2LE2A

Novel dimeric structure of phage phi29-encoded protein p56: insights into uracil-dna glycosylase inhibition
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
MVQNDFVDSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords P56
publication title Novel dimeric structure of phage 29-encoded protein p56: insights into uracil-DNA glycosylase inhibition.
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 8
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2le2A00
3ZOQB 2LE2A 4L5NC
chains in the Genus database with same CATH superfamily
3ECRA 3KWRA 2DB2A 1X6FA 3AUZA 4NXNE 2LO3A 1NCSA 2MKDA 2EOEA 1F2IG 4WPYA 4WSPA 1KJKA 1RQ0A 2UUBE 2GPIA 3VHTB 5AE3A 4JI8E 5BR8E 2Q8UA 2EMIA 4LF7E 2IHR1 1RC7A 2JYAA 2ZM6E 2YTFA 2I9IA 2F8BA 4F2JC 2EPAA 3EPJA 3EPLA 4GKJE 4I8OA 3BBGA 3LLHA 4DV6E 2KONA 3K6QA 4L8NA 2ELZA 2RS6A 3JAMC 4GEQB 5KL2A 4DUZE 2M1SA 2LMZA 1MEYC 2JR1A 2B9DA 3ZOQB 1SR9A 2ELYA 3DJWA 2EN8A 2MDGA 2FV4B 1T4NA 4BMJA 2V89A 4R2DA 2JY9A 2EMFA 4NHRA 4P78A 4R2PA 2CT1A 3JTZA 1BBOA 4OOGC 2E72A 2EPZA 4NZVA 1X49A 4R2SA 3BGHA 4B3RE 4DR6E 2YWQA 3KZYA 3BIDA 2LTSA 2EL6A 4WXDA 1STUA 4B3TE 2UXDE 2EMLA 3OMLA 1A1HA 1A1JA 2M4IA 4OX9E 2M7QA 1XNQE 3RMPA 1RMDA 2EN1A 4HEIA 2V86A 3OTOE 2EMWA 4JI2E 3ADIA 2LUPB 2WZOA 2ENCA 3HPZA 4JI7E 1MGTA 4F9BB 4X65E 1FKAE 2EOOA 2L2NA 2N3HA 4BHBA 1QNTA 3JU0A 1IBME 2EMHA 1BBGA 1J26A 2EQ0A 4JV5E 1JK2A 2E1MA 2EL5A 2L3JA 1T38A 1YFHA 4M0VA 2ADRA 2DLQA 4IS1C 1FJGE 2LUQA 4BC9A 4Q35B 1IQOA 2YTIA 4DR5E 3HQ1A 5A69A 4RH8A 2EP3A 2WBUA 4RHBB 4AQYE 2DLKA 1LLMC 3ADJA 1WRJA 2G7HA 4WSGA 2B7TA 2ODRD 1YSAC 4ZYHA 5AE2A 2EOQA 2EPNA 1SFEA 5A6BA 1PJTA 2EPUA 4LFBE 1PDAA 3J81C 4LFCE 2MKNA 1L4SA 4F54A 1A1KA 2J7JA 1PJSA 1XMOE 4LTYA 2DSYA 3J7Yp 2R76A 2V88A 4LFAE 4JI5E 2K7IA 2EL4A 2EOIA 3LMLA 3TQMA 4KWYA 3P1XA 1IBKE 3QG5C 1T4OA 3C4TA 4M9VC 4JI3E 1X47A 1ZAAC 1NEIA 2V8QB 2EPCA 4WFTA 1ZBTA 2GLIA 1BB8A 4DV2E 2JPAA 1EH7A 1XNRE 4TUIA 1G2FC 3HPSA 2VF1A 4DV1E 2KHXA 2NUEA 4DV5E 2V87A 2L2MA 3C6MA 2EJ4A 4WYQB 4DR3E 4KHPE 1TN9A 2DMIA 3IWDA 2YRHA 4JI4E 1EH6A 4K0KE 1YPNA 2JOXA 1ZU1A 2EPPA 2FTXB 4R03A 2L2KB 2JP9A 2CPNA 1N34E 2EMBA 4Q28A 2CTDA 4ZYGA 2EM8A 2L33A 2JWOA 3VYYA 2YTPA 2EQ3A 2EPXA 2EOXA 2YZTA 1EH8A 1QU6A 5A2QC 2RQLA 5IXMB 3EQ1A 4P7DA 4B3ME 4DR4E 1N3GA 2EMAA 4BBYA 1ZBQA 5A6AA 2NABA 4DV3E 4FK5C 4X64E 2DGCA 2EPMX 4NXME 2D9HA 1AH5A 5TSEA 2L92A 1ZR9A 2LV2A 1T39A 2V83A 4LF4E 4DV0E 5LMNE 2RPCA 4JI0E 2YTJA 4R8OA 1A1IA 5AC4A 1X3CA 2WBTA 2EPOA 2EMCA 2UXCE 1YUJA 3IWCA 4DR7E 5A6BD 2M9AA 2EMXA 1IBLE 5LMUE 2EMKA 4R2RA 2EOSA 5CFFE 2YT4A 3AV0A 1UILA 2EPRA 3T1YE 4WX9A 2EM2A 2LRSA 2LBSB 2LTRA 5T6JA 4BS9A 2N8XA 5F3WA 2JXPA 5LLQA 1P47A 4MLQA 2F4VE 4JYAE 4TUGA 2EN2A 1UBDC 3H09A 1XMQE 5IWAE 4HTGA 2YTQA 2ODRC 3C6KA 1IQSA 3BF2A 4IJDA 1UHZA 2EN7A 3VYXA 2DMYA 2B3TB 1WHQA 1GQEA 4DMIA 5DNYA 2EN3A 1HR0E 4M2ZA 2YSOA 2RSIA 2RSMA 3HTXA 3THOB 1G2DC 2EM5A 4LF6E 2UUCE 2LVHA 4L5NC 1YUIA 2YTOA 2BB8A 4O24A 2H36X 2B7VA 3L00A 3FIGA 4DR2E 2EM6A 1JK1A 1IMUA 5AE1A 2YRKA 2EPLX 3IWBA 4J8ZA 1YYOA 2L8TA 4O4KA 1AAYA 4LU9A 4F6NA 4DUYE 4O5GA 1J5EE 1DI2A 2EM4A 5KL7A 5KL5A 1O0WA 1GTKA 1DGCA 2LJHA 5AC5A 3KZZA 3F6HA 1I94E 5KL4A 2DRPA 5KL6A 2RTXA 3ADLA 1A1GA 2L6MA 2I13A 4WXCA 4X9JA 3THNA 2EPKX 2CSHA 2RS7A 4ZYDA 2LE2A 3MHHC 2R1FA 2E5LE 4MLVA 4BHCA 5AASA 4YY3E 1N33E 1Z1BA 4BCAA 2UUAE 2NA2A 2EQ1A 2MC6A 2EM9A 2EM0A 2KOUA 2EM7A 4JI1E 4R2EA 2VQEE 3UK3C 4GKKE 5IT9C 2LJUA 2LCEA 4LF5E 2EOZA 2NUGA 2HC5A 2EOMA 2V85A 4GZNC 4LF8E 3HXLA 2GHFA 3ADGA 2WBSA 1B69A 2HGHA 2N3GA 2DIXA 2LT7A 2EOFA 5FLXC 3F6GA 2FGGA 3J80C 2YTNA 2MDRA 2YPNA 4R2CA 2NUFA 3EPHA 2JVAA 2K4VA 3J7AG 4ZYEA 2EOJA 2WCC3 2YTDA 1A1LA 1YYWA 1DQ3A 1X48A 2EWLA 2MC5A 2BBGA 2VE7C 3M99B 2ENHA 4DV4E 2EN6A 1YZ9A 2YU8A 3VK6A 3MSWA 4R2AA 1T4LB 3EPKA 5LL6R 4N4RB 2VRDA 1UN6B 1YYKA 5IV8B 3T1HE 4DKKA 1TF6A 4F9CB 4X8WA 1KYQA 1X6HA 2YSPA 3DF6A 2EZ6A 1WHNA 1HNWE 2UU9E 2YTEA 1PJQA 4M30A 2HHHE 2EMZA 3C4BA 4DV7E 4BC7A 1HNXE 1X6EA 2VQFE 2PRTA 4KZSA 2HJJA 4X66E 2UXBE 3MHSC 2EMYA 2EOYA 1WXRA 2EOHA 5KL3A 1EKZA 5A6JA 1WJPA 2EE8A 2EMGA 4YHHE 1PKPA 4O43A 4B3SE 1X5WA 1GZ6A 5A6KA 1N36E 2ENAA 4DR1E 2JOBA 2YU5A 4F9AB 2YTGA 2L3CA 4JI6E 1N32E 4LF9E 2A25A 2EORA 5ADZA 2EN4A 1A1FA 2EM3A 4R2QA 1HNZE 1TF3A 4X62E 4F6MA 2YRMA
chains in the Genus database with same CATH topology
1ZBQA 4DV3E 3KWRA 1FJGE 4X64E 2DB2A 2LUQA 4BCAA 2UUAE 4NXME 2NA2A 3AUZA 4BC9A 4NXNE 2MC6A 2L92A 2KOUA 4DR5E 4JI1E 2V83A 2VQEE 3HQ1A 4GKKE 4WPYA 4DV0E 5IT9C 4LF4E 5LMNE 4WSPA 1RQ0A 4JI0E 2UUBE 4LF5E 4R8OA 5AE3A 4JI8E 2NUGA 5BR8E 4AQYE 2V85A 3ADJA 4LF8E 3HXLA 2UXCE 2G7HA 3IWCA 4LF7E 3ADGA 4DR7E 2IHR1 1RC7A 2ZM6E 1IBLE 2B7TA 2ODRD 2N3GA 5LMUE 2DIXA 2F8BA 5CFFE 5FLXC 5AE2A 3F6GA 2FGGA 4I8OA 3J80C 2YT4A 4GKJE 2MDRA 3AV0A 2NUFA 1UILA 3LLHA 3J81C 4DV6E 2JVAA 2K4VA 2KONA 3T1YE 2LRSA 2LBSB 4LFCE 2LTRA 3K6QA 5T6JA 4BS9A 5F3WA 4L8NA 4F54A 2RS6A 3JAMC 1YYWA 1XMOE 1DQ3A 1X48A 2EWLA 2MC5A 2VE7C 2DSYA 4GEQB 4LTYA 3J7Yp 4DUZE 4TUGA 2V88A 2F4VE 4JYAE 3H09A 4LFBE 4LFAE 4DV4E 1XMQE 2M1SA 4JI5E 5IWAE 2LMZA 2JR1A 2ODRC 1YZ9A 2B9DA 3LMLA 1SR9A 1UHZA 3ZOQB 3VK6A 3DJWA 3MSWA 3VYXA 2DMYA 2B3TB 1WHQA 1T4LB 5LL6R 1GQEA 2FV4B 1T4NA 3P1XA 4BMJA 4DMIA 5DNYA 1IBKE 1YYKA 2V89A 1T4OA 3C4TA 3J7AG 3T1HE 4JI3E 1HR0E 1X47A 2JY9A 4DKKA 4M2ZA 4F9CB 4P78A 4X8WA 2RSMA 3HTXA 2V8QB 3DF6A 3JTZA 2EZ6A 1WHNA 4WFTA 1ZBTA 4OOGC 2UU9E 4DV2E 2UUCE 4M30A 4LF6E 1HNWE 4L5NC 2HHHE 3C4BA 1X49A 2H36X 4DV7E 4B3RE 4DR6E 1XNRE 4TUIA 4BC7A 1HNXE 2B7VA 3HPSA 2VF1A 4KZSA 2VQFE 4DV1E 2KHXA 2LTSA 3FIGA 4X66E 1STUA 4DR2E 4DV5E 4B3TE 2NUEA 2V87A 1WXRA 3OMLA 5AE1A 2L2MA 2UXDE 3IWBA 4J8ZA 4WYQB 2L8TA 1YYOA 1EKZA 4DR3E 2M4IA 4KHPE 4LU9A 4OX9E 4DUYE 4YHHE 1PKPA 2M7QA 1J5EE 3IWDA 1XNQE 4JI4E 1DI2A 4B3SE 3RMPA 1GZ6A 4K0KE 1O0WA 2JOXA 2FTXB 2V86A 4R03A 3OTOE 2L2KB 2LJHA 1N36E 2UXBE 2CPNA 4JI2E 1N34E 3ADIA 4Q28A 4DR1E 2L33A 2JOBA 2LUPB 2WZOA 4F9AB 3HPZA 2JWOA 3F6HA 4JI7E 2L3CA 4F9BB 3VYYA 1I94E 4JI6E 1N32E 4X65E 2RTXA 1FKAE 4LF9E 3ADLA 2YZTA 2L6MA 2L2NA 5ADZA 2N3HA 1HNZE 3JU0A 1IBME 2RS7A 1QU6A 1J26A 5A2QC 4JV5E 4X62E 2LE2A 4P7DA 2E1MA 4B3ME 4DR4E 2L3JA 2E5LE 4BBYA 5AASA 4YY3E 4M0VA 1N33E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOQ B;  2LE2 A;  4L5N C; 
#chains in the Genus database with same CATH topology
 3ECR A;  3KWR A;  2DB2 A;  1X6F A;  3AUZ A;  4NXN E;  2LO3 A;  1NCS A;  2MKD A;  2EOE A;  1F2I G;  4WPY A;  4WSP A;  1KJK A;  1RQ0 A;  2UUB E;  2GPI A;  3VHT B;  5AE3 A;  4JI8 E;  5BR8 E;  2Q8U A;  2EMI A;  4LF7 E;  2IHR 1;  1RC7 A;  2JYA A;  2ZM6 E;  2YTF A;  2I9I A;  2F8B A;  4F2J C;  2EPA A;  3EPJ A;  3EPL A;  4GKJ E;  4I8O A;  3BBG A;  3LLH A;  4DV6 E;  2KON A;  3K6Q A;  4L8N A;  2ELZ A;  2RS6 A;  3JAM C;  4GEQ B;  5KL2 A;  4DUZ E;  2M1S A;  2LMZ A;  1MEY C;  2JR1 A;  2B9D A;  3ZOQ B;  1SR9 A;  2ELY A;  3DJW A;  2EN8 A;  2MDG A;  2FV4 B;  1T4N A;  4BMJ A;  2V89 A;  4R2D A;  2JY9 A;  2EMF A;  4NHR A;  4P78 A;  4R2P A;  2CT1 A;  3JTZ A;  1BBO A;  4OOG C;  2E72 A;  2EPZ A;  4NZV A;  1X49 A;  4R2S A;  3BGH A;  4B3R E;  4DR6 E;  2YWQ A;  3KZY A;  3BID A;  2LTS A;  2EL6 A;  4WXD A;  1STU A;  4B3T E;  2UXD E;  2EML A;  3OML A;  1A1H A;  1A1J A;  2M4I A;  4OX9 E;  2M7Q A;  1XNQ E;  3RMP A;  1RMD A;  2EN1 A;  4HEI A;  2V86 A;  3OTO E;  2EMW A;  4JI2 E;  3ADI A;  2LUP B;  2WZO A;  2ENC A;  3HPZ A;  4JI7 E;  1MGT A;  4F9B B;  4X65 E;  1FKA E;  2EOO A;  2L2N A;  2N3H A;  4BHB A;  1QNT A;  3JU0 A;  1IBM E;  2EMH A;  1BBG A;  1J26 A;  2EQ0 A;  4JV5 E;  1JK2 A;  2E1M A;  2EL5 A;  2L3J A;  1T38 A;  1YFH A;  4M0V A;  2ADR A;  2DLQ A;  4IS1 C;  1FJG E;  2LUQ A;  4BC9 A;  4Q35 B;  1IQO A;  2YTI A;  4DR5 E;  3HQ1 A;  5A69 A;  4RH8 A;  2EP3 A;  2WBU A;  4RHB B;  4AQY E;  2DLK A;  1LLM C;  3ADJ A;  1WRJ A;  2G7H A;  4WSG A;  2B7T A;  2ODR D;  1YSA C;  4ZYH A;  5AE2 A;  2EOQ A;  2EPN A;  1SFE A;  5A6B A;  1PJT A;  2EPU A;  4LFB E;  1PDA A;  3J81 C;  4LFC E;  2MKN A;  1L4S A;  4F54 A;  1A1K A;  2J7J A;  1PJS A;  1XMO E;  4LTY A;  2DSY A;  3J7Y p;  2R76 A;  2V88 A;  4LFA E;  4JI5 E;  2K7I A;  2EL4 A;  2EOI A;  3LML A;  3TQM A;  4KWY A;  3P1X A;  1IBK E;  3QG5 C;  1T4O A;  3C4T A;  4M9V C;  4JI3 E;  1X47 A;  1ZAA C;  1NEI A;  2V8Q B;  2EPC A;  4WFT A;  1ZBT A;  2GLI A;  1BB8 A;  4DV2 E;  2JPA A;  1EH7 A;  1XNR E;  4TUI A;  1G2F C;  3HPS A;  2VF1 A;  4DV1 E;  2KHX A;  2NUE A;  4DV5 E;  2V87 A;  2L2M A;  3C6M A;  2EJ4 A;  4WYQ B;  4DR3 E;  4KHP E;  1TN9 A;  2DMI A;  3IWD A;  2YRH A;  4JI4 E;  1EH6 A;  4K0K E;  1YPN A;  2JOX A;  1ZU1 A;  2EPP A;  2FTX B;  4R03 A;  2L2K B;  2JP9 A;  2CPN A;  1N34 E;  2EMB A;  4Q28 A;  2CTD A;  4ZYG A;  2EM8 A;  2L33 A;  2JWO A;  3VYY A;  2YTP A;  2EQ3 A;  2EPX A;  2EOX A;  2YZT A;  1EH8 A;  1QU6 A;  5A2Q C;  2RQL A;  5IXM B;  3EQ1 A;  4P7D A;  4B3M E;  4DR4 E;  1N3G A;  2EMA A;  4BBY A;  1ZBQ A;  5A6A A;  2NAB A;  4DV3 E;  4FK5 C;  4X64 E;  2DGC A;  2EPM X;  4NXM E;  2D9H A;  1AH5 A;  5TSE A;  2L92 A;  1ZR9 A;  2LV2 A;  1T39 A;  2V83 A;  4LF4 E;  4DV0 E;  5LMN E;  2RPC A;  4JI0 E;  2YTJ A;  4R8O A;  1A1I A;  5AC4 A;  1X3C A;  2WBT A;  2EPO A;  2EMC A;  2UXC E;  1YUJ A;  3IWC A;  4DR7 E;  5A6B D;  2M9A A;  2EMX A;  1IBL E;  5LMU E;  2EMK A;  4R2R A;  2EOS A;  5CFF E;  2YT4 A;  3AV0 A;  1UIL A;  2EPR A;  3T1Y E;  4WX9 A;  2EM2 A;  2LRS A;  2LBS B;  2LTR A;  5T6J A;  4BS9 A;  2N8X A;  5F3W A;  2JXP A;  5LLQ A;  1P47 A;  4MLQ A;  2F4V E;  4JYA E;  4TUG A;  2EN2 A;  1UBD C;  3H09 A;  1XMQ E;  5IWA E;  4HTG A;  2YTQ A;  2ODR C;  3C6K A;  1IQS A;  3BF2 A;  4IJD A;  1UHZ A;  2EN7 A;  3VYX A;  2DMY A;  2B3T B;  1WHQ A;  1GQE A;  4DMI A;  5DNY A;  2EN3 A;  1HR0 E;  4M2Z A;  2YSO A;  2RSI A;  2RSM A;  3HTX A;  3THO B;  1G2D C;  2EM5 A;  4LF6 E;  2UUC E;  2LVH A;  4L5N C;  1YUI A;  2YTO A;  2BB8 A;  4O24 A;  2H36 X;  2B7V A;  3L00 A;  3FIG A;  4DR2 E;  2EM6 A;  1JK1 A;  1IMU A;  5AE1 A;  2YRK A;  2EPL X;  3IWB A;  4J8Z A;  1YYO A;  2L8T A;  4O4K A;  1AAY A;  4LU9 A;  4F6N A;  4DUY E;  4O5G A;  1J5E E;  1DI2 A;  2EM4 A;  5KL7 A;  5KL5 A;  1O0W A;  1GTK A;  1DGC A;  2LJH A;  5AC5 A;  3KZZ A;  3F6H A;  1I94 E;  5KL4 A;  2DRP A;  5KL6 A;  2RTX A;  3ADL A;  1A1G A;  2L6M A;  2I13 A;  4WXC A;  4X9J A;  3THN A;  2EPK X;  2CSH A;  2RS7 A;  4ZYD A;  2LE2 A;  3MHH C;  2R1F A;  2E5L E;  4MLV A;  4BHC A;  5AAS A;  4YY3 E;  1N33 E;  1Z1B A;  4BCA A;  2UUA E;  2NA2 A;  2EQ1 A;  2MC6 A;  2EM9 A;  2EM0 A;  2KOU A;  2EM7 A;  4JI1 E;  4R2E A;  2VQE E;  3UK3 C;  4GKK E;  5IT9 C;  2LJU A;  2LCE A;  4LF5 E;  2EOZ A;  2NUG A;  2HC5 A;  2EOM A;  2V85 A;  4GZN C;  4LF8 E;  3HXL A;  2GHF A;  3ADG A;  2WBS A;  1B69 A;  2HGH A;  2N3G A;  2DIX A;  2LT7 A;  2EOF A;  5FLX C;  3F6G A;  2FGG A;  3J80 C;  2YTN A;  2MDR A;  2YPN A;  4R2C A;  2NUF A;  3EPH A;  2JVA A;  2K4V A;  3J7A G;  4ZYE A;  2EOJ A;  2WCC 3;  2YTD A;  1A1L A;  1YYW A;  1DQ3 A;  1X48 A;  2EWL A;  2MC5 A;  2BBG A;  2VE7 C;  3M99 B;  2ENH A;  4DV4 E;  2EN6 A;  1YZ9 A;  2YU8 A;  3VK6 A;  3MSW A;  4R2A A;  1T4L B;  3EPK A;  5LL6 R;  4N4R B;  2VRD A;  1UN6 B;  1YYK A;  5IV8 B;  3T1H E;  4DKK A;  1TF6 A;  4F9C B;  4X8W A;  1KYQ A;  1X6H A;  2YSP A;  3DF6 A;  2EZ6 A;  1WHN A;  1HNW E;  2UU9 E;  2YTE A;  1PJQ A;  4M30 A;  2HHH E;  2EMZ A;  3C4B A;  4DV7 E;  4BC7 A;  1HNX E;  1X6E A;  2VQF E;  2PRT A;  4KZS A;  2HJJ A;  4X66 E;  2UXB E;  3MHS C;  2EMY A;  2EOY A;  1WXR A;  2EOH A;  5KL3 A;  1EKZ A;  5A6J A;  1WJP A;  2EE8 A;  2EMG A;  4YHH E;  1PKP A;  4O43 A;  4B3S E;  1X5W A;  1GZ6 A;  5A6K A;  1N36 E;  2ENA A;  4DR1 E;  2JOB A;  2YU5 A;  4F9A B;  2YTG A;  2L3C A;  4JI6 E;  1N32 E;  4LF9 E;  2A25 A;  2EOR A;  5ADZ A;  2EN4 A;  1A1F A;  2EM3 A;  4R2Q A;  1HNZ E;  1TF3 A;  4X62 E;  4F6M A;  2YRM A; 
#chains in the Genus database with same CATH homology
 1ZBQ A;  4DV3 E;  3KWR A;  1FJG E;  4X64 E;  2DB2 A;  2LUQ A;  4BCA A;  2UUA E;  4NXM E;  2NA2 A;  3AUZ A;  4BC9 A;  4NXN E;  2MC6 A;  2L92 A;  2KOU A;  4DR5 E;  4JI1 E;  2V83 A;  2VQE E;  3HQ1 A;  4GKK E;  4WPY A;  4DV0 E;  5IT9 C;  4LF4 E;  5LMN E;  4WSP A;  1RQ0 A;  4JI0 E;  2UUB E;  4LF5 E;  4R8O A;  5AE3 A;  4JI8 E;  2NUG A;  5BR8 E;  4AQY E;  2V85 A;  3ADJ A;  4LF8 E;  3HXL A;  2UXC E;  2G7H A;  3IWC A;  4LF7 E;  3ADG A;  4DR7 E;  2IHR 1;  1RC7 A;  2ZM6 E;  1IBL E;  2B7T A;  2ODR D;  2N3G A;  5LMU E;  2DIX A;  2F8B A;  5CFF E;  5FLX C;  5AE2 A;  3F6G A;  2FGG A;  4I8O A;  3J80 C;  2YT4 A;  4GKJ E;  2MDR A;  3AV0 A;  2NUF A;  1UIL A;  3LLH A;  3J81 C;  4DV6 E;  2JVA A;  2K4V A;  2KON A;  3T1Y E;  2LRS A;  2LBS B;  4LFC E;  2LTR A;  3K6Q A;  5T6J A;  4BS9 A;  5F3W A;  4L8N A;  4F54 A;  2RS6 A;  3JAM C;  1YYW A;  1XMO E;  1DQ3 A;  1X48 A;  2EWL A;  2MC5 A;  2VE7 C;  2DSY A;  4GEQ B;  4LTY A;  3J7Y p;  4DUZ E;  4TUG A;  2V88 A;  2F4V E;  4JYA E;  3H09 A;  4LFB E;  4LFA E;  4DV4 E;  1XMQ E;  2M1S A;  4JI5 E;  5IWA E;  2LMZ A;  2JR1 A;  2ODR C;  1YZ9 A;  2B9D A;  3LML A;  1SR9 A;  1UHZ A;  3ZOQ B;  3VK6 A;  3DJW A;  3MSW A;  3VYX A;  2DMY A;  2B3T B;  1WHQ A;  1T4L B;  5LL6 R;  1GQE A;  2FV4 B;  1T4N A;  3P1X A;  4BMJ A;  4DMI A;  5DNY A;  1IBK E;  1YYK A;  2V89 A;  1T4O A;  3C4T A;  3J7A G;  3T1H E;  4JI3 E;  1HR0 E;  1X47 A;  2JY9 A;  4DKK A;  4M2Z A;  4F9C B;  4P78 A;  4X8W A;  2RSM A;  3HTX A;  2V8Q B;  3DF6 A;  3JTZ A;  2EZ6 A;  1WHN A;  4WFT A;  1ZBT A;  4OOG C;  2UU9 E;  4DV2 E;  2UUC E;  4M30 A;  4LF6 E;  1HNW E;  4L5N C;  2HHH E;  3C4B A;  1X49 A;  2H36 X;  4DV7 E;  4B3R E;  4DR6 E;  1XNR E;  4TUI A;  4BC7 A;  1HNX E;  2B7V A;  3HPS A;  2VF1 A;  4KZS A;  2VQF E;  4DV1 E;  2KHX A;  2LTS A;  3FIG A;  4X66 E;  1STU A;  4DR2 E;  4DV5 E;  4B3T E;  2NUE A;  2V87 A;  1WXR A;  3OML A;  5AE1 A;  2L2M A;  2UXD E;  3IWB A;  4J8Z A;  4WYQ B;  2L8T A;  1YYO A;  1EKZ A;  4DR3 E;  2M4I A;  4KHP E;  4LU9 A;  4OX9 E;  4DUY E;  4YHH E;  1PKP A;  2M7Q A;  1J5E E;  3IWD A;  1XNQ E;  4JI4 E;  1DI2 A;  4B3S E;  3RMP A;  1GZ6 A;  4K0K E;  1O0W A;  2JOX A;  2FTX B;  2V86 A;  4R03 A;  3OTO E;  2L2K B;  2LJH A;  1N36 E;  2UXB E;  2CPN A;  4JI2 E;  1N34 E;  3ADI A;  4Q28 A;  4DR1 E;  2L33 A;  2JOB A;  2LUP B;  2WZO A;  4F9A B;  3HPZ A;  2JWO A;  3F6H A;  4JI7 E;  2L3C A;  4F9B B;  3VYY A;  1I94 E;  4JI6 E;  1N32 E;  4X65 E;  2RTX A;  1FKA E;  4LF9 E;  3ADL A;  2YZT A;  2L6M A;  2L2N A;  5ADZ A;  2N3H A;  1HNZ E;  3JU0 A;  1IBM E;  2RS7 A;  1QU6 A;  1J26 A;  5A2Q C;  4JV5 E;  4X62 E;  2LE2 A;  4P7D A;  2E1M A;  4B3M E;  4DR4 E;  2L3J A;  2E5L E;  4BBY A;  5AAS A;  4YY3 E;  4M0V A;  1N33 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...