEY C;  2EOJ A;  1Z1B A;  1A1L A;  2EN6 A;  2YU5 A;  2YTG A;  1YUJ A;  2EL4 A;  2EMW A;  2LO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...