2EN6A

Solution structure of the c2h2 type zinc finger (region 887-919) of human zinc finger protein 268
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGSGEKPYGCNECGKTFSQKSILSAHQRTHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 887-919) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en6A01
2EL5A 2EOZA 2LCEA 2EMGA 4F6MA 2EN1A 2ADRA 2WCC3 2NABA 2MDGA 1Z1BA 2BB8A 2YTJA 2YU5A 5KL5A 2EORA 2YTQA 1TF6A 2EN2A 2EOHA 4R2EA 1B69A 1RMDA 2EL4A 2EPCA 2YSOA 2DMIA 2EM5A 2E72A 2EMAA 4IS1C 5KL2A 1DGCA 1UN6B 2EOXA 4R2RA 2EOEA 1MEYC 2EM2A 2EOYA 2EOQA 2EMCA 2EN8A 2YTOA 4R2CA 2EMYA 1ZAAC 5KL4A 2YTPA 2WBUA 1X3CA 2EOFA 4GZNC 1X5WA 1NCSA 5KL7A 4M9VC 2EPXA 2YRHA 4R2PA 3M99B 2EMWA 4WSGA 1X6HA 2ENAA 1G2DC 2VRDA 2EQ0A 2RPCA 2YTIA 3VHTB 2EN4A 2LVHA 4R2QA 4R2SA 2EPUA 1ZR9A 2DLKA 2EPAA 2LV2A 3MHSC 2PRTA 5KL6A 3EPKA 3EPJA 2EN6A 3MHHC 2DRPA 1YUIA 2YTGA 2EM0A 1JK2A 2CT1A 2MKDA 1A1KA 2ELYA 2EM6A 2EMXA 2EJ4A 1F2IG 4FK5C 1YUJA 2EM8A 4F2JC 2EMFA 2EMZA 4X9JA 2HGHA 2CTDA 2EQ1A 1A1IA 2JP9A 2EN3A 2LT7A 2EOOA 2MKNA 2EOJA 1TF3A 2WBSA 1JK1A 2DGCA 3EPLA 2YTNA 2YSPA 1LLMC 2DLQA 2EPPA 1BB8A 2D9HA 2EP3A 5KL3A 2EPRA 2EM9A 2GHFA 3UK3C 4R2DA 2ELZA 1X6FA 2EMLA 2EPZA 1P47A 2EM4A 2CSHA 2J7JA 2EMHA 1A1JA 1AAYA 2EMIA 2EM7A 2EOSA 2EMKA 2YRKA 1ZU1A 2ENCA 1G2FC 2RSIA 1A1GA 2I13A 2EL6A 1TN9A 2EM3A 1A1LA 2YTFA 3EPHA 2A25A 1BBOA 2GLIA 4F6NA 2ENHA 1X6EA 2EMBA 2YU8A 2EQ3A 2WBTA 2EOMA 1WJPA 2YTDA 2EOIA 1KJKA 2YRMA 1UBDC 4R2AA 2LO3A 1A1HA 2EN7A 2JPAA 2EE8A 2R1FA 2M9AA 4IJDA 2YTEA 1YSAC 1A1FA
chains in the Genus database with same CATH superfamily
4JI7E 2LMZA 3JAMC 3LLHA 2EN1A 5T6JA 3THOB 2YTQA 3T1YE 4DV1E 2UXDE 4WSPA 4LF9E 4DR1E 2YSOA 2DMIA 5FLXC 2EMAA 2JVAA 1EKZA 1UN6B 4DR5E 1MEYC 2ODRD 4B3RE 1YYWA 2NUEA 2L33A 4KZSA 1ZBTA 4RH8A 2B7VA 2EOFA 1X5WA 5LL6R 2VF1A 2YRHA 2RS7A 4R2PA 3M99B 2LTRA 2VE7C 4TUIA 2ENAA 5BR8E 2EQ0A 2YTIA 2UUBE 2L3JA 2EPAA 5LMNE 4F54A 3EPJA 3MHHC 4JI5E 1KYQA 2M4IA 3ADIA 2MKDA 1BBGA 1A1KA 1F2IG 4KWYA 4DR3E 4B3ME 1RQ0A 2EWLA 2EMZA 4M2ZA 1YYOA 3K6QA 2JXPA 3IWDA 4TUGA 4DV4E 5IWAE 2EOJA 4LU9A 1TF3A 2WBSA 4DR4E 1SFEA 5IV8B 1LLMC 4X66E 4JV5E 4LFCE 1BB8A 2EPRA 2DSYA 4R2DA 1YYKA 4BCAA 2EPZA 1UHZA 2EM4A 4R03A 2J7JA 4DUYE 2UXBE 2EMKA 1L4SA 4DV5E 1G2FC 3MSWA 1A1GA 1A1LA 3F6GA 1BBOA 5A6KA 4JYAE 4RHBB 2EOMA 1PKPA 2YTDA 4DV7E 3BF2A 1MGTA 1T4OA 2FV4B 4NHRA 1UBDC 1A1HA 2VQEE 2JPAA 2VQFE 4M0VA 3C4BA 2M9AA 4DMIA 2NUGA 4IJDA 2UXCE 2LUQA 1YSAC 1X48A 4X65E 2V88A 1WXRA 4B3SE 1N3GA 3EQ1A 2EL5A 2LCEA 3VYXA 3T1HE 2WCC3 2NABA 1STUA 5A6JA 2YTJA 2YU5A 2F4VE 2JYAA 3H09A 2L2MA 2EN2A 4R2EA 2YWQA 1B69A 2RQLA 1HNXE 2F8BA 4GEQB 1EH8A 3OTOE 2E72A 2HHHE 5KL2A 1DGCA 3DJWA 4NXME 3IWCA 4WYQB 2EOYA 2ZM6E 1DQ3A 2YTOA 1ZAAC 2FTXB 3THNA 2YTPA 2CPNA 4BMJA 2WBUA 2UU9E 1X3CA 4WXCA 4MLVA 1J26A 2EMWA 4LF8E 4GKKE 2ODRC 1G2DC 2VRDA 2V89A 1O0WA 2LVHA 3HPSA 4R2SA 4X62E 1ZR9A 4DV2E 5IXMB 5KL6A 5IT9C 2EN6A 1QU6A 2YTGA 1JK2A 4BC7A 4YHHE 2K7IA 2EM6A 2EJ4A 2K4VA 2FGGA 2EPNA 3BIDA 2UUCE 3ADLA 1HR0E 1HNWE 2HC5A 4X9JA 1XNQE 4JI2E 2JP9A 2EN3A 5ADZA 2EOOA 2B3TB 2MKNA 2L3CA 2DGCA 4WPYA 1AH5A 5AE2A 2YSPA 2DLQA 2V83A 2EPPA 3LMLA 2EP3A 4NXNE 2YZTA 1X6FA 4R8OA 2EMLA 5DNYA 4JI4E 1P47A 1YPNA 5A2QC 2Q8UA 2EMIA 2LE2A 2YRKA 5LMUE 2I13A 2EL6A 2EM3A 5A6BD 1PDAA 3EPHA 2UUAE 4OOGC 3JTZA 5TSEA 3ADJA 1WJPA 4WX9A 2YRMA 1X47A 4R2AA 2L6MA 2R76A 4JI3E 1N33E 1PJSA 2NA2A 1XMOE 4F9BB 4DV3E 1IBME 4LTYA 4O43A 4LF6E 4N4RB 2MC5A 1N34E 2LRSA 2MDRA 2L2KB 2EMGA 1T4NA 1WHNA 2MDGA 2JR1A 1PJQA 3J7Yp 3JU0A 4L5NC 1RMDA 2EPCA 3IWBA 4Q28A 2EM5A 3J7AG 3C6MA 1XMQE 2B7TA 4X8WA 4LF7E 4P7DA 4BC9A 4R2RA 2N3GA 4BS9A 2EMCA 2EN8A 2NUFA 2YPNA 4R2CA 4P78A 1T38A 2L92A 1IBLE 1NCSA 2E1MA 2HJJA 2DMYA 4DR2E 4KHPE 2EPXA 1N36E 2YT4A 1NEIA 3P1XA 4WSGA 1X6HA 3KZZA 2RPCA 5A69A 3L00A 4R2QA 4O24A 2EPUA 1YZ9A 2G7HA 5A6BA 2DLKA 2LV2A 4YY3E 3MHSC 2LUPB 1WRJA 4AQYE 4HTGA 1QNTA 5AC4A 5A6AA 1YUIA 4M30A 5AE1A 2CT1A 4OX9E 4WXDA 4FK5C 1YUJA 2EM8A 2WZOA 3FIGA 2CTDA 2JOBA 2LT7A 1EH6A 3KZYA 3ZOQB 3HXLA 4BHCA 2LJUA 4GKJE 1IQSA 2YTNA 3VYYA 1UILA 2D9HA 5KL3A 4BBYA 2GHFA 2LBSB 4DV0E 2DB2A 2EMHA 2N8XA 5F3WA 4LFBE 4DV6E 2EM7A 2EOSA 5AASA 1PJTA 2RSIA 4BHBA 4JI0E 1T39A 1X6EA 2EMBA 2YU8A 2WBTA 3TQMA 1KJKA 2EPKX 2EN7A 1DI2A 2DIXA 2KOUA 2LJHA 4LF4E 3HTXA 2KHXA 4L8NA 1XNRE 1T4LB 3KWRA 4F9CB 3F6HA 1X49A 1YFHA 1RC7A 1WHQA 2EOZA 4DUZE 4DR7E 1FJGE 1ZBQA 4F6MA 2ADRA 2JY9A 1Z1BA 1I94E 2BB8A 5KL5A 2EORA 1TF6A 1GZ6A 2EOHA 4I8OA 2EPOA 2EPLX 2EL4A 3HPZA 4IS1C 2JWOA 3AV0A 2EOXA 2EOEA 2EM2A 3OMLA 5AE3A 2EOQA 2LTSA 2EMYA 4ZYGA 5KL4A 1GQEA 4J8ZA 1SR9A 1HNZE 4GZNC 5KL7A 2I9IA 4M9VC 4Q35B 2H36X 4B3TE 1GTKA 2GPIA 1IMUA 3VK6A 1J5EE 4JI6E 3VHTB 2EN4A 3RMPA 2KONA 4LF5E 2PRTA 5CFFE 5LLQA 3EPKA 2DRPA 2M7QA 2EM0A 2B9DA 2M1SA 2RTXA 3DF6A 2ELYA 2EMXA 4WFTA 4ZYHA 1EH7A 4F2JC 2EMFA 2V87A 2MC6A 4K0KE 4X64E 2HGHA 2EQ1A 3QG5C 1A1IA 4ZYEA 2BBGA 2L8TA 4NZVA 4DKKA 5AC5A 1JK1A 3EPLA 3J80C 2V8QB 3BGHA 2RS6A 4O5GA 3AUZA 3UK3C 2EM9A 2JOXA 2ELZA 2RSMA 3BBGA 1FKAE 3ECRA 2L2NA 2CSHA 1A1JA 1AAYA 4ZYDA 1N32E 4HEIA 4JI8E 4O4KA 4DR6E 1ZU1A 2EZ6A 2ENCA 2E5LE 3J81C 1IBKE 1TN9A 2YTFA 2A25A 2GLIA 4F6NA 2ENHA 4JI1E 2EQ3A 3HQ1A 3C4TA 2EOIA 2N3HA 2IHR1 4MLQA 2LO3A 3ADGA 2V85A 2EE8A 2R1FA 2YTEA 4LFAE 2EPMX 2V86A 3C6KA 1A1FA 4F9AB 1IQOA
chains in the Genus database with same CATH topology
2EL5A 2EOZA 2LCEA 2EMGA 4F6MA 2EN1A 2ADRA 2WCC3 2NABA 2MDGA 1Z1BA 2BB8A 2YTJA 2YU5A 5KL5A 2EORA 2YTQA 1TF6A 2EN2A 2EOHA 4R2EA 1B69A 1RMDA 2EL4A 2EPCA 2YSOA 2DMIA 2EM5A 2E72A 2EMAA 4IS1C 5KL2A 1DGCA 1UN6B 2EOXA 4R2RA 2EOEA 1MEYC 2EM2A 2EOYA 2EOQA 2EMCA 2EN8A 2YTOA 4R2CA 2EMYA 1ZAAC 5KL4A 2YTPA 2WBUA 1X3CA 2EOFA 4GZNC 1X5WA 1NCSA 5KL7A 4M9VC 2EPXA 2YRHA 4R2PA 3M99B 2EMWA 4WSGA 1X6HA 2ENAA 1G2DC 2VRDA 2EQ0A 2RPCA 2YTIA 3VHTB 2EN4A 2LVHA 4R2QA 4R2SA 2EPUA 1ZR9A 2DLKA 2EPAA 2LV2A 3MHSC 2PRTA 5KL6A 3EPKA 3EPJA 2EN6A 3MHHC 2DRPA 1YUIA 2YTGA 2EM0A 1JK2A 2CT1A 2MKDA 1A1KA 2ELYA 2EM6A 2EMXA 2EJ4A 1F2IG 4FK5C 1YUJA 2EM8A 4F2JC 2EMFA 2EMZA 4X9JA 2HGHA 2CTDA 2EQ1A 1A1IA 2JP9A 2EN3A 2LT7A 2EOOA 2MKNA 2EOJA 1TF3A 2WBSA 1JK1A 2DGCA 3EPLA 2YTNA 2YSPA 1LLMC 2DLQA 2EPPA 1BB8A 2D9HA 2EP3A 5KL3A 2EPRA 2EM9A 2GHFA 3UK3C 4R2DA 2ELZA 1X6FA 2EMLA 2EPZA 1P47A 2EM4A 2CSHA 2J7JA 2EMHA 1A1JA 1AAYA 2EMIA 2EM7A 2EOSA 2EMKA 2YRKA 1ZU1A 2ENCA 1G2FC 2RSIA 1A1GA 2I13A 2EL6A 1TN9A 2EM3A 1A1LA 2YTFA 3EPHA 2A25A 1BBOA 2GLIA 4F6NA 2ENHA 1X6EA 2EMBA 2YU8A 2EQ3A 2WBTA 2EOMA 1WJPA 2YTDA 2EOIA 1KJKA 2YRMA 1UBDC 4R2AA 2LO3A 1A1HA 2EN7A 2JPAA 2EE8A 2R1FA 2M9AA 4IJDA 2YTEA 1YSAC 1A1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL5 A;  2EOZ A;  2LCE A;  2EMG A;  4F6M A;  2EN1 A;  2ADR A;  2WCC 3;  2NAB A;  2MDG A;  1Z1B A;  2BB8 A;  2YTJ A;  2YU5 A;  5KL5 A;  2EOR A;  2YTQ A;  1TF6 A;  2EN2 A;  2EOH A;  4R2E A;  1B69 A;  1RMD A;  2EL4 A;  2EPC A;  2YSO A;  2DMI A;  2EM5 A;  2E72 A;  2EMA A;  4IS1 C;  5KL2 A;  1DGC A;  1UN6 B;  2EOX A;  4R2R A;  2EOE A;  1MEY C;  2EM2 A;  2EOY A;  2EOQ A;  2EMC A;  2EN8 A;  2YTO A;  4R2C A;  2EMY A;  1ZAA C;  5KL4 A;  2YTP A;  2WBU A;  1X3C A;  2EOF A;  4GZN C;  1X5W A;  1NCS A;  5KL7 A;  4M9V C;  2EPX A;  2YRH A;  4R2P A;  3M99 B;  2EMW A;  4WSG A;  1X6H A;  2ENA A;  1G2D C;  2VRD A;  2EQ0 A;  2RPC A;  2YTI A;  3VHT B;  2EN4 A;  2LVH A;  4R2Q A;  4R2S A;  2EPU A;  1ZR9 A;  2DLK A;  2EPA A;  2LV2 A;  3MHS C;  2PRT A;  5KL6 A;  3EPK A;  3EPJ A;  2EN6 A;  3MHH C;  2DRP A;  1YUI A;  2YTG A;  2EM0 A;  1JK2 A;  2CT1 A;  2MKD A;  1A1K A;  2ELY A;  2EM6 A;  2EMX A;  2EJ4 A;  1F2I G;  4FK5 C;  1YUJ A;  2EM8 A;  4F2J C;  2EMF A;  2EMZ A;  4X9J A;  2HGH A;  2CTD A;  2EQ1 A;  1A1I A;  2JP9 A;  2EN3 A;  2LT7 A;  2EOO A;  2MKN A;  2EOJ A;  1TF3 A;  2WBS A;  1JK1 A;  2DGC A;  3EPL A;  2YTN A;  2YSP A;  1LLM C;  2DLQ A;  2EPP A;  1BB8 A;  2D9H A;  2EP3 A;  5KL3 A;  2EPR A;  2EM9 A;  2GHF A;  3UK3 C;  4R2D A;  2ELZ A;  1X6F A;  2EML A;  2EPZ A;  1P47 A;  2EM4 A;  2CSH A;  2J7J A;  2EMH A;  1A1J A;  1AAY A;  2EMI A;  2EM7 A;  2EOS A;  2EMK A;  2YRK A;  1ZU1 A;  2ENC A;  1G2F C;  2RSI A;  1A1G A;  2I13 A;  2EL6 A;  1TN9 A;  2EM3 A;  1A1L A;  2YTF A;  3EPH A;  2A25 A;  1BBO A;  2GLI A;  4F6N A;  2ENH A;  1X6E A;  2EMB A;  2YU8 A;  2EQ3 A;  2WBT A;  2EOM A;  1WJP A;  2YTD A;  2EOI A;  1KJK A;  2YRM A;  1UBD C;  4R2A A;  2LO3 A;  1A1H A;  2EN7 A;  2JPA A;  2EE8 A;  2R1F A;  2M9A A;  4IJD A;  2YTE A;  1YSA C;  1A1F A; 
#chains in the Genus database with same CATH topology
 4JI7 E;  2LMZ A;  3JAM C;  3LLH A;  2EN1 A;  5T6J A;  3THO B;  2YTQ A;  3T1Y E;  4DV1 E;  2UXD E;  4WSP A;  4LF9 E;  4DR1 E;  2YSO A;  2DMI A;  5FLX C;  2EMA A;  2JVA A;  1EKZ A;  1UN6 B;  4DR5 E;  1MEY C;  2ODR D;  4B3R E;  1YYW A;  2NUE A;  2L33 A;  4KZS A;  1ZBT A;  4RH8 A;  2B7V A;  2EOF A;  1X5W A;  5LL6 R;  2VF1 A;  2YRH A;  2RS7 A;  4R2P A;  3M99 B;  2LTR A;  2VE7 C;  4TUI A;  2ENA A;  5BR8 E;  2EQ0 A;  2YTI A;  2UUB E;  2L3J A;  2EPA A;  5LMN E;  4F54 A;  3EPJ A;  3MHH C;  4JI5 E;  1KYQ A;  2M4I A;  3ADI A;  2MKD A;  1BBG A;  1A1K A;  1F2I G;  4KWY A;  4DR3 E;  4B3M E;  1RQ0 A;  2EWL A;  2EMZ A;  4M2Z A;  1YYO A;  3K6Q A;  2JXP A;  3IWD A;  4TUG A;  4DV4 E;  5IWA E;  2EOJ A;  4LU9 A;  1TF3 A;  2WBS A;  4DR4 E;  1SFE A;  5IV8 B;  1LLM C;  4X66 E;  4JV5 E;  4LFC E;  1BB8 A;  2EPR A;  2DSY A;  4R2D A;  1YYK A;  4BCA A;  2EPZ A;  1UHZ A;  2EM4 A;  4R03 A;  2J7J A;  4DUY E;  2UXB E;  2EMK A;  1L4S A;  4DV5 E;  1G2F C;  3MSW A;  1A1G A;  1A1L A;  3F6G A;  1BBO A;  5A6K A;  4JYA E;  4RHB B;  2EOM A;  1PKP A;  2YTD A;  4DV7 E;  3BF2 A;  1MGT A;  1T4O A;  2FV4 B;  4NHR A;  1UBD C;  1A1H A;  2VQE E;  2JPA A;  2VQF E;  4M0V A;  3C4B A;  2M9A A;  4DMI A;  2NUG A;  4IJD A;  2UXC E;  2LUQ A;  1YSA C;  1X48 A;  4X65 E;  2V88 A;  1WXR A;  4B3S E;  1N3G A;  3EQ1 A;  2EL5 A;  2LCE A;  3VYX A;  3T1H E;  2WCC 3;  2NAB A;  1STU A;  5A6J A;  2YTJ A;  2YU5 A;  2F4V E;  2JYA A;  3H09 A;  2L2M A;  2EN2 A;  4R2E A;  2YWQ A;  1B69 A;  2RQL A;  1HNX E;  2F8B A;  4GEQ B;  1EH8 A;  3OTO E;  2E72 A;  2HHH E;  5KL2 A;  1DGC A;  3DJW A;  4NXM E;  3IWC A;  4WYQ B;  2EOY A;  2ZM6 E;  1DQ3 A;  2YTO A;  1ZAA C;  2FTX B;  3THN A;  2YTP A;  2CPN A;  4BMJ A;  2WBU A;  2UU9 E;  1X3C A;  4WXC A;  4MLV A;  1J26 A;  2EMW A;  4LF8 E;  4GKK E;  2ODR C;  1G2D C;  2VRD A;  2V89 A;  1O0W A;  2LVH A;  3HPS A;  4R2S A;  4X62 E;  1ZR9 A;  4DV2 E;  5IXM B;  5KL6 A;  5IT9 C;  2EN6 A;  1QU6 A;  2YTG A;  1JK2 A;  4BC7 A;  4YHH E;  2K7I A;  2EM6 A;  2EJ4 A;  2K4V A;  2FGG A;  2EPN A;  3BID A;  2UUC E;  3ADL A;  1HR0 E;  1HNW E;  2HC5 A;  4X9J A;  1XNQ E;  4JI2 E;  2JP9 A;  2EN3 A;  5ADZ A;  2EOO A;  2B3T B;  2MKN A;  2L3C A;  2DGC A;  4WPY A;  1AH5 A;  5AE2 A;  2YSP A;  2DLQ A;  2V83 A;  2EPP A;  3LML A;  2EP3 A;  4NXN E;  2YZT A;  1X6F A;  4R8O A;  2EML A;  5DNY A;  4JI4 E;  1P47 A;  1YPN A;  5A2Q C;  2Q8U A;  2EMI A;  2LE2 A;  2YRK A;  5LMU E;  2I13 A;  2EL6 A;  2EM3 A;  5A6B D;  1PDA A;  3EPH A;  2UUA E;  4OOG C;  3JTZ A;  5TSE A;  3ADJ A;  1WJP A;  4WX9 A;  2YRM A;  1X47 A;  4R2A A;  2L6M A;  2R76 A;  4JI3 E;  1N33 E;  1PJS A;  2NA2 A;  1XMO E;  4F9B B;  4DV3 E;  1IBM E;  4LTY A;  4O43 A;  4LF6 E;  4N4R B;  2MC5 A;  1N34 E;  2LRS A;  2MDR A;  2L2K B;  2EMG A;  1T4N A;  1WHN A;  2MDG A;  2JR1 A;  1PJQ A;  3J7Y p;  3JU0 A;  4L5N C;  1RMD A;  2EPC A;  3IWB A;  4Q28 A;  2EM5 A;  3J7A G;  3C6M A;  1XMQ E;  2B7T A;  4X8W A;  4LF7 E;  4P7D A;  4BC9 A;  4R2R A;  2N3G A;  4BS9 A;  2EMC A;  2EN8 A;  2NUF A;  2YPN A;  4R2C A;  4P78 A;  1T38 A;  2L92 A;  1IBL E;  1NCS A;  2E1M A;  2HJJ A;  2DMY A;  4DR2 E;  4KHP E;  2EPX A;  1N36 E;  2YT4 A;  1NEI A;  3P1X A;  4WSG A;  1X6H A;  3KZZ A;  2RPC A;  5A69 A;  3L00 A;  4R2Q A;  4O24 A;  2EPU A;  1YZ9 A;  2G7H A;  5A6B A;  2DLK A;  2LV2 A;  4YY3 E;  3MHS C;  2LUP B;  1WRJ A;  4AQY E;  4HTG A;  1QNT A;  5AC4 A;  5A6A A;  1YUI A;  4M30 A;  5AE1 A;  2CT1 A;  4OX9 E;  4WXD A;  4FK5 C;  1YUJ A;  2EM8 A;  2WZO A;  3FIG A;  2CTD A;  2JOB A;  2LT7 A;  1EH6 A;  3KZY A;  3ZOQ B;  3HXL A;  4BHC A;  2LJU A;  4GKJ E;  1IQS A;  2YTN A;  3VYY A;  1UIL A;  2D9H A;  5KL3 A;  4BBY A;  2GHF A;  2LBS B;  4DV0 E;  2DB2 A;  2EMH A;  2N8X A;  5F3W A;  4LFB E;  4DV6 E;  2EM7 A;  2EOS A;  5AAS A;  1PJT A;  2RSI A;  4BHB A;  4JI0 E;  1T39 A;  1X6E A;  2EMB A;  2YU8 A;  2WBT A;  3TQM A;  1KJK A;  2EPK X;  2EN7 A;  1DI2 A;  2DIX A;  2KOU A;  2LJH A;  4LF4 E;  3HTX A;  2KHX A;  4L8N A;  1XNR E;  1T4L B;  3KWR A;  4F9C B;  3F6H A;  1X49 A;  1YFH A;  1RC7 A;  1WHQ A;  2EOZ A;  4DUZ E;  4DR7 E;  1FJG E;  1ZBQ A;  4F6M A;  2ADR A;  2JY9 A;  1Z1B A;  1I94 E;  2BB8 A;  5KL5 A;  2EOR A;  1TF6 A;  1GZ6 A;  2EOH A;  4I8O A;  2EPO A;  2EPL X;  2EL4 A;  3HPZ A;  4IS1 C;  2JWO A;  3AV0 A;  2EOX A;  2EOE A;  2EM2 A;  3OML A;  5AE3 A;  2EOQ A;  2LTS A;  2EMY A;  4ZYG A;  5KL4 A;  1GQE A;  4J8Z A;  1SR9 A;  1HNZ E;  4GZN C;  5KL7 A;  2I9I A;  4M9V C;  4Q35 B;  2H36 X;  4B3T E;  1GTK A;  2GPI A;  1IMU A;  3VK6 A;  1J5E E;  4JI6 E;  3VHT B;  2EN4 A;  3RMP A;  2KON A;  4LF5 E;  2PRT A;  5CFF E;  5LLQ A;  3EPK A;  2DRP A;  2M7Q A;  2EM0 A;  2B9D A;  2M1S A;  2RTX A;  3DF6 A;  2ELY A;  2EMX A;  4WFT A;  4ZYH A;  1EH7 A;  4F2J C;  2EMF A;  2V87 A;  2MC6 A;  4K0K E;  4X64 E;  2HGH A;  2EQ1 A;  3QG5 C;  1A1I A;  4ZYE A;  2BBG A;  2L8T A;  4NZV A;  4DKK A;  5AC5 A;  1JK1 A;  3EPL A;  3J80 C;  2V8Q B;  3BGH A;  2RS6 A;  4O5G A;  3AUZ A;  3UK3 C;  2EM9 A;  2JOX A;  2ELZ A;  2RSM A;  3BBG A;  1FKA E;  3ECR A;  2L2N A;  2CSH A;  1A1J A;  1AAY A;  4ZYD A;  1N32 E;  4HEI A;  4JI8 E;  4O4K A;  4DR6 E;  1ZU1 A;  2EZ6 A;  2ENC A;  2E5L E;  3J81 C;  1IBK E;  1TN9 A;  2YTF A;  2A25 A;  2GLI A;  4F6N A;  2ENH A;  4JI1 E;  2EQ3 A;  3HQ1 A;  3C4T A;  2EOI A;  2N3H A;  2IHR 1;  4MLQ A;  2LO3 A;  3ADG A;  2V85 A;  2EE8 A;  2R1F A;  2YTE A;  4LFA E;  2EPM X;  2V86 A;  3C6K A;  1A1F A;  4F9A B;  1IQO A; 
#chains in the Genus database with same CATH homology
 2EL5 A;  2EOZ A;  2LCE A;  2EMG A;  4F6M A;  2EN1 A;  2ADR A;  2WCC 3;  2NAB A;  2MDG A;  1Z1B A;  2BB8 A;  2YTJ A;  2YU5 A;  5KL5 A;  2EOR A;  2YTQ A;  1TF6 A;  2EN2 A;  2EOH A;  4R2E A;  1B69 A;  1RMD A;  2EL4 A;  2EPC A;  2YSO A;  2DMI A;  2EM5 A;  2E72 A;  2EMA A;  4IS1 C;  5KL2 A;  1DGC A;  1UN6 B;  2EOX A;  4R2R A;  2EOE A;  1MEY C;  2EM2 A;  2EOY A;  2EOQ A;  2EMC A;  2EN8 A;  2YTO A;  4R2C A;  2EMY A;  1ZAA C;  5KL4 A;  2YTP A;  2WBU A;  1X3C A;  2EOF A;  4GZN C;  1X5W A;  1NCS A;  5KL7 A;  4M9V C;  2EPX A;  2YRH A;  4R2P A;  3M99 B;  2EMW A;  4WSG A;  1X6H A;  2ENA A;  1G2D C;  2VRD A;  2EQ0 A;  2RPC A;  2YTI A;  3VHT B;  2EN4 A;  2LVH A;  4R2Q A;  4R2S A;  2EPU A;  1ZR9 A;  2DLK A;  2EPA A;  2LV2 A;  3MHS C;  2PRT A;  5KL6 A;  3EPK A;  3EPJ A;  2EN6 A;  3MHH C;  2DRP A;  1YUI A;  2YTG A;  2EM0 A;  1JK2 A;  2CT1 A;  2MKD A;  1A1K A;  2ELY A;  2EM6 A;  2EMX A;  2EJ4 A;  1F2I G;  4FK5 C;  1YUJ A;  2EM8 A;  4F2J C;  2EMF A;  2EMZ A;  4X9J A;  2HGH A;  2CTD A;  2EQ1 A;  1A1I A;  2JP9 A;  2EN3 A;  2LT7 A;  2EOO A;  2MKN A;  2EOJ A;  1TF3 A;  2WBS A;  1JK1 A;  2DGC A;  3EPL A;  2YTN A;  2YSP A;  1LLM C;  2DLQ A;  2EPP A;  1BB8 A;  2D9H A;  2EP3 A;  5KL3 A;  2EPR A;  2EM9 A;  2GHF A;  3UK3 C;  4R2D A;  2ELZ A;  1X6F A;  2EML A;  2EPZ A;  1P47 A;  2EM4 A;  2CSH A;  2J7J A;  2EMH A;  1A1J A;  1AAY A;  2EMI A;  2EM7 A;  2EOS A;  2EMK A;  2YRK A;  1ZU1 A;  2ENC A;  1G2F C;  2RSI A;  1A1G A;  2I13 A;  2EL6 A;  1TN9 A;  2EM3 A;  1A1L A;  2YTF A;  3EPH A;  2A25 A;  1BBO A;  2GLI A;  4F6N A;  2ENH A;  1X6E A;  2EMB A;  2YU8 A;  2EQ3 A;  2WBT A;  2EOM A;  1WJP A;  2YTD A;  2EOI A;  1KJK A;  2YRM A;  1UBD C;  4R2A A;  2LO3 A;  1A1H A;  2EN7 A;  2JPA A;  2EE8 A;  2R1F A;  2M9A A;  4IJD A;  2YTE A;  1YSA C;  1A1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...