2LE2A

Novel dimeric structure of phage phi29-encoded protein p56: insights into uracil-dna glycosylase inhibition
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'MVQNDFVDSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P56
publication title Novel dimeric structure of phage 29-encoded protein p56: insights into uracil-DNA glycosylase inhibition.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Hydrolase inhibitor
total genus 8
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2le2A00
4L5NC 3ZOQB 2LE2A
chains in the Genus database with same CATH superfamily
2J7JA 1NCSA 1BBGA 4R2QA 2LBSB 2IHR1 2L3JA 3BBGA 3J7AG 2EMFA 1A1GA 3KZZA 3UK3C 1GQEA 5KL3A 2RSIA 4LU9A 2V83A 3THNA 1YSAC 3HPSA 3JTZA 4LF6E 2K7IA 2YU5A 5DNYA 2E72A 2DB2A 4P78A 4MLQA 2EMXA 2RQLA 4LTYA 1DGCA 2EOMA 4DUYE 4LF7E 2EMAA 2LCEA 4JI5E 5LLQA 1G2DC 2DIXA 1WJPA 2EL4A 2LUPB 3THOB 2LJHA 5BR8E 2UU9E 2CT1A 2EPCA 2EQ3A 3C4BA 4BC7A 4NXNE 1IQOA 3EPJA 3IWBA 2KHXA 4DR5E 4DR7E 5AASA 1UBDC 2E5LE 2N3HA 4WSPA 2JYAA 4X62E 2UUBE 3J81C 2EM7A 1JK2A 2NUGA 2CSHA 2E1MA 1F2IG 2H36X 1YYOA 1YZ9A 4LFBE 5IV8B 1AH5A 2HJJA 3ADJA 4K0KE 5A6JA 2HGHA 2EOQA 2LUQA 1Z1BA 4JI3E 1T4LB 3DF6A 1SFEA 3MSWA 2DSYA 2YTEA 5KL6A 1X6HA 4L8NA 1X6FA 3VYXA 3HXLA 2YPNA 1XNRE 4R03A 3HTXA 2RPCA 4JV5E 2EM5A 2EPKX 2EWLA 3BF2A 3T1HE 2EMYA 4F2JC 4M30A 1UHZA 4AQYE 4F9CB 1HNZE 2MC6A 4YY3E 2L6MA 2UXCE 4IJDA 2EOFA 2F4VE 5IXMB 2L92A 2VQEE 4WXDA 1X5WA 5LMUE 2L2MA 2UXBE 2G7HA 1PJQA 4WSGA 2DMYA 5KL5A 2WBSA 2YTDA 2BB8A 1GZ6A 2B7VA 2EMGA 2EM6A 4O4KA 1DI2A 3F6GA 4X8WA 2M1SA 2EQ0A 4X65E 3VYYA 2WZOA 1X3CA 4F54A 3IWDA 4JI4E 2VQFE 4DUZE 1T38A 4M2ZA 2UUAE 4DMIA 4R2PA 2YT4A 4M9VC 2EL6A 3VK6A 4GEQB 1LLMC 1UILA 2EN3A 4JI6E 4DV5E 2YWQA 1TF6A 1XMOE 1QU6A 4KZSA 4KWYA 4L5NC 4Q35B 2I9IA 2WBUA 1KYQA 2EM0A 2DLKA 3AUZA 1X6EA 4BHBA 1TF3A 4BHCA 2JOBA 2EN4A 4LF4E 1WRJA 4R2AA 2EMWA 2PRTA 5AC5A 2YRKA 1T39A 2F8BA 1P47A 2EPLX 4WXCA 2L3CA 2ODRD 2UXDE 4F6NA 2EMBA 1X48A 4RHBB 2RSMA 4M0VA 1O0WA 2LRSA 1N3GA 2ODRC 2EM3A 2EOSA 1YPNA 2NA2A 1XMQE 1PDAA 4X64E 4O24A 4DV3E 2A25A 1RMDA 2M4IA 5F3WA 3RMPA 2N8XA 1WHQA 1T4NA 3C6MA 1J26A 1N33E 3EQ1A 2D9HA 2B3TB 2EPRA 4ZYDA 1YYKA 2YSPA 3L00A 4BC9A 5KL4A 2DMIA 2YTOA 3EPHA 4JI8E 1B69A 2EOJA 3F6HA 5A6AA 2LO3A 1N34E 4B3TE 4B3SE 4KHPE 2EOOA 1ZR9A 5CFFE 4LF8E 4WFTA 2EPZA 2JWOA 2MDRA 2EPPA 2YTFA 2VRDA 2EE8A 2L8TA 1PJTA 2KOUA 2EOIA 2RTXA 4LFAE 2EP3A 4LF5E 4DV2E 4LF9E 2JY9A 1ZAAC 2EN6A 2YTPA 4DV6E 2LVHA 2EMIA 2YSOA 2K4VA 3ECRA 2YZTA 4R2DA 2YTIA 2B9DA 4JI0E 4R2EA 2V85A 2L33A 3QG5C 4R8OA 4Q28A 4RH8A 4JI2E 1A1HA 3MHHC 2EOXA 2B7TA 1EH6A 2EMLA 1X49A 4DR1E 2KONA 1ZBTA 1G2FC 2EOHA 1FJGE 2CPNA 3M99B 2ELZA 2VE7C 1WXRA 1N36E 1ZBQA 2RS7A 2LTSA 5IT9C 1A1JA 1UN6B 2EMHA 2EOYA 4TUGA 4R2RA 3EPLA 4R2CA 4NZVA 2ENHA 2LMZA 2N3GA 2M7QA 4TUIA 2FTXB 2JOXA 4JI1E 2GHFA 2V89A 3JU0A 4BCAA 4JYAE 4BMJA 4GKKE 2MKDA 1IBLE 1HNWE 1MEYC 1X47A 1YYWA 4N4RB 2DLQA 2UUCE 3MHSC 4F9BB 5T6JA 4LFCE 2MC5A 3T1YE 1MGTA 3HPZA 3LLHA 2GPIA 3KWRA 1STUA 3J7Yp 1IMUA 4DKKA 2LTRA 3K6QA 1HR0E 2EM9A 2EPOA 1N32E 1EH8A 2ADRA 4DR3E 1A1KA 2YRHA 2NUFA 2YTJA 4F6MA 2V87A 2R1FA 1ZU1A 1PJSA 3KZYA 4X9JA 2HC5A 4J8ZA 1DQ3A 4BBYA 2V86A 1YUIA 4B3ME 2EPAA 2WBTA 1AAYA 4ZYHA 2ENAA 2GLIA 1SR9A 1EH7A 2YTGA 5FLXC 2M9AA 1JK1A 4DR4E 5KL2A 4GZNC 2L2KB 2WCC3 2EN8A 2EN1A 2JP9A 1QNTA 2EZ6A 4YHHE 2NABA 3C6KA 2EJ4A 3LMLA 1YFHA 2YRMA 1A1LA 1YUJA 1IQSA 4HEIA 4JI7E 2DGCA 2LJUA 2EQ1A 1T4OA 1HNXE 3J80C 3ADLA 4DR6E 1L4SA 2EPMX 3DJWA 2EN2A 2L2NA 4OX9E 4DR2E 4IS1C 3C4TA 1EKZA 2EMZA 4F9AB 1BBOA 4R2SA 5AC4A 3EPKA 2LE2A 2EORA 2LV2A 2R76A 2FV4B 3AV0A 5ADZA 3OTOE 2RS6A 1A1FA 4O43A 4DV0E 3HQ1A 1KJKA 3P1XA 5A69A 4B3RE 1IBME 3TQMA 4WPYA 2YTNA 5A6BD 2V88A 2NUEA 2ELYA 2EOEA 4BS9A 2EPXA 2YU8A 2ENCA 2V8QB 1TN9A 2JPAA 4ZYGA 1RC7A 2MDGA 4WX9A 3ZOQB 2CTDA 2EMCA 4WYQB 2FGGA 2MKNA 2EM2A 1J5EE 2EM4A 2JVAA 5TSEA 3OMLA 2Q8UA 4O5GA 1PKPA 1A1IA 3BIDA 5A6BA 5A6KA 4GKJE 1GTKA 4DV7E 3VHTB 2HHHE 5LL6R 1IBKE 1FKAE 2EM8A 4X66E 5AE3A 4NHRA 5IWAE 1WHNA 1XNQE 2LT7A 5A2QC 2EMKA 2EOZA 2EPNA 3ADGA 3IWCA 1I94E 3ADIA 5KL7A 4I8OA 4P7DA 5LMNE 4FK5C 4HTGA 1RQ0A 2BBGA 2DRPA 3FIGA 4DV4E 2JXPA 4DV1E 2VF1A 2ZM6E 2YTQA 1BB8A 3H09A 1NEIA 2EL5A 2EN7A 3JAMC 3BGHA 4NXME 4ZYEA 2I13A 2JR1A 5AE1A 4MLVA 4OOGC 5AE2A 2EPUA
chains in the Genus database with same CATH topology
2RTXA 2EZ6A 4YHHE 2LBSB 4LFAE 2IHR1 4X65E 2L3JA 3J7AG 3VYYA 3LMLA 4LF5E 2WZOA 1GQEA 4DV2E 4LU9A 2JY9A 4LF9E 2V83A 4F54A 3HPSA 3IWDA 4DV6E 3JTZA 4JI7E 4JI4E 4LF6E 2VQFE 1T4OA 1HNXE 3J80C 5DNYA 2K4VA 4DUZE 2DB2A 4P78A 4M2ZA 2YZTA 3ADLA 4DR6E 2UUAE 4DMIA 2YT4A 4LTYA 3VK6A 4GEQB 2B9DA 4JI0E 2KOUA 3DJWA 2V85A 1UILA 2L33A 2L2NA 4DUYE 4R8OA 4Q28A 4DV5E 4JI5E 4JI6E 4LF7E 4DR2E 4JI2E 4OX9E 1XMOE 1QU6A 2B7TA 2DIXA 2LUPB 3C4TA 4KZSA 1EKZA 4L5NC 1X49A 4F9AB 4DR1E 2UU9E 2KONA 2LJHA 5BR8E 1ZBTA 1FJGE 2CPNA 3AUZA 3C4BA 4BC7A 4NXNE 2VE7C 2LE2A 3IWBA 2KHXA 2JOBA 2FV4B 3AV0A 1ZBQA 2RS7A 2LTSA 2RS6A 5ADZA 5AASA 1WXRA 3OTOE 4DR5E 5IT9C 4DV0E 2E5LE 2N3HA 4LF4E 4TUGA 3HQ1A 4WSPA 4X62E 3P1XA 2UUBE 4B3RE 3J81C 1IBME 2NUGA 2F8BA 2LMZA 4WPYA 2E1MA 2N3GA 2H36X 2M7QA 4TUIA 1YYOA 1YZ9A 2FTXB 2L3CA 2V88A 2NUEA 2JOXA 2ODRD 4JI1E 4LFBE 3JU0A 2V89A 4BS9A 2UXDE 1X48A 3ADJA 4BCAA 2RSMA 4M0VA 4JYAE 4BMJA 1O0WA 4K0KE 2V8QB 2LRSA 4GKKE 2LUQA 1IBLE 4JI3E 1T4LB 1HNWE 2ODRC 3DF6A 1RC7A 3MSWA 2DSYA 1X47A 2NA2A 3ZOQB 1YYWA 4L8NA 2UUCE 1XMQE 3VYXA 4F9BB 3HXLA 4WYQB 2FGGA 4X64E 4GKJE 1J5EE 5T6JA 1XNRE 2JVAA 4LFCE 2MC5A 3OMLA 3F6GA 4R03A 4DV3E 3T1YE 1N36E 3HTXA 4JV5E 2M4IA 5F3WA 1PKPA 2EWLA 3HPZA 3LLHA 3RMPA 3KWRA 1WHQA 1STUA 3J7Yp 3T1HE 4DKKA 1T4NA 2LTRA 3K6QA 4DV7E 1HR0E 2HHHE 1J26A 1N33E 4M30A 1UHZA 4AQYE 5LL6R 4F9CB 1IBKE 1FKAE 2MC6A 1HNZE 2B3TB 4X66E 4YY3E 5AE3A 1N32E 4DR7E 5IWAE 2L6MA 4DR3E 1WHNA 1YYKA 2UXCE 2F4VE 2NUFA 1XNQE 4BC9A 5A2QC 2V87A 4JI8E 2L92A 2VQEE 3ADGA 3IWCA 1I94E 3F6HA 3ADIA 4I8OA 4P7DA 5LMNE 4J8ZA 5LMUE 1DQ3A 2L2MA 1RQ0A 2V86A 4BBYA 2G7HA 2UXBE 1N34E 3FIGA 4B3ME 4DV4E 4B3TE 4DV1E 2VF1A 2ZM6E 2DMYA 3H09A 4B3SE 1SR9A 4KHPE 5FLXC 3JAMC 5CFFE 4LF8E 4DR4E 4NXME 1GZ6A 2B7VA 4WFTA 2L2KB 2JR1A 5AE1A 5AE2A 2JWOA 4OOGC 2MDRA 1DI2A 2L8TA 4X8WA 2M1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5N C;  3ZOQ B;  2LE2 A; 
#chains in the Genus database with same CATH topology
 2J7J A;  1NCS A;  1BBG A;  4R2Q A;  2LBS B;  2IHR 1;  2L3J A;  3BBG A;  3J7A G;  2EMF A;  1A1G A;  3KZZ A;  3UK3 C;  1GQE A;  5KL3 A;  2RSI A;  4LU9 A;  2V83 A;  3THN A;  1YSA C;  3HPS A;  3JTZ A;  4LF6 E;  2K7I A;  2YU5 A;  5DNY A;  2E72 A;  2DB2 A;  4P78 A;  4MLQ A;  2EMX A;  2RQL A;  4LTY A;  1DGC A;  2EOM A;  4DUY E;  4LF7 E;  2EMA A;  2LCE A;  4JI5 E;  5LLQ A;  1G2D C;  2DIX A;  1WJP A;  2EL4 A;  2LUP B;  3THO B;  2LJH A;  5BR8 E;  2UU9 E;  2CT1 A;  2EPC A;  2EQ3 A;  3C4B A;  4BC7 A;  4NXN E;  1IQO A;  3EPJ A;  3IWB A;  2KHX A;  4DR5 E;  4DR7 E;  5AAS A;  1UBD C;  2E5L E;  2N3H A;  4WSP A;  2JYA A;  4X62 E;  2UUB E;  3J81 C;  2EM7 A;  1JK2 A;  2NUG A;  2CSH A;  2E1M A;  1F2I G;  2H36 X;  1YYO A;  1YZ9 A;  4LFB E;  5IV8 B;  1AH5 A;  2HJJ A;  3ADJ A;  4K0K E;  5A6J A;  2HGH A;  2EOQ A;  2LUQ A;  1Z1B A;  4JI3 E;  1T4L B;  3DF6 A;  1SFE A;  3MSW A;  2DSY A;  2YTE A;  5KL6 A;  1X6H A;  4L8N A;  1X6F A;  3VYX A;  3HXL A;  2YPN A;  1XNR E;  4R03 A;  3HTX A;  2RPC A;  4JV5 E;  2EM5 A;  2EPK X;  2EWL A;  3BF2 A;  3T1H E;  2EMY A;  4F2J C;  4M30 A;  1UHZ A;  4AQY E;  4F9C B;  1HNZ E;  2MC6 A;  4YY3 E;  2L6M A;  2UXC E;  4IJD A;  2EOF A;  2F4V E;  5IXM B;  2L92 A;  2VQE E;  4WXD A;  1X5W A;  5LMU E;  2L2M A;  2UXB E;  2G7H A;  1PJQ A;  4WSG A;  2DMY A;  5KL5 A;  2WBS A;  2YTD A;  2BB8 A;  1GZ6 A;  2B7V A;  2EMG A;  2EM6 A;  4O4K A;  1DI2 A;  3F6G A;  4X8W A;  2M1S A;  2EQ0 A;  4X65 E;  3VYY A;  2WZO A;  1X3C A;  4F54 A;  3IWD A;  4JI4 E;  2VQF E;  4DUZ E;  1T38 A;  4M2Z A;  2UUA E;  4DMI A;  4R2P A;  2YT4 A;  4M9V C;  2EL6 A;  3VK6 A;  4GEQ B;  1LLM C;  1UIL A;  2EN3 A;  4JI6 E;  4DV5 E;  2YWQ A;  1TF6 A;  1XMO E;  1QU6 A;  4KZS A;  4KWY A;  4L5N C;  4Q35 B;  2I9I A;  2WBU A;  1KYQ A;  2EM0 A;  2DLK A;  3AUZ A;  1X6E A;  4BHB A;  1TF3 A;  4BHC A;  2JOB A;  2EN4 A;  4LF4 E;  1WRJ A;  4R2A A;  2EMW A;  2PRT A;  5AC5 A;  2YRK A;  1T39 A;  2F8B A;  1P47 A;  2EPL X;  4WXC A;  2L3C A;  2ODR D;  2UXD E;  4F6N A;  2EMB A;  1X48 A;  4RHB B;  2RSM A;  4M0V A;  1O0W A;  2LRS A;  1N3G A;  2ODR C;  2EM3 A;  2EOS A;  1YPN A;  2NA2 A;  1XMQ E;  1PDA A;  4X64 E;  4O24 A;  4DV3 E;  2A25 A;  1RMD A;  2M4I A;  5F3W A;  3RMP A;  2N8X A;  1WHQ A;  1T4N A;  3C6M A;  1J26 A;  1N33 E;  3EQ1 A;  2D9H A;  2B3T B;  2EPR A;  4ZYD A;  1YYK A;  2YSP A;  3L00 A;  4BC9 A;  5KL4 A;  2DMI A;  2YTO A;  3EPH A;  4JI8 E;  1B69 A;  2EOJ A;  3F6H A;  5A6A A;  2LO3 A;  1N34 E;  4B3T E;  4B3S E;  4KHP E;  2EOO A;  1ZR9 A;  5CFF E;  4LF8 E;  4WFT A;  2EPZ A;  2JWO A;  2MDR A;  2EPP A;  2YTF A;  2VRD A;  2EE8 A;  2L8T A;  1PJT A;  2KOU A;  2EOI A;  2RTX A;  4LFA E;  2EP3 A;  4LF5 E;  4DV2 E;  4LF9 E;  2JY9 A;  1ZAA C;  2EN6 A;  2YTP A;  4DV6 E;  2LVH A;  2EMI A;  2YSO A;  2K4V A;  3ECR A;  2YZT A;  4R2D A;  2YTI A;  2B9D A;  4JI0 E;  4R2E A;  2V85 A;  2L33 A;  3QG5 C;  4R8O A;  4Q28 A;  4RH8 A;  4JI2 E;  1A1H A;  3MHH C;  2EOX A;  2B7T A;  1EH6 A;  2EML A;  1X49 A;  4DR1 E;  2KON A;  1ZBT A;  1G2F C;  2EOH A;  1FJG E;  2CPN A;  3M99 B;  2ELZ A;  2VE7 C;  1WXR A;  1N36 E;  1ZBQ A;  2RS7 A;  2LTS A;  5IT9 C;  1A1J A;  1UN6 B;  2EMH A;  2EOY A;  4TUG A;  4R2R A;  3EPL A;  4R2C A;  4NZV A;  2ENH A;  2LMZ A;  2N3G A;  2M7Q A;  4TUI A;  2FTX B;  2JOX A;  4JI1 E;  2GHF A;  2V89 A;  3JU0 A;  4BCA A;  4JYA E;  4BMJ A;  4GKK E;  2MKD A;  1IBL E;  1HNW E;  1MEY C;  1X47 A;  1YYW A;  4N4R B;  2DLQ A;  2UUC E;  3MHS C;  4F9B B;  5T6J A;  4LFC E;  2MC5 A;  3T1Y E;  1MGT A;  3HPZ A;  3LLH A;  2GPI A;  3KWR A;  1STU A;  3J7Y p;  1IMU A;  4DKK A;  2LTR A;  3K6Q A;  1HR0 E;  2EM9 A;  2EPO A;  1N32 E;  1EH8 A;  2ADR A;  4DR3 E;  1A1K A;  2YRH A;  2NUF A;  2YTJ A;  4F6M A;  2V87 A;  2R1F A;  1ZU1 A;  1PJS A;  3KZY A;  4X9J A;  2HC5 A;  4J8Z A;  1DQ3 A;  4BBY A;  2V86 A;  1YUI A;  4B3M E;  2EPA A;  2WBT A;  1AAY A;  4ZYH A;  2ENA A;  2GLI A;  1SR9 A;  1EH7 A;  2YTG A;  5FLX C;  2M9A A;  1JK1 A;  4DR4 E;  5KL2 A;  4GZN C;  2L2K B;  2WCC 3;  2EN8 A;  2EN1 A;  2JP9 A;  1QNT A;  2EZ6 A;  4YHH E;  2NAB A;  3C6K A;  2EJ4 A;  3LML A;  1YFH A;  2YRM A;  1A1L A;  1YUJ A;  1IQS A;  4HEI A;  4JI7 E;  2DGC A;  2LJU A;  2EQ1 A;  1T4O A;  1HNX E;  3J80 C;  3ADL A;  4DR6 E;  1L4S A;  2EPM X;  3DJW A;  2EN2 A;  2L2N A;  4OX9 E;  4DR2 E;  4IS1 C;  3C4T A;  1EKZ A;  2EMZ A;  4F9A B;  1BBO A;  4R2S A;  5AC4 A;  3EPK A;  2LE2 A;  2EOR A;  2LV2 A;  2R76 A;  2FV4 B;  3AV0 A;  5ADZ A;  3OTO E;  2RS6 A;  1A1F A;  4O43 A;  4DV0 E;  3HQ1 A;  1KJK A;  3P1X A;  5A69 A;  4B3R E;  1IBM E;  3TQM A;  4WPY A;  2YTN A;  5A6B D;  2V88 A;  2NUE A;  2ELY A;  2EOE A;  4BS9 A;  2EPX A;  2YU8 A;  2ENC A;  2V8Q B;  1TN9 A;  2JPA A;  4ZYG A;  1RC7 A;  2MDG A;  4WX9 A;  3ZOQ B;  2CTD A;  2EMC A;  4WYQ B;  2FGG A;  2MKN A;  2EM2 A;  1J5E E;  2EM4 A;  2JVA A;  5TSE A;  3OML A;  2Q8U A;  4O5G A;  1PKP A;  1A1I A;  3BID A;  5A6B A;  5A6K A;  4GKJ E;  1GTK A;  4DV7 E;  3VHT B;  2HHH E;  5LL6 R;  1IBK E;  1FKA E;  2EM8 A;  4X66 E;  5AE3 A;  4NHR A;  5IWA E;  1WHN A;  1XNQ E;  2LT7 A;  5A2Q C;  2EMK A;  2EOZ A;  2EPN A;  3ADG A;  3IWC A;  1I94 E;  3ADI A;  5KL7 A;  4I8O A;  4P7D A;  5LMN E;  4FK5 C;  4HTG A;  1RQ0 A;  2BBG A;  2DRP A;  3FIG A;  4DV4 E;  2JXP A;  4DV1 E;  2VF1 A;  2ZM6 E;  2YTQ A;  1BB8 A;  3H09 A;  1NEI A;  2EL5 A;  2EN7 A;  3JAM C;  3BGH A;  4NXM E;  4ZYE A;  2I13 A;  2JR1 A;  5AE1 A;  4MLV A;  4OOG C;  5AE2 A;  2EPU A; 
#chains in the Genus database with same CATH homology
 2RTX A;  2EZ6 A;  4YHH E;  2LBS B;  4LFA E;  2IHR 1;  4X65 E;  2L3J A;  3J7A G;  3VYY A;  3LML A;  4LF5 E;  2WZO A;  1GQE A;  4DV2 E;  4LU9 A;  2JY9 A;  4LF9 E;  2V83 A;  4F54 A;  3HPS A;  3IWD A;  4DV6 E;  3JTZ A;  4JI7 E;  4JI4 E;  4LF6 E;  2VQF E;  1T4O A;  1HNX E;  3J80 C;  5DNY A;  2K4V A;  4DUZ E;  2DB2 A;  4P78 A;  4M2Z A;  2YZT A;  3ADL A;  4DR6 E;  2UUA E;  4DMI A;  2YT4 A;  4LTY A;  3VK6 A;  4GEQ B;  2B9D A;  4JI0 E;  2KOU A;  3DJW A;  2V85 A;  1UIL A;  2L33 A;  2L2N A;  4DUY E;  4R8O A;  4Q28 A;  4DV5 E;  4JI5 E;  4JI6 E;  4LF7 E;  4DR2 E;  4JI2 E;  4OX9 E;  1XMO E;  1QU6 A;  2B7T A;  2DIX A;  2LUP B;  3C4T A;  4KZS A;  1EKZ A;  4L5N C;  1X49 A;  4F9A B;  4DR1 E;  2UU9 E;  2KON A;  2LJH A;  5BR8 E;  1ZBT A;  1FJG E;  2CPN A;  3AUZ A;  3C4B A;  4BC7 A;  4NXN E;  2VE7 C;  2LE2 A;  3IWB A;  2KHX A;  2JOB A;  2FV4 B;  3AV0 A;  1ZBQ A;  2RS7 A;  2LTS A;  2RS6 A;  5ADZ A;  5AAS A;  1WXR A;  3OTO E;  4DR5 E;  5IT9 C;  4DV0 E;  2E5L E;  2N3H A;  4LF4 E;  4TUG A;  3HQ1 A;  4WSP A;  4X62 E;  3P1X A;  2UUB E;  4B3R E;  3J81 C;  1IBM E;  2NUG A;  2F8B A;  2LMZ A;  4WPY A;  2E1M A;  2N3G A;  2H36 X;  2M7Q A;  4TUI A;  1YYO A;  1YZ9 A;  2FTX B;  2L3C A;  2V88 A;  2NUE A;  2JOX A;  2ODR D;  4JI1 E;  4LFB E;  3JU0 A;  2V89 A;  4BS9 A;  2UXD E;  1X48 A;  3ADJ A;  4BCA A;  2RSM A;  4M0V A;  4JYA E;  4BMJ A;  1O0W A;  4K0K E;  2V8Q B;  2LRS A;  4GKK E;  2LUQ A;  1IBL E;  4JI3 E;  1T4L B;  1HNW E;  2ODR C;  3DF6 A;  1RC7 A;  3MSW A;  2DSY A;  1X47 A;  2NA2 A;  3ZOQ B;  1YYW A;  4L8N A;  2UUC E;  1XMQ E;  3VYX A;  4F9B B;  3HXL A;  4WYQ B;  2FGG A;  4X64 E;  4GKJ E;  1J5E E;  5T6J A;  1XNR E;  2JVA A;  4LFC E;  2MC5 A;  3OML A;  3F6G A;  4R03 A;  4DV3 E;  3T1Y E;  1N36 E;  3HTX A;  4JV5 E;  2M4I A;  5F3W A;  1PKP A;  2EWL A;  3HPZ A;  3LLH A;  3RMP A;  3KWR A;  1WHQ A;  1STU A;  3J7Y p;  3T1H E;  4DKK A;  1T4N A;  2LTR A;  3K6Q A;  4DV7 E;  1HR0 E;  2HHH E;  1J26 A;  1N33 E;  4M30 A;  1UHZ A;  4AQY E;  5LL6 R;  4F9C B;  1IBK E;  1FKA E;  2MC6 A;  1HNZ E;  2B3T B;  4X66 E;  4YY3 E;  5AE3 A;  1N32 E;  4DR7 E;  5IWA E;  2L6M A;  4DR3 E;  1WHN A;  1YYK A;  2UXC E;  2F4V E;  2NUF A;  1XNQ E;  4BC9 A;  5A2Q C;  2V87 A;  4JI8 E;  2L92 A;  2VQE E;  3ADG A;  3IWC A;  1I94 E;  3F6H A;  3ADI A;  4I8O A;  4P7D A;  5LMN E;  4J8Z A;  5LMU E;  1DQ3 A;  2L2M A;  1RQ0 A;  2V86 A;  4BBY A;  2G7H A;  2UXB E;  1N34 E;  3FIG A;  4B3M E;  4DV4 E;  4B3T E;  4DV1 E;  2VF1 A;  2ZM6 E;  2DMY A;  3H09 A;  4B3S E;  1SR9 A;  4KHP E;  5FLX C;  3JAM C;  5CFF E;  4LF8 E;  4DR4 E;  4NXM E;  1GZ6 A;  2B7V A;  4WFT A;  2L2K B;  2JR1 A;  5AE1 A;  5AE2 A;  2JWO A;  4OOG C;  2MDR A;  1DI2 A;  2L8T A;  4X8W A;  2M1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...