2LE2A

Novel dimeric structure of phage phi29-encoded protein p56: insights into uracil-dna glycosylase inhibition
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
MVQNDFVDSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P56
publication title Novel dimeric structure of phage 29-encoded protein p56: insights into uracil-DNA glycosylase inhibition.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Hydrolase inhibitor
total genus 8
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2le2A00
2LE2A 3ZOQB 4L5NC
chains in the Genus database with same CATH superfamily
2YTJA 1FJGE 2EMAA 5TSEA 4X62E 3DJWA 2HJJA 2EPUA 2MDGA 4KZSA 1ZBQA 2YWQA 2EM2A 4L5NC 3IWDA 3DF6A 1T38A 2YTPA 2EOYA 2N3GA 2HC5A 2HGHA 3THNA 5A6BD 1YSAC 2EM5A 2EOEA 4WX9A 1J26A 2YTGA 2WZOA 2YZTA 5AE1A 4RHBB 2ELZA 5A69A 1YZ9A 1O0WA 4GKJE 2NUGA 1XNRE 4R2CA 2YSOA 1A1FA 2EE8A 4LFAE 4GEQB 2JOXA 5LMNE 4R2EA 2JOBA 1ZR9A 3BGHA 1B69A 4DR6E 2L6MA 1PJTA 4JI0E 1UN6B 2NABA 2GHFA 3KZZA 4F54A 2DLKA 2ENHA 2F8BA 4JI8E 1IBLE 2EM3A 4F9CB 2KONA 2EMFA 2J7JA 4LF7E 4B3RE 2EPRA 1GQEA 4F9BB 3T1HE 2YTDA 1JK2A 2CTDA 3K6QA 2EWLA 4LF5E 3HPSA 4DMIA 3QG5C 3M99B 2D9HA 2B3TB 4DV6E 1MGTA 2L2NA 2EL4A 2CT1A 5KL6A 2LJHA 1TF6A 4X64E 2EOMA 2EPNA 2EMZA 4O24A 4R2RA 4ZYHA 3J81C 2MC6A 1DQ3A 5KL4A 2LT7A 2L3CA 2G7HA 4ZYEA 3J7Yp 4WPYA 2ZM6E 1Z1BA 4X66E 2JY9A 1WXRA 2EPCA 2RPCA 3JU0A 2ODRC 2N8XA 2EMGA 2RTXA 2DRPA 2EPKX 2EPPA 5T6JA 5LLQA 3T1YE 3LMLA 3ADLA 1N3GA 2UXBE 4GKKE 4JV5E 2V87A 1T4NA 5AE3A 4F6NA 1KJKA 4BBYA 3EPKA 2GPIA 2EM6A 2V83A 1P47A 1NCSA 4IJDA 2FV4B 2EPXA 3J7AG 1SFEA 2A25A 4NZVA 4X65E 4DR4E 2E72A 2YTNA 2WCC3 1QU6A 1EKZA 2EORA 3MSWA 2MC5A 4B3TE 4JI7E 2WBUA 1N36E 5IWAE 4LF8E 2YTIA 1BBOA 4LFCE 2DGCA 2EOXA 4R2AA 2EQ0A 1X49A 4LF9E 4HTGA 2EOOA 2FTXB 4I8OA 1X5WA 2I9IA 1JK1A 2K4VA 4LU9A 2ENCA 1IMUA 1WRJA 4BCAA 2EMXA 2K7IA 4R2PA 4AQYE 1YYKA 3EQ1A 1GTKA 5KL3A 5FLXC 1PKPA 4YHHE 5KL7A 4JYAE 3OMLA 2LUPB 4DV5E 4JI5E 1ZAAC 3KWRA 4O4KA 4M30A 2YPNA 3C4TA 2EPLX 1UILA 2DLQA 4DV0E 4JI2E 2M7QA 4Q28A 2NUFA 2EM9A 3HQ1A 4JI4E 4DV1E 2E1MA 1STUA 2EPZA 4R2SA 3C6KA 2JP9A 3IWCA 2V85A 3IWBA 4JI1E 2KOUA 1HNWE 4B3SE 4DR7E 3OTOE 2LRSA 2UUBE 2I13A 1XNQE 2EPMX 2UUAE 1DI2A 3L00A 1AH5A 1LLMC 2DIXA 2LE2A 1PJSA 1A1HA 4R2DA 2EP3A 2EM8A 1X6EA 2H36X 2YTEA 3J80C 2EPOA 2KHXA 1T4OA 2JYAA 2EN4A 2EN3A 2EOHA 5KL5A 1AAYA 4YY3E 4MLVA 2YT4A 2EOFA 4M0VA 1HNZE 2BB8A 2EN6A 5ADZA 5IXMB 2EN1A 2YTQA 1EH8A 3P1XA 4B3ME 1RQ0A 2L2MA 1XMQE 4LF6E 2E5LE 4DR2E 1J5EE 2YTFA 2MKDA 4GZNC 2UXDE 1A1GA 2B9DA 2LBSB 2EOSA 1N33E 2L8TA 2LMZA 3ADGA 4P7DA 4DUZE 1IBKE 1HNXE 2EM4A 2NUEA 3H09A 3FIGA 1XMOE 3KZYA 4ZYDA 3HXLA 4J8ZA 4JI6E 5KL2A 5DNYA 2LTSA 2GLIA 2LV2A 2RS7A 2YU5A 4OX9E 4BHCA 2LUQA 2IHR1 3BF2A 2ENAA 2VQFE 3HTXA 2EOZA 2V8QB 3LLHA 1IQSA 4ZYGA 1YPNA 2ODRD 2EMIA 2L3JA 2CPNA 2VF1A 1WJPA 4MLQA 1A1IA 2YRHA 2YRKA 2B7TA 4KWYA 4LF4E 5AE2A 3EPLA 4P78A 2VQEE 1EH6A 2EM7A 3MHHC 2UU9E 2RQLA 2EMWA 2V89A 1A1KA 4BC7A 2EN7A 2EMCA 5AC4A 1BBGA 2DMYA 5CFFE 4L8NA 2L92A 1I94E 2EMKA 1UHZA 1ZBTA 4RH8A 2MKNA 1F2IG 4F2JC 1N32E 2EJ4A 2EMYA 1DGCA 1SR9A 2EN2A 1A1LA 4TUIA 2M4IA 1YUJA 3THOB 4WSGA 2JPAA 2EMBA 5F3WA 2ADRA 4WYQB 3VK6A 2WBTA 2EL5A 1G2FC 2EOQA 2EL6A 5BR8E 2VRDA 4BC9A 3AUZA 1TF3A 1RMDA 2RSMA 4FK5C 4DUYE 2F4VE 2EQ3A 4TUGA 4LFBE 1YYWA 3TQMA 5A6AA 2YTOA 1WHNA 4DV4E 1A1JA 1YFHA 2EMLA 2LTRA 1X6FA 4WXDA 5IT9C 2EOJA 5LMUE 2BBGA 2JWOA 2YRMA 3AV0A 4DV7E 3C4BA 2HHHE 2PRTA 2RS6A 4O43A 2L2KB 4NHRA 5A6JA 2YU8A 1X47A 3F6HA 1WHQA 1NEIA 4DR3E 1G2DC 2R1FA 2DSYA 2EPAA 2EN8A 4O5GA 4F9AB 2B7VA 5IV8B 4NXNE 3JTZA 1HR0E 3HPZA 1X48A 4HEIA 4K0KE 2LO3A 1T4LB 4WSPA 1QNTA 3ADIA 3VYXA 3EPJA 4DR5E 4WXCA 1GZ6A 4DV2E 2EZ6A 2VE7C 1X6HA 2V88A 4IS1C 4R8OA 1N34E 5A6KA 2LVHA 1IBME 1ZU1A 4M2ZA 1KYQA 3VHTB 2FGGA 2UUCE 2M9AA 2JVAA 2R76A 3BBGA 2ELYA 3ADJA 4BHBA 4Q35B 2JR1A 3BIDA 2EM0A 1T39A 2EMHA 1FKAE 3UK3C 4BS9A 2JXPA 2N3HA 4OOGC 4R2QA 3C6MA 4M9VC 2M1SA 5A6BA 2MDRA 1BB8A 2LJUA 4R03A 1EH7A 2EOIA 4JI3E 1UBDC 4N4RB 2CSHA 2RSIA 4NXME 2LCEA 3ECRA 4BMJA 3EPHA 4WFTA 2WBSA 3VYYA 2UXCE 4LTYA 1YYOA 1YUIA 2V86A 4X9JA 4F6MA 4X8WA 1RC7A 4DR1E 3F6GA 2L33A 5AASA 3MHSC 4DKKA 2Q8UA 3RMPA 1X3CA 2DMIA 5LL6R 2EQ1A 4KHPE 5A2QC 2DB2A 1TN9A 2NA2A 1MEYC 1PJQA 3ZOQB 5AC5A 1L4SA 3JAMC 1IQOA 4DV3E 1PDAA 2YSPA
chains in the Genus database with same CATH topology
4DR2E 1FJGE 2RS6A 1J5EE 4GKKE 4JV5E 2UXDE 2V87A 2B9DA 2L2KB 2LBSB 1T4NA 5AE3A 3DJWA 4X62E 4BBYA 2L8TA 2LMZA 1N33E 3ADGA 4P7DA 4KZSA 4DUZE 1X47A 1IBKE 1HNXE 1ZBQA 1WHQA 2V83A 3F6HA 2NUEA 2FV4B 4DR3E 3H09A 4L5NC 3FIGA 3IWDA 3DF6A 3J7AG 1XMOE 4X65E 2DSYA 4DR4E 2N3GA 4F9AB 1QU6A 2B7VA 3HXLA 4J8ZA 1EKZA 4JI6E 4NXNE 3MSWA 2MC5A 5DNYA 2LTSA 4B3TE 4JI7E 3JTZA 1HR0E 3HPZA 1X48A 1N36E 4K0KE 1J26A 2RS7A 2WZOA 2YZTA 5AE1A 5IWAE 1T4LB 4LF8E 4WSPA 1YZ9A 4OX9E 1O0WA 3ADIA 3VYXA 4DR5E 4GKJE 2NUGA 2LUQA 2IHR1 1GZ6A 1XNRE 4DV2E 4LFCE 2EZ6A 2VE7C 2VQFE 4KHPE 1X49A 4LFAE 2V88A 4LF9E 3HTXA 4GEQB 2JOXA 2V8QB 4R8OA 3LLHA 5LMNE 2FTXB 1N34E 4I8OA 2JOBA 2ODRD 1IBME 4M2ZA 2K4VA 2L3JA 4LU9A 4DR6E 2CPNA 2VF1A 4BCAA 2FGGA 2L6MA 4AQYE 2UUCE 2B7TA 2JVAA 1YYKA 4JI0E 4LF4E 3ADJA 5AE2A 4F54A 4P78A 5FLXC 1PKPA 2F8BA 4JI8E 4YHHE 2VQEE 3OMLA 1IBLE 4JYAE 2LUPB 1FKAE 4BS9A 4DV5E 2N3HA 4F9CB 4JI5E 2KONA 3KWRA 2UU9E 4OOGC 4LF7E 4B3RE 2V89A 4BC7A 1GQEA 4M30A 4F9BB 2M1SA 3T1HE 3C4TA 3K6QA 2MDRA 2DMYA 4DV0E 1UILA 5CFFE 4L8NA 2EWLA 2L92A 2M7QA 4Q28A 1I94E 4JI2E 4LF5E 4R03A 2NUFA 4JI4E 1UHZA 3HQ1A 1XMQE 4DV1E 2E1MA 1ZBTA 3HPSA 4JI3E 1STUA 4DMIA 4JI1E 3IWCA 2V85A 3IWBA 1N32E 2KOUA 1HNWE 2B3TB 4DV6E 4B3SE 1SR9A 4NXME 4BMJA 2L2NA 4TUIA 4WFTA 2M4IA 4DR7E 2LJHA 3OTOE 2LRSA 3VYYA 2UXCE 2UUBE 4X64E 1XNQE 4LTYA 1YYOA 2UUAE 2V86A 1DI2A 5F3WA 4WYQB 3J81C 2MC6A 1DQ3A 4X8WA 4DR1E 1RC7A 3VK6A 3F6GA 2DIXA 2LE2A 2L33A 5AASA 2L3CA 5BR8E 4BC9A 2G7HA 3AUZA 4DKKA 2RSMA 4WPYA 2H36X 3J7Yp 2ZM6E 4DUYE 3RMPA 2F4VE 3J80C 4TUGA 4X66E 4LFBE 1YYWA 2KHXA 1T4OA 5LL6R 1WHNA 2JY9A 1WXRA 4YY3E 5A2QC 2YT4A 2DB2A 4M0VA 4DV4E 3JU0A 2ODRC 4LF6E 1HNZE 2NA2A 2RTXA 2HHHE 2LTRA 3ZOQB 5ADZA 5T6JA 3JAMC 5IT9C 5LMUE 3T1YE 2JWOA 3AV0A 3P1XA 3LMLA 4DV3E 4DV7E 3C4BA 3ADLA 4B3ME 1RQ0A 2L2MA 2JR1A 2UXBE 2E5LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE2 A;  3ZOQ B;  4L5N C; 
#chains in the Genus database with same CATH topology
 2YTJ A;  1FJG E;  2EMA A;  5TSE A;  4X62 E;  3DJW A;  2HJJ A;  2EPU A;  2MDG A;  4KZS A;  1ZBQ A;  2YWQ A;  2EM2 A;  4L5N C;  3IWD A;  3DF6 A;  1T38 A;  2YTP A;  2EOY A;  2N3G A;  2HC5 A;  2HGH A;  3THN A;  5A6B D;  1YSA C;  2EM5 A;  2EOE A;  4WX9 A;  1J26 A;  2YTG A;  2WZO A;  2YZT A;  5AE1 A;  4RHB B;  2ELZ A;  5A69 A;  1YZ9 A;  1O0W A;  4GKJ E;  2NUG A;  1XNR E;  4R2C A;  2YSO A;  1A1F A;  2EE8 A;  4LFA E;  4GEQ B;  2JOX A;  5LMN E;  4R2E A;  2JOB A;  1ZR9 A;  3BGH A;  1B69 A;  4DR6 E;  2L6M A;  1PJT A;  4JI0 E;  1UN6 B;  2NAB A;  2GHF A;  3KZZ A;  4F54 A;  2DLK A;  2ENH A;  2F8B A;  4JI8 E;  1IBL E;  2EM3 A;  4F9C B;  2KON A;  2EMF A;  2J7J A;  4LF7 E;  4B3R E;  2EPR A;  1GQE A;  4F9B B;  3T1H E;  2YTD A;  1JK2 A;  2CTD A;  3K6Q A;  2EWL A;  4LF5 E;  3HPS A;  4DMI A;  3QG5 C;  3M99 B;  2D9H A;  2B3T B;  4DV6 E;  1MGT A;  2L2N A;  2EL4 A;  2CT1 A;  5KL6 A;  2LJH A;  1TF6 A;  4X64 E;  2EOM A;  2EPN A;  2EMZ A;  4O24 A;  4R2R A;  4ZYH A;  3J81 C;  2MC6 A;  1DQ3 A;  5KL4 A;  2LT7 A;  2L3C A;  2G7H A;  4ZYE A;  3J7Y p;  4WPY A;  2ZM6 E;  1Z1B A;  4X66 E;  2JY9 A;  1WXR A;  2EPC A;  2RPC A;  3JU0 A;  2ODR C;  2N8X A;  2EMG A;  2RTX A;  2DRP A;  2EPK X;  2EPP A;  5T6J A;  5LLQ A;  3T1Y E;  3LML A;  3ADL A;  1N3G A;  2UXB E;  4GKK E;  4JV5 E;  2V87 A;  1T4N A;  5AE3 A;  4F6N A;  1KJK A;  4BBY A;  3EPK A;  2GPI A;  2EM6 A;  2V83 A;  1P47 A;  1NCS A;  4IJD A;  2FV4 B;  2EPX A;  3J7A G;  1SFE A;  2A25 A;  4NZV A;  4X65 E;  4DR4 E;  2E72 A;  2YTN A;  2WCC 3;  1QU6 A;  1EKZ A;  2EOR A;  3MSW A;  2MC5 A;  4B3T E;  4JI7 E;  2WBU A;  1N36 E;  5IWA E;  4LF8 E;  2YTI A;  1BBO A;  4LFC E;  2DGC A;  2EOX A;  4R2A A;  2EQ0 A;  1X49 A;  4LF9 E;  4HTG A;  2EOO A;  2FTX B;  4I8O A;  1X5W A;  2I9I A;  1JK1 A;  2K4V A;  4LU9 A;  2ENC A;  1IMU A;  1WRJ A;  4BCA A;  2EMX A;  2K7I A;  4R2P A;  4AQY E;  1YYK A;  3EQ1 A;  1GTK A;  5KL3 A;  5FLX C;  1PKP A;  4YHH E;  5KL7 A;  4JYA E;  3OML A;  2LUP B;  4DV5 E;  4JI5 E;  1ZAA C;  3KWR A;  4O4K A;  4M30 A;  2YPN A;  3C4T A;  2EPL X;  1UIL A;  2DLQ A;  4DV0 E;  4JI2 E;  2M7Q A;  4Q28 A;  2NUF A;  2EM9 A;  3HQ1 A;  4JI4 E;  4DV1 E;  2E1M A;  1STU A;  2EPZ A;  4R2S A;  3C6K A;  2JP9 A;  3IWC A;  2V85 A;  3IWB A;  4JI1 E;  2KOU A;  1HNW E;  4B3S E;  4DR7 E;  3OTO E;  2LRS A;  2UUB E;  2I13 A;  1XNQ E;  2EPM X;  2UUA E;  1DI2 A;  3L00 A;  1AH5 A;  1LLM C;  2DIX A;  2LE2 A;  1PJS A;  1A1H A;  4R2D A;  2EP3 A;  2EM8 A;  1X6E A;  2H36 X;  2YTE A;  3J80 C;  2EPO A;  2KHX A;  1T4O A;  2JYA A;  2EN4 A;  2EN3 A;  2EOH A;  5KL5 A;  1AAY A;  4YY3 E;  4MLV A;  2YT4 A;  2EOF A;  4M0V A;  1HNZ E;  2BB8 A;  2EN6 A;  5ADZ A;  5IXM B;  2EN1 A;  2YTQ A;  1EH8 A;  3P1X A;  4B3M E;  1RQ0 A;  2L2M A;  1XMQ E;  4LF6 E;  2E5L E;  4DR2 E;  1J5E E;  2YTF A;  2MKD A;  4GZN C;  2UXD E;  1A1G A;  2B9D A;  2LBS B;  2EOS A;  1N33 E;  2L8T A;  2LMZ A;  3ADG A;  4P7D A;  4DUZ E;  1IBK E;  1HNX E;  2EM4 A;  2NUE A;  3H09 A;  3FIG A;  1XMO E;  3KZY A;  4ZYD A;  3HXL A;  4J8Z A;  4JI6 E;  5KL2 A;  5DNY A;  2LTS A;  2GLI A;  2LV2 A;  2RS7 A;  2YU5 A;  4OX9 E;  4BHC A;  2LUQ A;  2IHR 1;  3BF2 A;  2ENA A;  2VQF E;  3HTX A;  2EOZ A;  2V8Q B;  3LLH A;  1IQS A;  4ZYG A;  1YPN A;  2ODR D;  2EMI A;  2L3J A;  2CPN A;  2VF1 A;  1WJP A;  4MLQ A;  1A1I A;  2YRH A;  2YRK A;  2B7T A;  4KWY A;  4LF4 E;  5AE2 A;  3EPL A;  4P78 A;  2VQE E;  1EH6 A;  2EM7 A;  3MHH C;  2UU9 E;  2RQL A;  2EMW A;  2V89 A;  1A1K A;  4BC7 A;  2EN7 A;  2EMC A;  5AC4 A;  1BBG A;  2DMY A;  5CFF E;  4L8N A;  2L92 A;  1I94 E;  2EMK A;  1UHZ A;  1ZBT A;  4RH8 A;  2MKN A;  1F2I G;  4F2J C;  1N32 E;  2EJ4 A;  2EMY A;  1DGC A;  1SR9 A;  2EN2 A;  1A1L A;  4TUI A;  2M4I A;  1YUJ A;  3THO B;  4WSG A;  2JPA A;  2EMB A;  5F3W A;  2ADR A;  4WYQ B;  3VK6 A;  2WBT A;  2EL5 A;  1G2F C;  2EOQ A;  2EL6 A;  5BR8 E;  2VRD A;  4BC9 A;  3AUZ A;  1TF3 A;  1RMD A;  2RSM A;  4FK5 C;  4DUY E;  2F4V E;  2EQ3 A;  4TUG A;  4LFB E;  1YYW A;  3TQM A;  5A6A A;  2YTO A;  1WHN A;  4DV4 E;  1A1J A;  1YFH A;  2EML A;  2LTR A;  1X6F A;  4WXD A;  5IT9 C;  2EOJ A;  5LMU E;  2BBG A;  2JWO A;  2YRM A;  3AV0 A;  4DV7 E;  3C4B A;  2HHH E;  2PRT A;  2RS6 A;  4O43 A;  2L2K B;  4NHR A;  5A6J A;  2YU8 A;  1X47 A;  3F6H A;  1WHQ A;  1NEI A;  4DR3 E;  1G2D C;  2R1F A;  2DSY A;  2EPA A;  2EN8 A;  4O5G A;  4F9A B;  2B7V A;  5IV8 B;  4NXN E;  3JTZ A;  1HR0 E;  3HPZ A;  1X48 A;  4HEI A;  4K0K E;  2LO3 A;  1T4L B;  4WSP A;  1QNT A;  3ADI A;  3VYX A;  3EPJ A;  4DR5 E;  4WXC A;  1GZ6 A;  4DV2 E;  2EZ6 A;  2VE7 C;  1X6H A;  2V88 A;  4IS1 C;  4R8O A;  1N34 E;  5A6K A;  2LVH A;  1IBM E;  1ZU1 A;  4M2Z A;  1KYQ A;  3VHT B;  2FGG A;  2UUC E;  2M9A A;  2JVA A;  2R76 A;  3BBG A;  2ELY A;  3ADJ A;  4BHB A;  4Q35 B;  2JR1 A;  3BID A;  2EM0 A;  1T39 A;  2EMH A;  1FKA E;  3UK3 C;  4BS9 A;  2JXP A;  2N3H A;  4OOG C;  4R2Q A;  3C6M A;  4M9V C;  2M1S A;  5A6B A;  2MDR A;  1BB8 A;  2LJU A;  4R03 A;  1EH7 A;  2EOI A;  4JI3 E;  1UBD C;  4N4R B;  2CSH A;  2RSI A;  4NXM E;  2LCE A;  3ECR A;  4BMJ A;  3EPH A;  4WFT A;  2WBS A;  3VYY A;  2UXC E;  4LTY A;  1YYO A;  1YUI A;  2V86 A;  4X9J A;  4F6M A;  4X8W A;  1RC7 A;  4DR1 E;  3F6G A;  2L33 A;  5AAS A;  3MHS C;  4DKK A;  2Q8U A;  3RMP A;  1X3C A;  2DMI A;  5LL6 R;  2EQ1 A;  4KHP E;  5A2Q C;  2DB2 A;  1TN9 A;  2NA2 A;  1MEY C;  1PJQ A;  3ZOQ B;  5AC5 A;  1L4S A;  3JAM C;  1IQO A;  4DV3 E;  1PDA A;  2YSP A; 
#chains in the Genus database with same CATH homology
 4DR2 E;  1FJG E;  2RS6 A;  1J5E E;  4GKK E;  4JV5 E;  2UXD E;  2V87 A;  2B9D A;  2L2K B;  2LBS B;  1T4N A;  5AE3 A;  3DJW A;  4X62 E;  4BBY A;  2L8T A;  2LMZ A;  1N33 E;  3ADG A;  4P7D A;  4KZS A;  4DUZ E;  1X47 A;  1IBK E;  1HNX E;  1ZBQ A;  1WHQ A;  2V83 A;  3F6H A;  2NUE A;  2FV4 B;  4DR3 E;  3H09 A;  4L5N C;  3FIG A;  3IWD A;  3DF6 A;  3J7A G;  1XMO E;  4X65 E;  2DSY A;  4DR4 E;  2N3G A;  4F9A B;  1QU6 A;  2B7V A;  3HXL A;  4J8Z A;  1EKZ A;  4JI6 E;  4NXN E;  3MSW A;  2MC5 A;  5DNY A;  2LTS A;  4B3T E;  4JI7 E;  3JTZ A;  1HR0 E;  3HPZ A;  1X48 A;  1N36 E;  4K0K E;  1J26 A;  2RS7 A;  2WZO A;  2YZT A;  5AE1 A;  5IWA E;  1T4L B;  4LF8 E;  4WSP A;  1YZ9 A;  4OX9 E;  1O0W A;  3ADI A;  3VYX A;  4DR5 E;  4GKJ E;  2NUG A;  2LUQ A;  2IHR 1;  1GZ6 A;  1XNR E;  4DV2 E;  4LFC E;  2EZ6 A;  2VE7 C;  2VQF E;  4KHP E;  1X49 A;  4LFA E;  2V88 A;  4LF9 E;  3HTX A;  4GEQ B;  2JOX A;  2V8Q B;  4R8O A;  3LLH A;  5LMN E;  2FTX B;  1N34 E;  4I8O A;  2JOB A;  2ODR D;  1IBM E;  4M2Z A;  2K4V A;  2L3J A;  4LU9 A;  4DR6 E;  2CPN A;  2VF1 A;  4BCA A;  2FGG A;  2L6M A;  4AQY E;  2UUC E;  2B7T A;  2JVA A;  1YYK A;  4JI0 E;  4LF4 E;  3ADJ A;  5AE2 A;  4F54 A;  4P78 A;  5FLX C;  1PKP A;  2F8B A;  4JI8 E;  4YHH E;  2VQE E;  3OML A;  1IBL E;  4JYA E;  2LUP B;  1FKA E;  4BS9 A;  4DV5 E;  2N3H A;  4F9C B;  4JI5 E;  2KON A;  3KWR A;  2UU9 E;  4OOG C;  4LF7 E;  4B3R E;  2V89 A;  4BC7 A;  1GQE A;  4M30 A;  4F9B B;  2M1S A;  3T1H E;  3C4T A;  3K6Q A;  2MDR A;  2DMY A;  4DV0 E;  1UIL A;  5CFF E;  4L8N A;  2EWL A;  2L92 A;  2M7Q A;  4Q28 A;  1I94 E;  4JI2 E;  4LF5 E;  4R03 A;  2NUF A;  4JI4 E;  1UHZ A;  3HQ1 A;  1XMQ E;  4DV1 E;  2E1M A;  1ZBT A;  3HPS A;  4JI3 E;  1STU A;  4DMI A;  4JI1 E;  3IWC A;  2V85 A;  3IWB A;  1N32 E;  2KOU A;  1HNW E;  2B3T B;  4DV6 E;  4B3S E;  1SR9 A;  4NXM E;  4BMJ A;  2L2N A;  4TUI A;  4WFT A;  2M4I A;  4DR7 E;  2LJH A;  3OTO E;  2LRS A;  3VYY A;  2UXC E;  2UUB E;  4X64 E;  1XNQ E;  4LTY A;  1YYO A;  2UUA E;  2V86 A;  1DI2 A;  5F3W A;  4WYQ B;  3J81 C;  2MC6 A;  1DQ3 A;  4X8W A;  4DR1 E;  1RC7 A;  3VK6 A;  3F6G A;  2DIX A;  2LE2 A;  2L33 A;  5AAS A;  2L3C A;  5BR8 E;  4BC9 A;  2G7H A;  3AUZ A;  4DKK A;  2RSM A;  4WPY A;  2H36 X;  3J7Y p;  2ZM6 E;  4DUY E;  3RMP A;  2F4V E;  3J80 C;  4TUG A;  4X66 E;  4LFB E;  1YYW A;  2KHX A;  1T4O A;  5LL6 R;  1WHN A;  2JY9 A;  1WXR A;  4YY3 E;  5A2Q C;  2YT4 A;  2DB2 A;  4M0V A;  4DV4 E;  3JU0 A;  2ODR C;  4LF6 E;  1HNZ E;  2NA2 A;  2RTX A;  2HHH E;  2LTR A;  3ZOQ B;  5ADZ A;  5T6J A;  3JAM C;  5IT9 C;  5LMU E;  3T1Y E;  2JWO A;  3AV0 A;  3P1X A;  3LML A;  4DV3 E;  4DV7 E;  3C4B A;  3ADL A;  4B3M E;  1RQ0 A;  2L2M A;  2JR1 A;  2UXB E;  2E5L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...