2EN6A

Solution structure of the c2h2 type zinc finger (region 887-919) of human zinc finger protein 268
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPYGCNECGKTFSQKSILSAHQRTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 887-919) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en6A01
1YUJA 2EOHA 2CTDA 1X6HA 2YTFA 2EPAA 2EN6A 2ELYA 1A1LA 2YU8A 2EMKA 2EL6A 2ENCA 1TF3A 2EN8A 2EMAA 2I13A 1F2IG 4M9VC 4R2QA 1UN6B 1TN9A 2WBSA 4R2DA 2EMWA 2EN3A 2DGCA 2YTDA 2WCC3 2J7JA 2YTIA 2EL4A 2A25A 2YTQA 4R2RA 1P47A 2NABA 2YTEA 2EE8A 4R2AA 2EJ4A 2ELZA 2EMBA 2EMGA 2YTGA 1WJPA 2EPXA 2LV2A 2EQ1A 1A1KA 2EM6A 2YRHA 2EN1A 2EPZA 2GHFA 4R2PA 2EM7A 2MKNA 2EMCA 2EOQA 1X6FA 2EOOA 2EOEA 5KL6A 2DLKA 4F6NA 4WSGA 2CT1A 4R2EA 2EL5A 2JP9A 1ZR9A 1A1JA 2EM0A 2YU5A 4IJDA 5KL5A 2EM9A 1MEYC 1Z1BA 1KJKA 2EMIA 2EQ3A 1ZAAC 2YTPA 4FK5C 1BBOA 1G2DC 2ENAA 3EPKA 4GZNC 2EOJA 1X3CA 1JK2A 3EPJA 1ZU1A 3VHTB 2YTJA 2LVHA 1X6EA 2WBTA 4F6MA 2EN7A 2DMIA 2EOXA 2EOIA 2YRMA 2EPCA 5KL2A 1G2FC 3MHSC 2CSHA 2LO3A 2YSOA 1UBDC 1NCSA 2GLIA 2EM3A 5KL3A 2R1FA 3EPLA 1BB8A 2HGHA 2EOSA 2LCEA 3EPHA 2EN4A 2EMLA 5KL4A 3MHHC 2EMFA 2DLQA 2VRDA 1B69A 2EORA 2RPCA 1A1IA 1X5WA 2MDGA 2PRTA 2YTNA 2MKDA 2JPAA 2EM5A 1A1FA 3UK3C 1YUIA 2EOYA 2D9HA 2RSIA 2EOFA 2EM2A 2YRKA 5KL7A 2WBUA 2DRPA 2EM8A 2ENHA 1RMDA 4F2JC 2EP3A 1DGCA 2BB8A 2EM4A 2ADRA 1AAYA 4X9JA 2YSPA 1TF6A 2LT7A 2YTOA 4R2SA 1A1GA 1LLMC 2EN2A 2EMHA 3M99B 2EOZA 2EPRA 1YSAC 2M9AA 2EOMA 4R2CA 4IS1C 2EPUA 1A1HA 2E72A 2EMXA 2EQ0A 1JK1A 2EMYA 2EPPA 2EMZA
chains in the Genus database with same CATH superfamily
2EOHA 3H09A 1QNTA 4LF5E 1X49A 2EPAA 2JYAA 2ELYA 3OMLA 2NA2A 5A6BA 4RH8A 1EH6A 4LFCE 4M30A 4KHPE 5A6AA 1X48A 2EMAA 1YFHA 1AH5A 5FLXC 3HPSA 4R2QA 1TN9A 4RHBB 2L8TA 4OX9E 2EN3A 2YPNA 1RQ0A 3EQ1A 2KONA 3JU0A 5T6JA 2M7QA 2A25A 2YTQA 4LU9A 4DUZE 2NABA 1WXRA 2EE8A 4R2AA 3AUZA 1N36E 3KZYA 2G7HA 2K7IA 3QG5C 4ZYHA 1A1KA 2EM7A 4MLQA 2EMCA 2EOQA 5A2QC 2DLKA 3C6MA 2CT1A 4WSGA 4R2EA 2EL5A 1YYOA 2JP9A 1ZR9A 5KL5A 2RTXA 4ZYGA 5LMNE 1KJKA 1XMQE 2EQ3A 1IMUA 4FK5C 2LTRA 1ZU1A 4F9CB 3L00A 4DKKA 1UILA 2WBTA 4F6MA 3JAMC 4WSPA 4O43A 2V88A 3HXLA 2EPCA 4DR2E 2RQLA 1GZ6A 2MC6A 3P1XA 3J7Yp 1T4OA 3F6GA 3ADIA 1EH7A 5KL3A 2R1FA 4WX9A 2VQEE 4O24A 3JTZA 2EN4A 2V86A 5KL4A 2LUPB 2VRDA 2V8QB 3ZOQB 1A1IA 2LRSA 4X64E 2JOXA 2FV4B 4JI6E 4DV5E 1A1FA 4LF4E 4B3ME 1UHZA 2ENHA 1RMDA 3DJWA 2L2MA 4JI7E 2ADRA 4DR1E 4BMJA 3M99B 4LFBE 2V87A 4KZSA 4L8NA 1JK1A 1I94E 3J7AG 4DUYE 5DNYA 2EMYA 2EPPA 2WBSA 2LJHA 4YY3E 1YUJA 2EPMX 2L6MA 2CTDA 2BBGA 2M1SA 4X8WA 4X62E 1FJGE 4DR4E 3VK6A 2YU8A 4HTGA 5TSEA 2EMKA 1T38A 2LE2A 1WHQA 2HHHE 1GTKA 5AC5A 2I13A 4M9VC 1UN6B 4O4KA 2KHXA 2EL4A 2F4VE 2DIXA 5LLQA 3TQMA 2YTEA 1IQSA 3AV0A 2EMBA 1PJQA 2YTGA 4X66E 4LF6E 1PJTA 2EM6A 2YRHA 4DR6E 2EPZA 2GHFA 5A6JA 2EOOA 2LTSA 3FIGA 1N33E 4NZVA 3ECRA 4X65E 5BR8E 1PDAA 2N8XA 4R03A 1YYWA 4HEIA 2ZM6E 4BS9A 2EMIA 1J5EE 1ZAAC 1G2DC 1ZBTA 2EOJA 2UU9E 3IWDA 4DV0E 3RMPA 4OOGC 4K0KE 1X6EA 4ZYEA 2UUCE 2EN7A 1PJSA 2F8BA 2EOXA 5AE2A 1EH8A 2H36X 4O5GA 3K6QA 3MHSC 2CSHA 4DR5E 3DF6A 1N3GA 2YSOA 4DR7E 2B7VA 3THNA 5ADZA 4I8OA 4F9AB 2LMZA 3MHHC 1GQEA 2B9DA 2YWQA 1B69A 2EORA 2RPCA 2YT4A 4DMIA 4B3SE 2JPAA 3C6KA 4DV3E 2D9HA 5KL7A 2WBUA 1XNQE 2EM8A 4F2JC 2EP3A 2ODRD 4WYQB 2KOUA 4DV2E 2LT7A 4JV5E 4R2SA 1WRJA 2LBSB 2EN2A 2EPKX 5IT9C 4LF7E 5IXMB 2EOZA 4Q28A 2M9AA 2EOMA 4BCAA 3KWRA 1PKPA 4IS1C 4BC9A 4AQYE 2DB2A 1X6HA 2EN6A 1L4SA 1O0WA 2MC5A 1BBGA 3LLHA 2LUQA 4JI3E 1YZ9A 2EL6A 1F2IG 4R8OA 1SR9A 5AE1A 1YPNA 4JI8E 4BC7A 4GEQB 2YTIA 2HJJA 4R2RA 1P47A 4F54A 4P78A 1WJPA 2EQ1A 3T1YE 3C4TA 1X6FA 3BIDA 4JI2E 4WXDA 5KL6A 4F6NA 3HPZA 2YU5A 2UXCE 4JI5E 2EM9A 1MEYC 4BHBA 3BBGA 1Z1BA 3KZZA 2RSMA 3EPKA 2JOBA 4GKKE 3EPJA 2N3HA 1HNWE 1XNRE 2DSYA 4NHRA 3VHTB 2N3GA 2YTJA 2V83A 4DV1E 2DMIA 3LMLA 4BHCA 2V89A 2EPLX 5IWAE 1DQ3A 2EOIA 4DV6E 2WZOA 4M0VA 2YZTA 5KL2A 4JI4E 2B3TB 5A6BD 1ZBQA 1STUA 2LO3A 5AE3A 1UBDC 1NCSA 2EZ6A 1QU6A 2EM3A 2L2NA 2L33A 3EPLA 4LF8E 1HNXE 2JXPA 2R76A 2HGHA 2EOSA 2NUFA 2UUBE 1BB8A 2LCEA 4P7DA 2EMLA 4LTYA 2L3CA 4JYAE 1T4NA 2EMFA 2DLQA 3BGHA 2ODRC 2VQFE 2MDRA 5LMUE 2V85A 2EM5A 2CPNA 3C4BA 4TUIA 2YRKA 2L2KB 4NXNE 1NEIA 2DMYA 2NUGA 1DGCA 2BB8A 2EM4A 1TF6A 4X9JA 2YSPA 4F9BB 1IBME 1A1GA 1LLMC 4KWYA 2FTXB 4B3TE 3MSWA 4R2CA 4MLVA 4DR3E 2EPUA 2VF1A 2RS6A 1A1HA 2E72A 2EMXA 2EQ0A 3OTOE 4NXME 3HTXA 2EMZA 2EM2A 2FGGA 5F3WA 3IWBA 2YTFA 3BF2A 3VYXA 2JWOA 1A1LA 4ZYDA 1FKAE 2GPIA 2UUAE 3IWCA 2ENCA 1TF3A 2EN8A 2L92A 1T39A 4R2DA 1IQOA 2EMWA 2DGCA 2YTDA 1MGTA 2J7JA 2WCC3 1N34E 4LFAE 1YYKA 4JI1E 2EJ4A 2ELZA 2EPOA 4N4RB 2EMGA 2K4VA 1T4LB 4LF9E 2EPXA 2LV2A 1HNZE 4R2PA 2EN1A 4YHHE 1HR0E 2MKNA 1J26A 4B3RE 2JVAA 2EOEA 5AASA 1SFEA 4M2ZA 1A1JA 2EM0A 4IJDA 2E5LE 3ADJA 2L3JA 4J8ZA 5A69A 2YTPA 1BBOA 2RS7A 2ENAA 4GZNC 1X47A 1JK2A 1X3CA 2UXBE 2E1MA 2EWLA 4WPYA 5CFFE 2LVHA 5LL6R 2B7TA 2YRMA 3F6HA 3ADGA 1G2FC 2Q8UA 2VE7C 4DV7E 3J81C 2GLIA 2JY9A 1RC7A 2NUEA 5AC4A 1KYQA 2I9IA 3EPHA 1DI2A 5IV8B 2M4IA 4BBYA 4WXCA 2LJUA 4JI0E 1X5WA 4WFTA 2MDGA 2EPNA 2PRTA 2YTNA 4L5NC 2MKDA 1EKZA 3UK3C 1YUIA 2EOYA 2RSIA 2EOFA 2DRPA 5A6KA 3ADLA 3T1HE 1AAYA 4TUGA 2YTOA 3HQ1A 4DV4E 2EMHA 3J80C 1XMOE 2EPRA 1YSAC 1N32E 1WHNA 2JR1A 3THOB 4Q35B 4GKJE 2IHR1 1IBKE 3VYYA 1IBLE 2UXDE 2HC5A
chains in the Genus database with same CATH topology
1YUJA 2EOHA 2CTDA 1X6HA 2YTFA 2EPAA 2EN6A 2ELYA 1A1LA 2YU8A 2EMKA 2EL6A 2ENCA 1TF3A 2EN8A 2EMAA 2I13A 1F2IG 4M9VC 4R2QA 1UN6B 1TN9A 2WBSA 4R2DA 2EMWA 2EN3A 2DGCA 2YTDA 2WCC3 2J7JA 2YTIA 2EL4A 2A25A 2YTQA 4R2RA 1P47A 2NABA 2YTEA 2EE8A 4R2AA 2EJ4A 2ELZA 2EMBA 2EMGA 2YTGA 1WJPA 2EPXA 2LV2A 2EQ1A 1A1KA 2EM6A 2YRHA 2EN1A 2EPZA 2GHFA 4R2PA 2EM7A 2MKNA 2EMCA 2EOQA 1X6FA 2EOOA 2EOEA 5KL6A 2DLKA 4F6NA 4WSGA 2CT1A 4R2EA 2EL5A 2JP9A 1ZR9A 1A1JA 2EM0A 2YU5A 4IJDA 5KL5A 2EM9A 1MEYC 1Z1BA 1KJKA 2EMIA 2EQ3A 1ZAAC 2YTPA 4FK5C 1BBOA 1G2DC 2ENAA 3EPKA 4GZNC 2EOJA 1X3CA 1JK2A 3EPJA 1ZU1A 3VHTB 2YTJA 2LVHA 1X6EA 2WBTA 4F6MA 2EN7A 2DMIA 2EOXA 2EOIA 2YRMA 2EPCA 5KL2A 1G2FC 3MHSC 2CSHA 2LO3A 2YSOA 1UBDC 1NCSA 2GLIA 2EM3A 5KL3A 2R1FA 3EPLA 1BB8A 2HGHA 2EOSA 2LCEA 3EPHA 2EN4A 2EMLA 5KL4A 3MHHC 2EMFA 2DLQA 2VRDA 1B69A 2EORA 2RPCA 1A1IA 1X5WA 2MDGA 2PRTA 2YTNA 2MKDA 2JPAA 2EM5A 1A1FA 3UK3C 1YUIA 2EOYA 2D9HA 2RSIA 2EOFA 2EM2A 2YRKA 5KL7A 2WBUA 2DRPA 2EM8A 2ENHA 1RMDA 4F2JC 2EP3A 1DGCA 2BB8A 2EM4A 2ADRA 1AAYA 4X9JA 2YSPA 1TF6A 2LT7A 2YTOA 4R2SA 1A1GA 1LLMC 2EN2A 2EMHA 3M99B 2EOZA 2EPRA 1YSAC 2M9AA 2EOMA 4R2CA 4IS1C 2EPUA 1A1HA 2E72A 2EMXA 2EQ0A 1JK1A 2EMYA 2EPPA 2EMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUJ A;  2EOH A;  2CTD A;  1X6H A;  2YTF A;  2EPA A;  2EN6 A;  2ELY A;  1A1L A;  2YU8 A;  2EMK A;  2EL6 A;  2ENC A;  1TF3 A;  2EN8 A;  2EMA A;  2I13 A;  1F2I G;  4M9V C;  4R2Q A;  1UN6 B;  1TN9 A;  2WBS A;  4R2D A;  2EMW A;  2EN3 A;  2DGC A;  2YTD A;  2WCC 3;  2J7J A;  2YTI A;  2EL4 A;  2A25 A;  2YTQ A;  4R2R A;  1P47 A;  2NAB A;  2YTE A;  2EE8 A;  4R2A A;  2EJ4 A;  2ELZ A;  2EMB A;  2EMG A;  2YTG A;  1WJP A;  2EPX A;  2LV2 A;  2EQ1 A;  1A1K A;  2EM6 A;  2YRH A;  2EN1 A;  2EPZ A;  2GHF A;  4R2P A;  2EM7 A;  2MKN A;  2EMC A;  2EOQ A;  1X6F A;  2EOO A;  2EOE A;  5KL6 A;  2DLK A;  4F6N A;  4WSG A;  2CT1 A;  4R2E A;  2EL5 A;  2JP9 A;  1ZR9 A;  1A1J A;  2EM0 A;  2YU5 A;  4IJD A;  5KL5 A;  2EM9 A;  1MEY C;  1Z1B A;  1KJK A;  2EMI A;  2EQ3 A;  1ZAA C;  2YTP A;  4FK5 C;  1BBO A;  1G2D C;  2ENA A;  3EPK A;  4GZN C;  2EOJ A;  1X3C A;  1JK2 A;  3EPJ A;  1ZU1 A;  3VHT B;  2YTJ A;  2LVH A;  1X6E A;  2WBT A;  4F6M A;  2EN7 A;  2DMI A;  2EOX A;  2EOI A;  2YRM A;  2EPC A;  5KL2 A;  1G2F C;  3MHS C;  2CSH A;  2LO3 A;  2YSO A;  1UBD C;  1NCS A;  2GLI A;  2EM3 A;  5KL3 A;  2R1F A;  3EPL A;  1BB8 A;  2HGH A;  2EOS A;  2LCE A;  3EPH A;  2EN4 A;  2EML A;  5KL4 A;  3MHH C;  2EMF A;  2DLQ A;  2VRD A;  1B69 A;  2EOR A;  2RPC A;  1A1I A;  1X5W A;  2MDG A;  2PRT A;  2YTN A;  2MKD A;  2JPA A;  2EM5 A;  1A1F A;  3UK3 C;  1YUI A;  2EOY A;  2D9H A;  2RSI A;  2EOF A;  2EM2 A;  2YRK A;  5KL7 A;  2WBU A;  2DRP A;  2EM8 A;  2ENH A;  1RMD A;  4F2J C;  2EP3 A;  1DGC A;  2BB8 A;  2EM4 A;  2ADR A;  1AAY A;  4X9J A;  2YSP A;  1TF6 A;  2LT7 A;  2YTO A;  4R2S A;  1A1G A;  1LLM C;  2EN2 A;  2EMH A;  3M99 B;  2EOZ A;  2EPR A;  1YSA C;  2M9A A;  2EOM A;  4R2C A;  4IS1 C;  2EPU A;  1A1H A;  2E72 A;  2EMX A;  2EQ0 A;  1JK1 A;  2EMY A;  2EPP A;  2EMZ A; 
#chains in the Genus database with same CATH topology
 2EOH A;  3H09 A;  1QNT A;  4LF5 E;  1X49 A;  2EPA A;  2JYA A;  2ELY A;  3OML A;  2NA2 A;  5A6B A;  4RH8 A;  1EH6 A;  4LFC E;  4M30 A;  4KHP E;  5A6A A;  1X48 A;  2EMA A;  1YFH A;  1AH5 A;  5FLX C;  3HPS A;  4R2Q A;  1TN9 A;  4RHB B;  2L8T A;  4OX9 E;  2EN3 A;  2YPN A;  1RQ0 A;  3EQ1 A;  2KON A;  3JU0 A;  5T6J A;  2M7Q A;  2A25 A;  2YTQ A;  4LU9 A;  4DUZ E;  2NAB A;  1WXR A;  2EE8 A;  4R2A A;  3AUZ A;  1N36 E;  3KZY A;  2G7H A;  2K7I A;  3QG5 C;  4ZYH A;  1A1K A;  2EM7 A;  4MLQ A;  2EMC A;  2EOQ A;  5A2Q C;  2DLK A;  3C6M A;  2CT1 A;  4WSG A;  4R2E A;  2EL5 A;  1YYO A;  2JP9 A;  1ZR9 A;  5KL5 A;  2RTX A;  4ZYG A;  5LMN E;  1KJK A;  1XMQ E;  2EQ3 A;  1IMU A;  4FK5 C;  2LTR A;  1ZU1 A;  4F9C B;  3L00 A;  4DKK A;  1UIL A;  2WBT A;  4F6M A;  3JAM C;  4WSP A;  4O43 A;  2V88 A;  3HXL A;  2EPC A;  4DR2 E;  2RQL A;  1GZ6 A;  2MC6 A;  3P1X A;  3J7Y p;  1T4O A;  3F6G A;  3ADI A;  1EH7 A;  5KL3 A;  2R1F A;  4WX9 A;  2VQE E;  4O24 A;  3JTZ A;  2EN4 A;  2V86 A;  5KL4 A;  2LUP B;  2VRD A;  2V8Q B;  3ZOQ B;  1A1I A;  2LRS A;  4X64 E;  2JOX A;  2FV4 B;  4JI6 E;  4DV5 E;  1A1F A;  4LF4 E;  4B3M E;  1UHZ A;  2ENH A;  1RMD A;  3DJW A;  2L2M A;  4JI7 E;  2ADR A;  4DR1 E;  4BMJ A;  3M99 B;  4LFB E;  2V87 A;  4KZS A;  4L8N A;  1JK1 A;  1I94 E;  3J7A G;  4DUY E;  5DNY A;  2EMY A;  2EPP A;  2WBS A;  2LJH A;  4YY3 E;  1YUJ A;  2EPM X;  2L6M A;  2CTD A;  2BBG A;  2M1S A;  4X8W A;  4X62 E;  1FJG E;  4DR4 E;  3VK6 A;  2YU8 A;  4HTG A;  5TSE A;  2EMK A;  1T38 A;  2LE2 A;  1WHQ A;  2HHH E;  1GTK A;  5AC5 A;  2I13 A;  4M9V C;  1UN6 B;  4O4K A;  2KHX A;  2EL4 A;  2F4V E;  2DIX A;  5LLQ A;  3TQM A;  2YTE A;  1IQS A;  3AV0 A;  2EMB A;  1PJQ A;  2YTG A;  4X66 E;  4LF6 E;  1PJT A;  2EM6 A;  2YRH A;  4DR6 E;  2EPZ A;  2GHF A;  5A6J A;  2EOO A;  2LTS A;  3FIG A;  1N33 E;  4NZV A;  3ECR A;  4X65 E;  5BR8 E;  1PDA A;  2N8X A;  4R03 A;  1YYW A;  4HEI A;  2ZM6 E;  4BS9 A;  2EMI A;  1J5E E;  1ZAA C;  1G2D C;  1ZBT A;  2EOJ A;  2UU9 E;  3IWD A;  4DV0 E;  3RMP A;  4OOG C;  4K0K E;  1X6E A;  4ZYE A;  2UUC E;  2EN7 A;  1PJS A;  2F8B A;  2EOX A;  5AE2 A;  1EH8 A;  2H36 X;  4O5G A;  3K6Q A;  3MHS C;  2CSH A;  4DR5 E;  3DF6 A;  1N3G A;  2YSO A;  4DR7 E;  2B7V A;  3THN A;  5ADZ A;  4I8O A;  4F9A B;  2LMZ A;  3MHH C;  1GQE A;  2B9D A;  2YWQ A;  1B69 A;  2EOR A;  2RPC A;  2YT4 A;  4DMI A;  4B3S E;  2JPA A;  3C6K A;  4DV3 E;  2D9H A;  5KL7 A;  2WBU A;  1XNQ E;  2EM8 A;  4F2J C;  2EP3 A;  2ODR D;  4WYQ B;  2KOU A;  4DV2 E;  2LT7 A;  4JV5 E;  4R2S A;  1WRJ A;  2LBS B;  2EN2 A;  2EPK X;  5IT9 C;  4LF7 E;  5IXM B;  2EOZ A;  4Q28 A;  2M9A A;  2EOM A;  4BCA A;  3KWR A;  1PKP A;  4IS1 C;  4BC9 A;  4AQY E;  2DB2 A;  1X6H A;  2EN6 A;  1L4S A;  1O0W A;  2MC5 A;  1BBG A;  3LLH A;  2LUQ A;  4JI3 E;  1YZ9 A;  2EL6 A;  1F2I G;  4R8O A;  1SR9 A;  5AE1 A;  1YPN A;  4JI8 E;  4BC7 A;  4GEQ B;  2YTI A;  2HJJ A;  4R2R A;  1P47 A;  4F54 A;  4P78 A;  1WJP A;  2EQ1 A;  3T1Y E;  3C4T A;  1X6F A;  3BID A;  4JI2 E;  4WXD A;  5KL6 A;  4F6N A;  3HPZ A;  2YU5 A;  2UXC E;  4JI5 E;  2EM9 A;  1MEY C;  4BHB A;  3BBG A;  1Z1B A;  3KZZ A;  2RSM A;  3EPK A;  2JOB A;  4GKK E;  3EPJ A;  2N3H A;  1HNW E;  1XNR E;  2DSY A;  4NHR A;  3VHT B;  2N3G A;  2YTJ A;  2V83 A;  4DV1 E;  2DMI A;  3LML A;  4BHC A;  2V89 A;  2EPL X;  5IWA E;  1DQ3 A;  2EOI A;  4DV6 E;  2WZO A;  4M0V A;  2YZT A;  5KL2 A;  4JI4 E;  2B3T B;  5A6B D;  1ZBQ A;  1STU A;  2LO3 A;  5AE3 A;  1UBD C;  1NCS A;  2EZ6 A;  1QU6 A;  2EM3 A;  2L2N A;  2L33 A;  3EPL A;  4LF8 E;  1HNX E;  2JXP A;  2R76 A;  2HGH A;  2EOS A;  2NUF A;  2UUB E;  1BB8 A;  2LCE A;  4P7D A;  2EML A;  4LTY A;  2L3C A;  4JYA E;  1T4N A;  2EMF A;  2DLQ A;  3BGH A;  2ODR C;  2VQF E;  2MDR A;  5LMU E;  2V85 A;  2EM5 A;  2CPN A;  3C4B A;  4TUI A;  2YRK A;  2L2K B;  4NXN E;  1NEI A;  2DMY A;  2NUG A;  1DGC A;  2BB8 A;  2EM4 A;  1TF6 A;  4X9J A;  2YSP A;  4F9B B;  1IBM E;  1A1G A;  1LLM C;  4KWY A;  2FTX B;  4B3T E;  3MSW A;  4R2C A;  4MLV A;  4DR3 E;  2EPU A;  2VF1 A;  2RS6 A;  1A1H A;  2E72 A;  2EMX A;  2EQ0 A;  3OTO E;  4NXM E;  3HTX A;  2EMZ A;  2EM2 A;  2FGG A;  5F3W A;  3IWB A;  2YTF A;  3BF2 A;  3VYX A;  2JWO A;  1A1L A;  4ZYD A;  1FKA E;  2GPI A;  2UUA E;  3IWC A;  2ENC A;  1TF3 A;  2EN8 A;  2L92 A;  1T39 A;  4R2D A;  1IQO A;  2EMW A;  2DGC A;  2YTD A;  1MGT A;  2J7J A;  2WCC 3;  1N34 E;  4LFA E;  1YYK A;  4JI1 E;  2EJ4 A;  2ELZ A;  2EPO A;  4N4R B;  2EMG A;  2K4V A;  1T4L B;  4LF9 E;  2EPX A;  2LV2 A;  1HNZ E;  4R2P A;  2EN1 A;  4YHH E;  1HR0 E;  2MKN A;  1J26 A;  4B3R E;  2JVA A;  2EOE A;  5AAS A;  1SFE A;  4M2Z A;  1A1J A;  2EM0 A;  4IJD A;  2E5L E;  3ADJ A;  2L3J A;  4J8Z A;  5A69 A;  2YTP A;  1BBO A;  2RS7 A;  2ENA A;  4GZN C;  1X47 A;  1JK2 A;  1X3C A;  2UXB E;  2E1M A;  2EWL A;  4WPY A;  5CFF E;  2LVH A;  5LL6 R;  2B7T A;  2YRM A;  3F6H A;  3ADG A;  1G2F C;  2Q8U A;  2VE7 C;  4DV7 E;  3J81 C;  2GLI A;  2JY9 A;  1RC7 A;  2NUE A;  5AC4 A;  1KYQ A;  2I9I A;  3EPH A;  1DI2 A;  5IV8 B;  2M4I A;  4BBY A;  4WXC A;  2LJU A;  4JI0 E;  1X5W A;  4WFT A;  2MDG A;  2EPN A;  2PRT A;  2YTN A;  4L5N C;  2MKD A;  1EKZ A;  3UK3 C;  1YUI A;  2EOY A;  2RSI A;  2EOF A;  2DRP A;  5A6K A;  3ADL A;  3T1H E;  1AAY A;  4TUG A;  2YTO A;  3HQ1 A;  4DV4 E;  2EMH A;  3J80 C;  1XMO E;  2EPR A;  1YSA C;  1N32 E;  1WHN A;  2JR1 A;  3THO B;  4Q35 B;  4GKJ E;  2IHR 1;  1IBK E;  3VYY A;  1IBL E;  2UXD E;  2HC5 A; 
#chains in the Genus database with same CATH homology
 1YUJ A;  2EOH A;  2CTD A;  1X6H A;  2YTF A;  2EPA A;  2EN6 A;  2ELY A;  1A1L A;  2YU8 A;  2EMK A;  2EL6 A;  2ENC A;  1TF3 A;  2EN8 A;  2EMA A;  2I13 A;  1F2I G;  4M9V C;  4R2Q A;  1UN6 B;  1TN9 A;  2WBS A;  4R2D A;  2EMW A;  2EN3 A;  2DGC A;  2YTD A;  2WCC 3;  2J7J A;  2YTI A;  2EL4 A;  2A25 A;  2YTQ A;  4R2R A;  1P47 A;  2NAB A;  2YTE A;  2EE8 A;  4R2A A;  2EJ4 A;  2ELZ A;  2EMB A;  2EMG A;  2YTG A;  1WJP A;  2EPX A;  2LV2 A;  2EQ1 A;  1A1K A;  2EM6 A;  2YRH A;  2EN1 A;  2EPZ A;  2GHF A;  4R2P A;  2EM7 A;  2MKN A;  2EMC A;  2EOQ A;  1X6F A;  2EOO A;  2EOE A;  5KL6 A;  2DLK A;  4F6N A;  4WSG A;  2CT1 A;  4R2E A;  2EL5 A;  2JP9 A;  1ZR9 A;  1A1J A;  2EM0 A;  2YU5 A;  4IJD A;  5KL5 A;  2EM9 A;  1MEY C;  1Z1B A;  1KJK A;  2EMI A;  2EQ3 A;  1ZAA C;  2YTP A;  4FK5 C;  1BBO A;  1G2D C;  2ENA A;  3EPK A;  4GZN C;  2EOJ A;  1X3C A;  1JK2 A;  3EPJ A;  1ZU1 A;  3VHT B;  2YTJ A;  2LVH A;  1X6E A;  2WBT A;  4F6M A;  2EN7 A;  2DMI A;  2EOX A;  2EOI A;  2YRM A;  2EPC A;  5KL2 A;  1G2F C;  3MHS C;  2CSH A;  2LO3 A;  2YSO A;  1UBD C;  1NCS A;  2GLI A;  2EM3 A;  5KL3 A;  2R1F A;  3EPL A;  1BB8 A;  2HGH A;  2EOS A;  2LCE A;  3EPH A;  2EN4 A;  2EML A;  5KL4 A;  3MHH C;  2EMF A;  2DLQ A;  2VRD A;  1B69 A;  2EOR A;  2RPC A;  1A1I A;  1X5W A;  2MDG A;  2PRT A;  2YTN A;  2MKD A;  2JPA A;  2EM5 A;  1A1F A;  3UK3 C;  1YUI A;  2EOY A;  2D9H A;  2RSI A;  2EOF A;  2EM2 A;  2YRK A;  5KL7 A;  2WBU A;  2DRP A;  2EM8 A;  2ENH A;  1RMD A;  4F2J C;  2EP3 A;  1DGC A;  2BB8 A;  2EM4 A;  2ADR A;  1AAY A;  4X9J A;  2YSP A;  1TF6 A;  2LT7 A;  2YTO A;  4R2S A;  1A1G A;  1LLM C;  2EN2 A;  2EMH A;  3M99 B;  2EOZ A;  2EPR A;  1YSA C;  2M9A A;  2EOM A;  4R2C A;  4IS1 C;  2EPU A;  1A1H A;  2E72 A;  2EMX A;  2EQ0 A;  1JK1 A;  2EMY A;  2EPP A;  2EMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...