2LE2A

Novel dimeric structure of phage phi29-encoded protein p56: insights into uracil-dna glycosylase inhibition
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
MVQNDFVDSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel dimeric structure of phage 29-encoded protein p56: insights into uracil-DNA glycosylase inhibition.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Hydrolase inhibitor
molecule keywords P56
total genus 8
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2le2A00
3ZOQB 4L5NC 2LE2A
chains in the Genus database with same CATH superfamily
4WXDA 3ADIA 4R2AA 2YTPA 1WHQA 2YTNA 3RMPA 2N3GA 4O4KA 2L33A 3P1XA 1GZ6A 2E72A 4WXCA 4M30A 2EN2A 4DV2E 4P78A 4GEQB 1YYKA 2EPZA 1YYOA 2EQ0A 4RHBB 2WBTA 4IS1C 2EMBA 2JOXA 3ADGA 2F4VE 5DNYA 3EPHA 2JVAA 2EMZA 2EPOA 4R03A 2UXCE 4AQYE 5BR8E 2EOFA 5KL7A 2KHXA 2K7IA 4ZYEA 4BMJA 2V87A 1WXRA 4WX9A 2YRHA 5IV8B 1PKPA 3IWBA 4F9CB 5A6KA 4LF7E 4X9JA 1G2FC 2YTIA 3MHHC 5IWAE 2RSMA 4JI8E 2V86A 1F2IG 2B7VA 2EM0A 2V88A 2VF1A 3OMLA 2MDRA 4N4RB 2L92A 4DR3E 4P7DA 3FIGA 2HGHA 1JK1A 4GKJE 3KWRA 5AC5A 1Z1BA 2VE7C 4L5NC 4GZNC 4DMIA 4DV5E 2EM4A 2MKDA 4DR5E 2ODRD 4I8OA 3MSWA 2EMCA 4RH8A 4O5GA 4WYQB 2V85A 2B7TA 4X64E 5LMNE 2ODRC 4DV0E 2YRKA 1ZBQA 3HXLA 1WRJA 5AC4A 5LLQA 3DJWA 3ECRA 4LU9A 4BCAA 5F3WA 2UU9E 4LF4E 1TF3A 2NUEA 2LT7A 4F6NA 1AAYA 1EKZA 4JV5E 2N8XA 4JI3E 4B3SE 2EMLA 5A6AA 2EPUA 2NUGA 2LRSA 1I94E 2V83A 4DUZE 4DV4E 3IWCA 3HPZA 4DV3E 1DI2A 2EM3A 4LFCE 2L2MA 4X62E 1T4NA 2KOUA 1EH7A 5IXMB 4B3RE 2JWOA 2IHR1 1XNQE 4LF6E 1N36E 2EL4A 1MGTA 2EMGA 3K6QA 4DKKA 1UILA 2EM8A 5KL5A 4LFBE 1IBME 2L3JA 1NCSA 1YUIA 2EMWA 2YZTA 1L4SA 2YTOA 2M9AA 3M99B 2YRMA 5A6BA 4OX9E 1HNWE 1A1LA 4JYAE 4MLQA 4JI2E 3C6KA 1LLMC 2A25A 4O43A 2EMHA 3AUZA 2JR1A 1RC7A 5AE3A 2FV4B 4NXME 1AH5A 2EOQA 2YU8A 4WSGA 3MHSC 2LJUA 3VYYA 3C6MA 4R2QA 3KZZA 2ELYA 2EOJA 3VK6A 4M9VC 4ZYGA 2VRDA 1IBKE 1WJPA 2VQFE 4F2JC 3TQMA 2V89A 1YUJA 1HR0E 2EQ3A 2YTDA 4JI4E 1ZAAC 2YTEA 2EM6A 1NEIA 5KL6A 5AE1A 2R76A 4F9BB 5A6JA 2UUCE 1KYQA 2DB2A 2YWQA 1A1HA 3JAMC 4JI6E 1GQEA 4DR1E 1PJTA 4R2EA 2L2KB 3F6GA 3ADJA 2YTGA 5CFFE 2EMKA 4J8ZA 1TF6A 3JU0A 2HHHE 5AASA 4F9AB 1N33E 2LBSB 2WBSA 5KL3A 2LTRA 4TUGA 1UN6B 3EPLA 1T4LB 4R2DA 3THNA 2EJ4A 4ZYHA 4DUYE 2EL5A 1EH6A 2JP9A 2DLQA 2EPLX 2ZM6E 3HQ1A 2UUBE 2JYAA 2VQEE 4B3TE 1UBDC 5T6JA 2EOHA 4KWYA 2EMYA 1GTKA 2H36X 1HNXE 4KHPE 2EOSA 2YSOA 1N32E 4X65E 2DRPA 1A1JA 1X48A 2WBUA 1X6HA 1YSAC 2V8QB 2Q8UA 3VHTB 1ZU1A 5KL4A 4R2SA 2EM2A 1FKAE 4M2ZA 3J7Yp 2JXPA 2EE8A 1RMDA 1T39A 2B9DA 1EH8A 4X8WA 3BGHA 2LV2A 4BBYA 4R8OA 1T38A 1QNTA 2EP3A 2L2NA 2LO3A 4DR7E 2JY9A 3EPKA 2ADRA 5A6BD 3C4BA 3BF2A 2KONA 1A1FA 2GPIA 2LE2A 4MLVA 3DF6A 2EOMA 5LMUE 4LF9E 1YFHA 4LFAE 2MC5A 2GLIA 4YY3E 2EOEA 2EPPA 1YYWA 2YTJA 4JI7E 4GKKE 2I13A 5LL6R 2CPNA 4DR4E 2LTSA 2UUAE 2RS7A 4R2CA 1MEYC 1FJGE 3ZOQB 2M4IA 2PRTA 4WSPA 3QG5C 2YT4A 1QU6A 1IBLE 2MC6A 1YZ9A 2HC5A 2J7JA 3ADLA 2E5LE 4LTYA 1UHZA 4IJDA 2M1SA 2DSYA 4BC9A 5TSEA 3HTXA 1STUA 1B69A 1TN9A 3IWDA 1BBGA 2EMIA 4NHRA 1IQSA 4LF5E 2JPAA 2FGGA 5A2QC 4NZVA 2CTDA 4ZYDA 2EMAA 2EWLA 1N34E 1X47A 2EORA 2DLKA 2EOYA 1KJKA 5IT9C 2ENHA 2LMZA 4DR2E 4BHBA 2RSIA 4KZSA 1PDAA 2K4VA 2BB8A 1DGCA 1JK2A 2EN6A 1X3CA 2JOBA 1PJQA 2EMXA 1X5WA 2YTFA 5FLXC 2EOOA 4WFTA 1BBOA 3C4TA 1J5EE 3J81C 1N3GA 2EMFA 3T1YE 2FTXB 3VYXA 2EPNA 1XMQE 2EZ6A 1X6EA 4BC7A 3J7AG 2GHFA 1T4OA 2L6MA 3OTOE 2DGCA 4DV1E 1A1GA 2NA2A 1SR9A 4K0KE 1PJSA 2EN1A 1XMOE 3BBGA 2LJHA 2RS6A 1IQOA 2N3HA 2I9IA 3JTZA 4FK5C 2L8TA 2UXBE 1YPNA 2CT1A 3UK3C 3LLHA 2L3CA 2EPKX 2EPMX 4OOGC 4YHHE 1J26A 2E1MA 3KZYA 2F8BA 4R2RA 2UXDE 2EM5A 1O0WA 3EQ1A 2LUPB 3J80C 2EL6A 4DV7E 2EPCA 2EPAA 2EOZA 2BBGA 2DMYA 4JI5E 2G7HA 4O24A 4TUIA 4JI0E 2MDGA 5ADZA 3H09A 2ENCA 2EOXA 4R2PA 2NUFA 1XNRE 4Q28A 4F6MA 2R1FA 3T1HE 1ZBTA 2EN8A 2ENAA 4X66E 1DQ3A 4HEIA 2EM7A 1P47A 1HNZE 2M7QA 4BS9A 2LCEA 2EN7A 2EPXA 3LMLA 4Q35B 4DV6E 4L8NA 5A69A 1WHNA 3AV0A 1IMUA 1X49A 1G2DC 2LUQA 1A1IA 2CSHA 2DIXA 4HTGA 3THOB 2HJJA 2YTQA 2EOIA 2RQLA 3BIDA 2MKNA 1RQ0A 3L00A 4BHCA 2ELZA 3F6HA 2EM9A 4M0VA 5KL2A 2EN3A 2RTXA 4NXNE 4LF8E 2EPRA 3HPSA 2LVHA 2DMIA 5AE2A 2B3TB 1A1KA 2RPCA 2EQ1A 2YPNA 2WCC3 2WZOA 4F54A 4DR6E 1SFEA 2EN4A 4WPYA 2YSPA 1X6FA 2D9HA 2NABA 1BB8A 4B3ME 1ZR9A 4JI1E 2YU5A 3EPJA
chains in the Genus database with same CATH topology
2LJHA 3ADIA 1WHQA 3RMPA 2RS6A 2V8QB 2N3GA 2N3HA 2L33A 3P1XA 1GZ6A 4M30A 3JTZA 1FKAE 4LFBE 4M2ZA 4DV2E 2L3JA 3J7Yp 1IBME 4P78A 2L8TA 2UXBE 4GEQB 3LLHA 1YYKA 2B9DA 2YZTA 1YYOA 2L3CA 4X8WA 4OOGC 4OX9E 4BBYA 1HNWE 4R8OA 4YHHE 4JYAE 2JOXA 2L2NA 1J26A 3ADGA 4JI2E 2E1MA 4DR7E 2JY9A 2F8BA 2F4VE 5DNYA 2UXDE 2JVAA 1O0WA 3AUZA 3C4BA 2JR1A 1RC7A 2KONA 2UXCE 4R03A 4AQYE 2LUPB 5AE3A 2FV4B 3J80C 4NXME 2LE2A 5BR8E 4DV7E 3DF6A 2KHXA 2DMYA 3VYYA 4BMJA 2V87A 1WXRA 4JI5E 5LMUE 4LF9E 2G7HA 4TUIA 4LFAE 1PKPA 2MC5A 4JI0E 3IWBA 4YY3E 5ADZA 3H09A 1YYWA 4F9CB 3VK6A 4LF7E 4JI7E 4GKKE 5LL6R 2CPNA 4DR4E 2LTSA 2UUAE 5IWAE 2RSMA 4JI8E 2RS7A 1IBKE 1FJGE 2V86A 2NUFA 1XNRE 4Q28A 3ZOQB 2M4IA 2VQFE 2B7VA 2V88A 4WSPA 2YT4A 2V89A 1QU6A 2MDRA 2VF1A 3OMLA 3T1HE 1HR0E 4JI4E 2L92A 4DR3E 4P7DA 1IBLE 2MC6A 1ZBTA 3FIGA 1YZ9A 4GKJE 3KWRA 4X66E 3ADLA 2VE7C 4LTYA 4L5NC 1UHZA 2E5LE 1DQ3A 4DMIA 4DV5E 2M1SA 2DSYA 4BC9A 4DR5E 2ODRD 1HNZE 2M7QA 5AE1A 4I8OA 3MSWA 1STUA 3HTXA 4BS9A 4WYQB 2V85A 2B7TA 4F9BB 3IWDA 4X64E 2UUCE 2DB2A 3LMLA 3JAMC 2ODRC 5LMNE 4LF5E 2FGGA 5A2QC 4DV6E 4JI6E 1GQEA 4DV0E 4L8NA 4DR1E 1WHNA 3AV0A 1ZBQA 3HXLA 3F6GA 2L2KB 3ADJA 1X49A 2EWLA 1N34E 1X47A 3DJWA 5CFFE 4J8ZA 2LUQA 5IT9C 3JU0A 2LMZA 4LU9A 4BCAA 2DIXA 5AASA 4DR2E 5F3WA 4F9AB 2HHHE 2UU9E 4LF4E 4KZSA 2NUEA 1N33E 2LBSB 2K4VA 2LTRA 1EKZA 4JV5E 2JOBA 4JI3E 4B3SE 4TUGA 2NUGA 2LRSA 1I94E 1RQ0A 2V83A 4DUZE 1T4LB 5FLXC 4DV4E 3IWCA 3F6HA 4WFTA 4M0VA 3HPZA 3C4TA 1J5EE 2RTXA 4NXNE 4DV3E 3J81C 4LF8E 1DI2A 3T1YE 3HPSA 2FTXB 2L2MA 4X62E 4DUYE 4LFCE 1XMQE 3VYXA 1T4NA 5AE2A 2KOUA 2EZ6A 2B3TB 2ZM6E 4B3RE 4BC7A 3J7AG 2JWOA 2IHR1 3HQ1A 1XNQE 2UUBE 2WZOA 4LF6E 1T4OA 2VQEE 1N36E 4B3TE 4F54A 4DR6E 2L6MA 3OTOE 5T6JA 4WPYA 2H36X 1HNXE 4DV1E 3K6QA 2NA2A 1SR9A 4DKKA 4K0KE 4KHPE 1N32E 1UILA 4B3ME 1XMOE 4X65E 4JI1E 1X48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOQ B;  4L5N C;  2LE2 A; 
#chains in the Genus database with same CATH topology
 4WXD A;  3ADI A;  4R2A A;  2YTP A;  1WHQ A;  2YTN A;  3RMP A;  2N3G A;  4O4K A;  2L33 A;  3P1X A;  1GZ6 A;  2E72 A;  4WXC A;  4M30 A;  2EN2 A;  4DV2 E;  4P78 A;  4GEQ B;  1YYK A;  2EPZ A;  1YYO A;  2EQ0 A;  4RHB B;  2WBT A;  4IS1 C;  2EMB A;  2JOX A;  3ADG A;  2F4V E;  5DNY A;  3EPH A;  2JVA A;  2EMZ A;  2EPO A;  4R03 A;  2UXC E;  4AQY E;  5BR8 E;  2EOF A;  5KL7 A;  2KHX A;  2K7I A;  4ZYE A;  4BMJ A;  2V87 A;  1WXR A;  4WX9 A;  2YRH A;  5IV8 B;  1PKP A;  3IWB A;  4F9C B;  5A6K A;  4LF7 E;  4X9J A;  1G2F C;  2YTI A;  3MHH C;  5IWA E;  2RSM A;  4JI8 E;  2V86 A;  1F2I G;  2B7V A;  2EM0 A;  2V88 A;  2VF1 A;  3OML A;  2MDR A;  4N4R B;  2L92 A;  4DR3 E;  4P7D A;  3FIG A;  2HGH A;  1JK1 A;  4GKJ E;  3KWR A;  5AC5 A;  1Z1B A;  2VE7 C;  4L5N C;  4GZN C;  4DMI A;  4DV5 E;  2EM4 A;  2MKD A;  4DR5 E;  2ODR D;  4I8O A;  3MSW A;  2EMC A;  4RH8 A;  4O5G A;  4WYQ B;  2V85 A;  2B7T A;  4X64 E;  5LMN E;  2ODR C;  4DV0 E;  2YRK A;  1ZBQ A;  3HXL A;  1WRJ A;  5AC4 A;  5LLQ A;  3DJW A;  3ECR A;  4LU9 A;  4BCA A;  5F3W A;  2UU9 E;  4LF4 E;  1TF3 A;  2NUE A;  2LT7 A;  4F6N A;  1AAY A;  1EKZ A;  4JV5 E;  2N8X A;  4JI3 E;  4B3S E;  2EML A;  5A6A A;  2EPU A;  2NUG A;  2LRS A;  1I94 E;  2V83 A;  4DUZ E;  4DV4 E;  3IWC A;  3HPZ A;  4DV3 E;  1DI2 A;  2EM3 A;  4LFC E;  2L2M A;  4X62 E;  1T4N A;  2KOU A;  1EH7 A;  5IXM B;  4B3R E;  2JWO A;  2IHR 1;  1XNQ E;  4LF6 E;  1N36 E;  2EL4 A;  1MGT A;  2EMG A;  3K6Q A;  4DKK A;  1UIL A;  2EM8 A;  5KL5 A;  4LFB E;  1IBM E;  2L3J A;  1NCS A;  1YUI A;  2EMW A;  2YZT A;  1L4S A;  2YTO A;  2M9A A;  3M99 B;  2YRM A;  5A6B A;  4OX9 E;  1HNW E;  1A1L A;  4JYA E;  4MLQ A;  4JI2 E;  3C6K A;  1LLM C;  2A25 A;  4O43 A;  2EMH A;  3AUZ A;  2JR1 A;  1RC7 A;  5AE3 A;  2FV4 B;  4NXM E;  1AH5 A;  2EOQ A;  2YU8 A;  4WSG A;  3MHS C;  2LJU A;  3VYY A;  3C6M A;  4R2Q A;  3KZZ A;  2ELY A;  2EOJ A;  3VK6 A;  4M9V C;  4ZYG A;  2VRD A;  1IBK E;  1WJP A;  2VQF E;  4F2J C;  3TQM A;  2V89 A;  1YUJ A;  1HR0 E;  2EQ3 A;  2YTD A;  4JI4 E;  1ZAA C;  2YTE A;  2EM6 A;  1NEI A;  5KL6 A;  5AE1 A;  2R76 A;  4F9B B;  5A6J A;  2UUC E;  1KYQ A;  2DB2 A;  2YWQ A;  1A1H A;  3JAM C;  4JI6 E;  1GQE A;  4DR1 E;  1PJT A;  4R2E A;  2L2K B;  3F6G A;  3ADJ A;  2YTG A;  5CFF E;  2EMK A;  4J8Z A;  1TF6 A;  3JU0 A;  2HHH E;  5AAS A;  4F9A B;  1N33 E;  2LBS B;  2WBS A;  5KL3 A;  2LTR A;  4TUG A;  1UN6 B;  3EPL A;  1T4L B;  4R2D A;  3THN A;  2EJ4 A;  4ZYH A;  4DUY E;  2EL5 A;  1EH6 A;  2JP9 A;  2DLQ A;  2EPL X;  2ZM6 E;  3HQ1 A;  2UUB E;  2JYA A;  2VQE E;  4B3T E;  1UBD C;  5T6J A;  2EOH A;  4KWY A;  2EMY A;  1GTK A;  2H36 X;  1HNX E;  4KHP E;  2EOS A;  2YSO A;  1N32 E;  4X65 E;  2DRP A;  1A1J A;  1X48 A;  2WBU A;  1X6H A;  1YSA C;  2V8Q B;  2Q8U A;  3VHT B;  1ZU1 A;  5KL4 A;  4R2S A;  2EM2 A;  1FKA E;  4M2Z A;  3J7Y p;  2JXP A;  2EE8 A;  1RMD A;  1T39 A;  2B9D A;  1EH8 A;  4X8W A;  3BGH A;  2LV2 A;  4BBY A;  4R8O A;  1T38 A;  1QNT A;  2EP3 A;  2L2N A;  2LO3 A;  4DR7 E;  2JY9 A;  3EPK A;  2ADR A;  5A6B D;  3C4B A;  3BF2 A;  2KON A;  1A1F A;  2GPI A;  2LE2 A;  4MLV A;  3DF6 A;  2EOM A;  5LMU E;  4LF9 E;  1YFH A;  4LFA E;  2MC5 A;  2GLI A;  4YY3 E;  2EOE A;  2EPP A;  1YYW A;  2YTJ A;  4JI7 E;  4GKK E;  2I13 A;  5LL6 R;  2CPN A;  4DR4 E;  2LTS A;  2UUA E;  2RS7 A;  4R2C A;  1MEY C;  1FJG E;  3ZOQ B;  2M4I A;  2PRT A;  4WSP A;  3QG5 C;  2YT4 A;  1QU6 A;  1IBL E;  2MC6 A;  1YZ9 A;  2HC5 A;  2J7J A;  3ADL A;  2E5L E;  4LTY A;  1UHZ A;  4IJD A;  2M1S A;  2DSY A;  4BC9 A;  5TSE A;  3HTX A;  1STU A;  1B69 A;  1TN9 A;  3IWD A;  1BBG A;  2EMI A;  4NHR A;  1IQS A;  4LF5 E;  2JPA A;  2FGG A;  5A2Q C;  4NZV A;  2CTD A;  4ZYD A;  2EMA A;  2EWL A;  1N34 E;  1X47 A;  2EOR A;  2DLK A;  2EOY A;  1KJK A;  5IT9 C;  2ENH A;  2LMZ A;  4DR2 E;  4BHB A;  2RSI A;  4KZS A;  1PDA A;  2K4V A;  2BB8 A;  1DGC A;  1JK2 A;  2EN6 A;  1X3C A;  2JOB A;  1PJQ A;  2EMX A;  1X5W A;  2YTF A;  5FLX C;  2EOO A;  4WFT A;  1BBO A;  3C4T A;  1J5E E;  3J81 C;  1N3G A;  2EMF A;  3T1Y E;  2FTX B;  3VYX A;  2EPN A;  1XMQ E;  2EZ6 A;  1X6E A;  4BC7 A;  3J7A G;  2GHF A;  1T4O A;  2L6M A;  3OTO E;  2DGC A;  4DV1 E;  1A1G A;  2NA2 A;  1SR9 A;  4K0K E;  1PJS A;  2EN1 A;  1XMO E;  3BBG A;  2LJH A;  2RS6 A;  1IQO A;  2N3H A;  2I9I A;  3JTZ A;  4FK5 C;  2L8T A;  2UXB E;  1YPN A;  2CT1 A;  3UK3 C;  3LLH A;  2L3C A;  2EPK X;  2EPM X;  4OOG C;  4YHH E;  1J26 A;  2E1M A;  3KZY A;  2F8B A;  4R2R A;  2UXD E;  2EM5 A;  1O0W A;  3EQ1 A;  2LUP B;  3J80 C;  2EL6 A;  4DV7 E;  2EPC A;  2EPA A;  2EOZ A;  2BBG A;  2DMY A;  4JI5 E;  2G7H A;  4O24 A;  4TUI A;  4JI0 E;  2MDG A;  5ADZ A;  3H09 A;  2ENC A;  2EOX A;  4R2P A;  2NUF A;  1XNR E;  4Q28 A;  4F6M A;  2R1F A;  3T1H E;  1ZBT A;  2EN8 A;  2ENA A;  4X66 E;  1DQ3 A;  4HEI A;  2EM7 A;  1P47 A;  1HNZ E;  2M7Q A;  4BS9 A;  2LCE A;  2EN7 A;  2EPX A;  3LML A;  4Q35 B;  4DV6 E;  4L8N A;  5A69 A;  1WHN A;  3AV0 A;  1IMU A;  1X49 A;  1G2D C;  2LUQ A;  1A1I A;  2CSH A;  2DIX A;  4HTG A;  3THO B;  2HJJ A;  2YTQ A;  2EOI A;  2RQL A;  3BID A;  2MKN A;  1RQ0 A;  3L00 A;  4BHC A;  2ELZ A;  3F6H A;  2EM9 A;  4M0V A;  5KL2 A;  2EN3 A;  2RTX A;  4NXN E;  4LF8 E;  2EPR A;  3HPS A;  2LVH A;  2DMI A;  5AE2 A;  2B3T B;  1A1K A;  2RPC A;  2EQ1 A;  2YPN A;  2WCC 3;  2WZO A;  4F54 A;  4DR6 E;  1SFE A;  2EN4 A;  4WPY A;  2YSP A;  1X6F A;  2D9H A;  2NAB A;  1BB8 A;  4B3M E;  1ZR9 A;  4JI1 E;  2YU5 A;  3EPJ A; 
#chains in the Genus database with same CATH homology
 2LJH A;  3ADI A;  1WHQ A;  3RMP A;  2RS6 A;  2V8Q B;  2N3G A;  2N3H A;  2L33 A;  3P1X A;  1GZ6 A;  4M30 A;  3JTZ A;  1FKA E;  4LFB E;  4M2Z A;  4DV2 E;  2L3J A;  3J7Y p;  1IBM E;  4P78 A;  2L8T A;  2UXB E;  4GEQ B;  3LLH A;  1YYK A;  2B9D A;  2YZT A;  1YYO A;  2L3C A;  4X8W A;  4OOG C;  4OX9 E;  4BBY A;  1HNW E;  4R8O A;  4YHH E;  4JYA E;  2JOX A;  2L2N A;  1J26 A;  3ADG A;  4JI2 E;  2E1M A;  4DR7 E;  2JY9 A;  2F8B A;  2F4V E;  5DNY A;  2UXD E;  2JVA A;  1O0W A;  3AUZ A;  3C4B A;  2JR1 A;  1RC7 A;  2KON A;  2UXC E;  4R03 A;  4AQY E;  2LUP B;  5AE3 A;  2FV4 B;  3J80 C;  4NXM E;  2LE2 A;  5BR8 E;  4DV7 E;  3DF6 A;  2KHX A;  2DMY A;  3VYY A;  4BMJ A;  2V87 A;  1WXR A;  4JI5 E;  5LMU E;  4LF9 E;  2G7H A;  4TUI A;  4LFA E;  1PKP A;  2MC5 A;  4JI0 E;  3IWB A;  4YY3 E;  5ADZ A;  3H09 A;  1YYW A;  4F9C B;  3VK6 A;  4LF7 E;  4JI7 E;  4GKK E;  5LL6 R;  2CPN A;  4DR4 E;  2LTS A;  2UUA E;  5IWA E;  2RSM A;  4JI8 E;  2RS7 A;  1IBK E;  1FJG E;  2V86 A;  2NUF A;  1XNR E;  4Q28 A;  3ZOQ B;  2M4I A;  2VQF E;  2B7V A;  2V88 A;  4WSP A;  2YT4 A;  2V89 A;  1QU6 A;  2MDR A;  2VF1 A;  3OML A;  3T1H E;  1HR0 E;  4JI4 E;  2L92 A;  4DR3 E;  4P7D A;  1IBL E;  2MC6 A;  1ZBT A;  3FIG A;  1YZ9 A;  4GKJ E;  3KWR A;  4X66 E;  3ADL A;  2VE7 C;  4LTY A;  4L5N C;  1UHZ A;  2E5L E;  1DQ3 A;  4DMI A;  4DV5 E;  2M1S A;  2DSY A;  4BC9 A;  4DR5 E;  2ODR D;  1HNZ E;  2M7Q A;  5AE1 A;  4I8O A;  3MSW A;  1STU A;  3HTX A;  4BS9 A;  4WYQ B;  2V85 A;  2B7T A;  4F9B B;  3IWD A;  4X64 E;  2UUC E;  2DB2 A;  3LML A;  3JAM C;  2ODR C;  5LMN E;  4LF5 E;  2FGG A;  5A2Q C;  4DV6 E;  4JI6 E;  1GQE A;  4DV0 E;  4L8N A;  4DR1 E;  1WHN A;  3AV0 A;  1ZBQ A;  3HXL A;  3F6G A;  2L2K B;  3ADJ A;  1X49 A;  2EWL A;  1N34 E;  1X47 A;  3DJW A;  5CFF E;  4J8Z A;  2LUQ A;  5IT9 C;  3JU0 A;  2LMZ A;  4LU9 A;  4BCA A;  2DIX A;  5AAS A;  4DR2 E;  5F3W A;  4F9A B;  2HHH E;  2UU9 E;  4LF4 E;  4KZS A;  2NUE A;  1N33 E;  2LBS B;  2K4V A;  2LTR A;  1EKZ A;  4JV5 E;  2JOB A;  4JI3 E;  4B3S E;  4TUG A;  2NUG A;  2LRS A;  1I94 E;  1RQ0 A;  2V83 A;  4DUZ E;  1T4L B;  5FLX C;  4DV4 E;  3IWC A;  3F6H A;  4WFT A;  4M0V A;  3HPZ A;  3C4T A;  1J5E E;  2RTX A;  4NXN E;  4DV3 E;  3J81 C;  4LF8 E;  1DI2 A;  3T1Y E;  3HPS A;  2FTX B;  2L2M A;  4X62 E;  4DUY E;  4LFC E;  1XMQ E;  3VYX A;  1T4N A;  5AE2 A;  2KOU A;  2EZ6 A;  2B3T B;  2ZM6 E;  4B3R E;  4BC7 A;  3J7A G;  2JWO A;  2IHR 1;  3HQ1 A;  1XNQ E;  2UUB E;  2WZO A;  4LF6 E;  1T4O A;  2VQE E;  1N36 E;  4B3T E;  4F54 A;  4DR6 E;  2L6M A;  3OTO E;  5T6J A;  4WPY A;  2H36 X;  1HNX E;  4DV1 E;  3K6Q A;  2NA2 A;  1SR9 A;  4DKK A;  4K0K E;  4KHP E;  1N32 E;  1UIL A;  4B3M E;  1XMO E;  4X65 E;  4JI1 E;  1X48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...