2EN6A

Solution structure of the c2h2 type zinc finger (region 887-919) of human zinc finger protein 268
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPYGCNECGKTFSQKSILSAHQRTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 887-919) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en6A01
2EOEA 1A1IA 1UBDC 5KL6A 2M9AA 2EM7A 2EPCA 1A1GA 2YTQA 2NABA 2EPAA 2WBSA 5KL2A 2EMIA 2EM8A 1G2DC 2EMLA 2EOFA 2EM4A 4FK5C 5KL7A 2ENAA 4R2EA 2YTIA 2WBUA 2E72A 5KL4A 2J7JA 3MHHC 1BB8A 2EOOA 2EPPA 2LV2A 4R2DA 1NCSA 2WBTA 2EM3A 2WCC3 4GZNC 1WJPA 1MEYC 1YSAC 2EORA 2A25A 3EPLA 4M9VC 2MKDA 2MDGA 2LT7A 4F6NA 2YTEA 2EM6A 3UK3C 2EN2A 4R2RA 1ZR9A 4IJDA 2YTGA 2EQ1A 4R2AA 4R2SA 2EPZA 2LCEA 2EOIA 1A1KA 1A1FA 1X3CA 2EOXA 2D9HA 1TN9A 2DGCA 2ADRA 2EMXA 2EN6A 1X6HA 1G2FC 2YTNA 1X6EA 2EMBA 2EP3A 1LLMC 1A1LA 2EMYA 1BBOA 5KL3A 2EMCA 2EM2A 2DMIA 2RSIA 4WSGA 2EN3A 2BB8A 2EN7A 4IS1C 2LVHA 2JP9A 2YRMA 3M99B 2GHFA 2CT1A 2EMAA 4X9JA 1TF3A 2DRPA 1ZU1A 2EOSA 2CSHA 2YU5A 2EMWA 2EOMA 2PRTA 2EL6A 2EL4A 2VRDA 2MKNA 2EMHA 4F6MA 2YRKA 2EOZA 1AAYA 1B69A 1ZAAC 2EOJA 1JK1A 1A1HA 2YTPA 2EMFA 2HGHA 4R2PA 2GLIA 2YSOA 3EPJA 1YUJA 2ELZA 2EMGA 1P47A 2EL5A 2EOYA 2YU8A 2EQ3A 3EPHA 1TF6A 2CTDA 3VHTB 1Z1BA 2LO3A 2ELYA 2EN8A 2EE8A 2EM0A 1KJKA 2EPUA 2YTDA 2EM9A 2EOHA 4F2JC 1A1JA 3EPKA 2EPXA 3MHSC 1YUIA 2EPRA 2YTFA 1X5WA 5KL5A 2ENHA 2ENCA 1RMDA 1JK2A 2JPAA 2EN1A 2R1FA 2RPCA 2EJ4A 1F2IG 1DGCA 2DLQA 4R2CA 2EOQA 2YTJA 4R2QA 2YRHA 2EMKA 1UN6B 2EQ0A 2YSPA 2EMZA 2EN4A 1X6FA 2I13A 2EM5A 2YTOA 2DLKA
chains in the Genus database with same CATH superfamily
2RQLA 1A1IA 2DIXA 1SR9A 2EM7A 4O4KA 2DB2A 4N4RB 4F9BB 3ADIA 4X64E 1N32E 4L5NC 2L3JA 1XNQE 1G2DC 4DR1E 2MC5A 2M7QA 2ENAA 2YZTA 2V86A 3VYYA 4ZYDA 2NA2A 3MHHC 1EH7A 2RSMA 2EPPA 2RS6A 2IHR1 3J80C 3IWCA 2FGGA 2WCC3 4M9VC 4GKKE 2EORA 3EPLA 2ODRD 2L8TA 2MKDA 2LT7A 4F6NA 2CPNA 3UK3C 1ZR9A 1GZ6A 2RTXA 1IBLE 2UXDE 4LF5E 1GTKA 4JI1E 4R2SA 4LFAE 1YYWA 2EPZA 2LCEA 2EOIA 4LF8E 2UU9E 1X3CA 1HR0E 3C6KA 1X47A 2N8XA 1PDAA 4B3RE 1LLMC 4F9CB 1BBOA 4P78A 2G7HA 4JI5E 2DMIA 4BS9A 1FKAE 4DV7E 3VK6A 1I94E 2L33A 1L4SA 2GHFA 4LTYA 2JVAA 4B3ME 1EH6A 4WXDA 4BHBA 1RC7A 4YY3E 2B9DA 1HNWE 4DV4E 1ZAAC 3HXLA 2EPMX 1XMQE 4KZSA 2V83A 3BIDA 2EPKX 2LUQA 4JI8E 1PJQA 1GQEA 2CTDA 4DV0E 1Z1BA 5A2QC 3T1YE 2EPUA 2YTDA 2EOHA 2V87A 3AUZA 4F2JC 1A1JA 1HNZE 4O24A 3MHSC 2EPRA 2VQFE 1PJTA 2YPNA 4DUZE 4LF6E 1RMDA 4RHBB 1JK2A 4B3SE 2RPCA 1F2IG 4LF4E 2I9IA 4JI6E 1PJSA 5IV8B 2EMZA 3ADGA 4KWYA 2I13A 2B7VA 2DLKA 3LLHA 2EOEA 3FIGA 1A1GA 4RH8A 4Q28A 4BBYA 3ZOQB 2LUPB 5A6AA 2EMIA 2EM8A 3HTXA 2EOFA 2NUFA 4O5GA 2E1MA 2YTIA 1STUA 4I8OA 1UILA 4J8ZA 1QNTA 2YWQA 2V85A 4M0VA 4HEIA 3C4TA 4JI4E 1SFEA 2JWOA 2EM3A 4GZNC 1WJPA 2EM6A 2EN2A 4R2RA 3H09A 3AV0A 2ZM6E 2YTGA 1ZBQA 3L00A 4LF9E 3J7Yp 2L3CA 1O0WA 1QU6A 2EOXA 4WSPA 2D9HA 1T38A 3C4BA 1X6HA 5DNYA 4KHPE 5IXMB 3EQ1A 1X6EA 2EMBA 4B3TE 2EMYA 4DV6E 4WX9A 1DQ3A 2B3TB 3KZZA 2VF1A 4JI3E 2EN3A 1T4NA 3HQ1A 2KHXA 3M99B 2B7TA 2CT1A 3KWRA 2VQEE 2LE2A 1ZU1A 4DUYE 2EOSA 2CSHA 4DR7E 4X66E 5A69A 4MLQA 4JYAE 2PRTA 2F8BA 2EL4A 1YYOA 1IBME 2YRKA 1B69A 2EOJA 1A1HA 2JXPA 2LMZA 4GEQB 4M2ZA 4DKKA 4R2PA 5T6JA 2E5LE 2RS7A 1YUJA 2ELZA 2EOYA 5CFFE 2EQ3A 3BGHA 2EN8A 2EE8A 1YZ9A 4OOGC 4BHCA 3ADLA 2YTFA 1WHNA 5AE3A 2EZ6A 4LU9A 3TQMA 2HHHE 2JYAA 3IWDA 2LJHA 2YTJA 5LMNE 3F6HA 1YFHA 2L6MA 3BF2A 2DMYA 3KZYA 2FTXB 5AC4A 2EPNA 4X62E 5FLXC 2L2KB 2YTOA 4YHHE 2LJUA 3MSWA 3JAMC 1MGTA 5KL6A 2M9AA 4DV2E 2KOUA 4JV5E 4ZYEA 2WBSA 4NXNE 4BC9A 1NEIA 2EMLA 2V88A 1XMOE 4JI0E 4DMIA 5KL7A 1UHZA 2BBGA 1XNRE 4DR5E 5KL4A 2J7JA 2K4VA 1BB8A 4F9AB 4Q35B 5LLQA 4R2DA 5IWAE 1NCSA 2WBTA 1YSAC 1MEYC 2UXBE 1EKZA 2K7IA 2YTEA 1HNXE 4ZYGA 3QG5C 2GPIA 2N3GA 3THNA 5BR8E 3ADJA 1A1KA 1WRJA 2LTRA 2EMXA 2EN6A 1DI2A 1N34E 1BBGA 1G2FC 2YTNA 4R03A 2N3HA 1A1LA 4DR6E 2VE7C 5KL3A 2JOXA 1J5EE 4DV3E 2L92A 3T1HE 2RSIA 2ODRC 2LTSA 2JP9A 3JTZA 2HJJA 1YPNA 1IQOA 3THOB 5A6BD 1EH8A 4X9JA 4TUGA 1TF3A 2DRPA 3HPZA 1ZBTA 4NXME 2EMWA 3ECRA 4X65E 2EOMA 2UUCE 4F6MA 4JI2E 3JU0A 2EWLA 3RMPA 2M4IA 2GLIA 2EMGA 2M1SA 3C6MA 3VHTB 3F6GA 2ELYA 4ZYHA 4F54A 3DF6A 2EM9A 3EPKA 1YUIA 1J26A 2KONA 1T4OA 4BMJA 3J7AG 2JPAA 2R1FA 2EJ4A 2LBSB 4MLVA 1YYKA 3DJWA 2DLQA 2EOQA 5IT9C 4R2QA 1PKPA 2YRHA 1KYQA 1N3GA 2EMKA 1UN6B 2L2NA 2YSPA 3OTOE 5A6BA 1X6FA 2EM5A 1KJKA 1N36E 4HTGA 5AE2A 1UBDC 4DR4E 2UXCE 2EPCA 2FV4B 2YTQA 2NABA 2F4VE 2EPOA 2EPAA 1X49A 3K6QA 4GKJE 5KL2A 3LMLA 1AH5A 2EM4A 2HC5A 2YT4A 4FK5C 4R2EA 2LRSA 2MC6A 2E72A 4BCAA 2WBUA 2JY9A 5TSEA 2NUGA 1IMUA 4DR3E 2EOOA 2LV2A 4DV5E 5AE1A 2A25A 2MDGA 2UUAE 2R76A 4IJDA 4AQYE 4WFTA 5ADZA 4LF7E 4L8NA 2EQ1A 2JR1A 5A6KA 1WHQA 4R2AA 3P1XA 1IBKE 5AC5A 4DR2E 1A1FA 1TN9A 2DGCA 2ADRA 4WYQB 4DV1E 2EP3A 4R8OA 5AASA 2WZOA 3HPSA 2EMCA 2EM2A 2JOBA 4WSGA 4M30A 3VYXA 2BB8A 2EN7A 4IS1C 2LVHA 4NHRA 2YRMA 2Q8UA 2MDRA 1N33E 2EMAA 1WXRA 4TUIA 2YU5A 2EL6A 2VRDA 2MKNA 2EMHA 4WPYA 4NZVA 4O43A 2EOZA 1AAYA 2EPLX 1IQSA 1JK1A 2YTPA 2EMFA 2HGHA 1RQ0A 4X8WA 2YSOA 3EPJA 1T39A 4LFCE 1P47A 2EL5A 2YU8A 3J81C 2V8QB 3EPHA 1TF6A 3IWBA 2LO3A 2UUBE 4LFBE 2L2MA 2EM0A 2V89A 2NUEA 2EPXA 5F3WA 1X5WA 2H36X 5KL5A 2ENHA 3BBGA 2ENCA 5LL6R 3OMLA 5LMUE 2EN1A 4WXCA 1DGCA 4P7DA 4JI7E 4K0KE 4R2CA 4BC7A 1T4LB 2EQ0A 1FJGE 2EN4A 4OX9E 1X48A 2DSYA 5A6JA
chains in the Genus database with same CATH topology
2EOEA 1A1IA 1UBDC 5KL6A 2M9AA 2EM7A 2EPCA 1A1GA 2YTQA 2NABA 2EPAA 2WBSA 5KL2A 2EMIA 2EM8A 1G2DC 2EMLA 2EOFA 2EM4A 4FK5C 5KL7A 2ENAA 4R2EA 2YTIA 2WBUA 2E72A 5KL4A 2J7JA 3MHHC 1BB8A 2EOOA 2EPPA 2LV2A 4R2DA 1NCSA 2WBTA 2EM3A 2WCC3 4GZNC 1WJPA 1MEYC 1YSAC 2EORA 2A25A 3EPLA 4M9VC 2MKDA 2MDGA 2LT7A 4F6NA 2YTEA 2EM6A 3UK3C 2EN2A 4R2RA 1ZR9A 4IJDA 2YTGA 2EQ1A 4R2AA 4R2SA 2EPZA 2LCEA 2EOIA 1A1KA 1A1FA 1X3CA 2EOXA 2D9HA 1TN9A 2DGCA 2ADRA 2EMXA 2EN6A 1X6HA 1G2FC 2YTNA 1X6EA 2EMBA 2EP3A 1LLMC 1A1LA 2EMYA 1BBOA 5KL3A 2EMCA 2EM2A 2DMIA 2RSIA 4WSGA 2EN3A 2BB8A 2EN7A 4IS1C 2LVHA 2JP9A 2YRMA 3M99B 2GHFA 2CT1A 2EMAA 4X9JA 1TF3A 2DRPA 1ZU1A 2EOSA 2CSHA 2YU5A 2EMWA 2EOMA 2PRTA 2EL6A 2EL4A 2VRDA 2MKNA 2EMHA 4F6MA 2YRKA 2EOZA 1AAYA 1B69A 1ZAAC 2EOJA 1JK1A 1A1HA 2YTPA 2EMFA 2HGHA 4R2PA 2GLIA 2YSOA 3EPJA 1YUJA 2ELZA 2EMGA 1P47A 2EL5A 2EOYA 2YU8A 2EQ3A 3EPHA 1TF6A 2CTDA 3VHTB 1Z1BA 2LO3A 2ELYA 2EN8A 2EE8A 2EM0A 1KJKA 2EPUA 2YTDA 2EM9A 2EOHA 4F2JC 1A1JA 3EPKA 2EPXA 3MHSC 1YUIA 2EPRA 2YTFA 1X5WA 5KL5A 2ENHA 2ENCA 1RMDA 1JK2A 2JPAA 2EN1A 2R1FA 2RPCA 2EJ4A 1F2IG 1DGCA 2DLQA 4R2CA 2EOQA 2YTJA 4R2QA 2YRHA 2EMKA 1UN6B 2EQ0A 2YSPA 2EMZA 2EN4A 1X6FA 2I13A 2EM5A 2YTOA 2DLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOE A;  1A1I A;  1UBD C;  5KL6 A;  2M9A A;  2EM7 A;  2EPC A;  1A1G A;  2YTQ A;  2NAB A;  2EPA A;  2WBS A;  5KL2 A;  2EMI A;  2EM8 A;  1G2D C;  2EML A;  2EOF A;  2EM4 A;  4FK5 C;  5KL7 A;  2ENA A;  4R2E A;  2YTI A;  2WBU A;  2E72 A;  5KL4 A;  2J7J A;  3MHH C;  1BB8 A;  2EOO A;  2EPP A;  2LV2 A;  4R2D A;  1NCS A;  2WBT A;  2EM3 A;  2WCC 3;  4GZN C;  1WJP A;  1MEY C;  1YSA C;  2EOR A;  2A25 A;  3EPL A;  4M9V C;  2MKD A;  2MDG A;  2LT7 A;  4F6N A;  2YTE A;  2EM6 A;  3UK3 C;  2EN2 A;  4R2R A;  1ZR9 A;  4IJD A;  2YTG A;  2EQ1 A;  4R2A A;  4R2S A;  2EPZ A;  2LCE A;  2EOI A;  1A1K A;  1A1F A;  1X3C A;  2EOX A;  2D9H A;  1TN9 A;  2DGC A;  2ADR A;  2EMX A;  2EN6 A;  1X6H A;  1G2F C;  2YTN A;  1X6E A;  2EMB A;  2EP3 A;  1LLM C;  1A1L A;  2EMY A;  1BBO A;  5KL3 A;  2EMC A;  2EM2 A;  2DMI A;  2RSI A;  4WSG A;  2EN3 A;  2BB8 A;  2EN7 A;  4IS1 C;  2LVH A;  2JP9 A;  2YRM A;  3M99 B;  2GHF A;  2CT1 A;  2EMA A;  4X9J A;  1TF3 A;  2DRP A;  1ZU1 A;  2EOS A;  2CSH A;  2YU5 A;  2EMW A;  2EOM A;  2PRT A;  2EL6 A;  2EL4 A;  2VRD A;  2MKN A;  2EMH A;  4F6M A;  2YRK A;  2EOZ A;  1AAY A;  1B69 A;  1ZAA C;  2EOJ A;  1JK1 A;  1A1H A;  2YTP A;  2EMF A;  2HGH A;  4R2P A;  2GLI A;  2YSO A;  3EPJ A;  1YUJ A;  2ELZ A;  2EMG A;  1P47 A;  2EL5 A;  2EOY A;  2YU8 A;  2EQ3 A;  3EPH A;  1TF6 A;  2CTD A;  3VHT B;  1Z1B A;  2LO3 A;  2ELY A;  2EN8 A;  2EE8 A;  2EM0 A;  1KJK A;  2EPU A;  2YTD A;  2EM9 A;  2EOH A;  4F2J C;  1A1J A;  3EPK A;  2EPX A;  3MHS C;  1YUI A;  2EPR A;  2YTF A;  1X5W A;  5KL5 A;  2ENH A;  2ENC A;  1RMD A;  1JK2 A;  2JPA A;  2EN1 A;  2R1F A;  2RPC A;  2EJ4 A;  1F2I G;  1DGC A;  2DLQ A;  4R2C A;  2EOQ A;  2YTJ A;  4R2Q A;  2YRH A;  2EMK A;  1UN6 B;  2EQ0 A;  2YSP A;  2EMZ A;  2EN4 A;  1X6F A;  2I13 A;  2EM5 A;  2YTO A;  2DLK A; 
#chains in the Genus database with same CATH topology
 2RQL A;  1A1I A;  2DIX A;  1SR9 A;  2EM7 A;  4O4K A;  2DB2 A;  4N4R B;  4F9B B;  3ADI A;  4X64 E;  1N32 E;  4L5N C;  2L3J A;  1XNQ E;  1G2D C;  4DR1 E;  2MC5 A;  2M7Q A;  2ENA A;  2YZT A;  2V86 A;  3VYY A;  4ZYD A;  2NA2 A;  3MHH C;  1EH7 A;  2RSM A;  2EPP A;  2RS6 A;  2IHR 1;  3J80 C;  3IWC A;  2FGG A;  2WCC 3;  4M9V C;  4GKK E;  2EOR A;  3EPL A;  2ODR D;  2L8T A;  2MKD A;  2LT7 A;  4F6N A;  2CPN A;  3UK3 C;  1ZR9 A;  1GZ6 A;  2RTX A;  1IBL E;  2UXD E;  4LF5 E;  1GTK A;  4JI1 E;  4R2S A;  4LFA E;  1YYW A;  2EPZ A;  2LCE A;  2EOI A;  4LF8 E;  2UU9 E;  1X3C A;  1HR0 E;  3C6K A;  1X47 A;  2N8X A;  1PDA A;  4B3R E;  1LLM C;  4F9C B;  1BBO A;  4P78 A;  2G7H A;  4JI5 E;  2DMI A;  4BS9 A;  1FKA E;  4DV7 E;  3VK6 A;  1I94 E;  2L33 A;  1L4S A;  2GHF A;  4LTY A;  2JVA A;  4B3M E;  1EH6 A;  4WXD A;  4BHB A;  1RC7 A;  4YY3 E;  2B9D A;  1HNW E;  4DV4 E;  1ZAA C;  3HXL A;  2EPM X;  1XMQ E;  4KZS A;  2V83 A;  3BID A;  2EPK X;  2LUQ A;  4JI8 E;  1PJQ A;  1GQE A;  2CTD A;  4DV0 E;  1Z1B A;  5A2Q C;  3T1Y E;  2EPU A;  2YTD A;  2EOH A;  2V87 A;  3AUZ A;  4F2J C;  1A1J A;  1HNZ E;  4O24 A;  3MHS C;  2EPR A;  2VQF E;  1PJT A;  2YPN A;  4DUZ E;  4LF6 E;  1RMD A;  4RHB B;  1JK2 A;  4B3S E;  2RPC A;  1F2I G;  4LF4 E;  2I9I A;  4JI6 E;  1PJS A;  5IV8 B;  2EMZ A;  3ADG A;  4KWY A;  2I13 A;  2B7V A;  2DLK A;  3LLH A;  2EOE A;  3FIG A;  1A1G A;  4RH8 A;  4Q28 A;  4BBY A;  3ZOQ B;  2LUP B;  5A6A A;  2EMI A;  2EM8 A;  3HTX A;  2EOF A;  2NUF A;  4O5G A;  2E1M A;  2YTI A;  1STU A;  4I8O A;  1UIL A;  4J8Z A;  1QNT A;  2YWQ A;  2V85 A;  4M0V A;  4HEI A;  3C4T A;  4JI4 E;  1SFE A;  2JWO A;  2EM3 A;  4GZN C;  1WJP A;  2EM6 A;  2EN2 A;  4R2R A;  3H09 A;  3AV0 A;  2ZM6 E;  2YTG A;  1ZBQ A;  3L00 A;  4LF9 E;  3J7Y p;  2L3C A;  1O0W A;  1QU6 A;  2EOX A;  4WSP A;  2D9H A;  1T38 A;  3C4B A;  1X6H A;  5DNY A;  4KHP E;  5IXM B;  3EQ1 A;  1X6E A;  2EMB A;  4B3T E;  2EMY A;  4DV6 E;  4WX9 A;  1DQ3 A;  2B3T B;  3KZZ A;  2VF1 A;  4JI3 E;  2EN3 A;  1T4N A;  3HQ1 A;  2KHX A;  3M99 B;  2B7T A;  2CT1 A;  3KWR A;  2VQE E;  2LE2 A;  1ZU1 A;  4DUY E;  2EOS A;  2CSH A;  4DR7 E;  4X66 E;  5A69 A;  4MLQ A;  4JYA E;  2PRT A;  2F8B A;  2EL4 A;  1YYO A;  1IBM E;  2YRK A;  1B69 A;  2EOJ A;  1A1H A;  2JXP A;  2LMZ A;  4GEQ B;  4M2Z A;  4DKK A;  4R2P A;  5T6J A;  2E5L E;  2RS7 A;  1YUJ A;  2ELZ A;  2EOY A;  5CFF E;  2EQ3 A;  3BGH A;  2EN8 A;  2EE8 A;  1YZ9 A;  4OOG C;  4BHC A;  3ADL A;  2YTF A;  1WHN A;  5AE3 A;  2EZ6 A;  4LU9 A;  3TQM A;  2HHH E;  2JYA A;  3IWD A;  2LJH A;  2YTJ A;  5LMN E;  3F6H A;  1YFH A;  2L6M A;  3BF2 A;  2DMY A;  3KZY A;  2FTX B;  5AC4 A;  2EPN A;  4X62 E;  5FLX C;  2L2K B;  2YTO A;  4YHH E;  2LJU A;  3MSW A;  3JAM C;  1MGT A;  5KL6 A;  2M9A A;  4DV2 E;  2KOU A;  4JV5 E;  4ZYE A;  2WBS A;  4NXN E;  4BC9 A;  1NEI A;  2EML A;  2V88 A;  1XMO E;  4JI0 E;  4DMI A;  5KL7 A;  1UHZ A;  2BBG A;  1XNR E;  4DR5 E;  5KL4 A;  2J7J A;  2K4V A;  1BB8 A;  4F9A B;  4Q35 B;  5LLQ A;  4R2D A;  5IWA E;  1NCS A;  2WBT A;  1YSA C;  1MEY C;  2UXB E;  1EKZ A;  2K7I A;  2YTE A;  1HNX E;  4ZYG A;  3QG5 C;  2GPI A;  2N3G A;  3THN A;  5BR8 E;  3ADJ A;  1A1K A;  1WRJ A;  2LTR A;  2EMX A;  2EN6 A;  1DI2 A;  1N34 E;  1BBG A;  1G2F C;  2YTN A;  4R03 A;  2N3H A;  1A1L A;  4DR6 E;  2VE7 C;  5KL3 A;  2JOX A;  1J5E E;  4DV3 E;  2L92 A;  3T1H E;  2RSI A;  2ODR C;  2LTS A;  2JP9 A;  3JTZ A;  2HJJ A;  1YPN A;  1IQO A;  3THO B;  5A6B D;  1EH8 A;  4X9J A;  4TUG A;  1TF3 A;  2DRP A;  3HPZ A;  1ZBT A;  4NXM E;  2EMW A;  3ECR A;  4X65 E;  2EOM A;  2UUC E;  4F6M A;  4JI2 E;  3JU0 A;  2EWL A;  3RMP A;  2M4I A;  2GLI A;  2EMG A;  2M1S A;  3C6M A;  3VHT B;  3F6G A;  2ELY A;  4ZYH A;  4F54 A;  3DF6 A;  2EM9 A;  3EPK A;  1YUI A;  1J26 A;  2KON A;  1T4O A;  4BMJ A;  3J7A G;  2JPA A;  2R1F A;  2EJ4 A;  2LBS B;  4MLV A;  1YYK A;  3DJW A;  2DLQ A;  2EOQ A;  5IT9 C;  4R2Q A;  1PKP A;  2YRH A;  1KYQ A;  1N3G A;  2EMK A;  1UN6 B;  2L2N A;  2YSP A;  3OTO E;  5A6B A;  1X6F A;  2EM5 A;  1KJK A;  1N36 E;  4HTG A;  5AE2 A;  1UBD C;  4DR4 E;  2UXC E;  2EPC A;  2FV4 B;  2YTQ A;  2NAB A;  2F4V E;  2EPO A;  2EPA A;  1X49 A;  3K6Q A;  4GKJ E;  5KL2 A;  3LML A;  1AH5 A;  2EM4 A;  2HC5 A;  2YT4 A;  4FK5 C;  4R2E A;  2LRS A;  2MC6 A;  2E72 A;  4BCA A;  2WBU A;  2JY9 A;  5TSE A;  2NUG A;  1IMU A;  4DR3 E;  2EOO A;  2LV2 A;  4DV5 E;  5AE1 A;  2A25 A;  2MDG A;  2UUA E;  2R76 A;  4IJD A;  4AQY E;  4WFT A;  5ADZ A;  4LF7 E;  4L8N A;  2EQ1 A;  2JR1 A;  5A6K A;  1WHQ A;  4R2A A;  3P1X A;  1IBK E;  5AC5 A;  4DR2 E;  1A1F A;  1TN9 A;  2DGC A;  2ADR A;  4WYQ B;  4DV1 E;  2EP3 A;  4R8O A;  5AAS A;  2WZO A;  3HPS A;  2EMC A;  2EM2 A;  2JOB A;  4WSG A;  4M30 A;  3VYX A;  2BB8 A;  2EN7 A;  4IS1 C;  2LVH A;  4NHR A;  2YRM A;  2Q8U A;  2MDR A;  1N33 E;  2EMA A;  1WXR A;  4TUI A;  2YU5 A;  2EL6 A;  2VRD A;  2MKN A;  2EMH A;  4WPY A;  4NZV A;  4O43 A;  2EOZ A;  1AAY A;  2EPL X;  1IQS A;  1JK1 A;  2YTP A;  2EMF A;  2HGH A;  1RQ0 A;  4X8W A;  2YSO A;  3EPJ A;  1T39 A;  4LFC E;  1P47 A;  2EL5 A;  2YU8 A;  3J81 C;  2V8Q B;  3EPH A;  1TF6 A;  3IWB A;  2LO3 A;  2UUB E;  4LFB E;  2L2M A;  2EM0 A;  2V89 A;  2NUE A;  2EPX A;  5F3W A;  1X5W A;  2H36 X;  5KL5 A;  2ENH A;  3BBG A;  2ENC A;  5LL6 R;  3OML A;  5LMU E;  2EN1 A;  4WXC A;  1DGC A;  4P7D A;  4JI7 E;  4K0K E;  4R2C A;  4BC7 A;  1T4L B;  2EQ0 A;  1FJG E;  2EN4 A;  4OX9 E;  1X48 A;  2DSY A;  5A6J A; 
#chains in the Genus database with same CATH homology
 2EOE A;  1A1I A;  1UBD C;  5KL6 A;  2M9A A;  2EM7 A;  2EPC A;  1A1G A;  2YTQ A;  2NAB A;  2EPA A;  2WBS A;  5KL2 A;  2EMI A;  2EM8 A;  1G2D C;  2EML A;  2EOF A;  2EM4 A;  4FK5 C;  5KL7 A;  2ENA A;  4R2E A;  2YTI A;  2WBU A;  2E72 A;  5KL4 A;  2J7J A;  3MHH C;  1BB8 A;  2EOO A;  2EPP A;  2LV2 A;  4R2D A;  1NCS A;  2WBT A;  2EM3 A;  2WCC 3;  4GZN C;  1WJP A;  1MEY C;  1YSA C;  2EOR A;  2A25 A;  3EPL A;  4M9V C;  2MKD A;  2MDG A;  2LT7 A;  4F6N A;  2YTE A;  2EM6 A;  3UK3 C;  2EN2 A;  4R2R A;  1ZR9 A;  4IJD A;  2YTG A;  2EQ1 A;  4R2A A;  4R2S A;  2EPZ A;  2LCE A;  2EOI A;  1A1K A;  1A1F A;  1X3C A;  2EOX A;  2D9H A;  1TN9 A;  2DGC A;  2ADR A;  2EMX A;  2EN6 A;  1X6H A;  1G2F C;  2YTN A;  1X6E A;  2EMB A;  2EP3 A;  1LLM C;  1A1L A;  2EMY A;  1BBO A;  5KL3 A;  2EMC A;  2EM2 A;  2DMI A;  2RSI A;  4WSG A;  2EN3 A;  2BB8 A;  2EN7 A;  4IS1 C;  2LVH A;  2JP9 A;  2YRM A;  3M99 B;  2GHF A;  2CT1 A;  2EMA A;  4X9J A;  1TF3 A;  2DRP A;  1ZU1 A;  2EOS A;  2CSH A;  2YU5 A;  2EMW A;  2EOM A;  2PRT A;  2EL6 A;  2EL4 A;  2VRD A;  2MKN A;  2EMH A;  4F6M A;  2YRK A;  2EOZ A;  1AAY A;  1B69 A;  1ZAA C;  2EOJ A;  1JK1 A;  1A1H A;  2YTP A;  2EMF A;  2HGH A;  4R2P A;  2GLI A;  2YSO A;  3EPJ A;  1YUJ A;  2ELZ A;  2EMG A;  1P47 A;  2EL5 A;  2EOY A;  2YU8 A;  2EQ3 A;  3EPH A;  1TF6 A;  2CTD A;  3VHT B;  1Z1B A;  2LO3 A;  2ELY A;  2EN8 A;  2EE8 A;  2EM0 A;  1KJK A;  2EPU A;  2YTD A;  2EM9 A;  2EOH A;  4F2J C;  1A1J A;  3EPK A;  2EPX A;  3MHS C;  1YUI A;  2EPR A;  2YTF A;  1X5W A;  5KL5 A;  2ENH A;  2ENC A;  1RMD A;  1JK2 A;  2JPA A;  2EN1 A;  2R1F A;  2RPC A;  2EJ4 A;  1F2I G;  1DGC A;  2DLQ A;  4R2C A;  2EOQ A;  2YTJ A;  4R2Q A;  2YRH A;  2EMK A;  1UN6 B;  2EQ0 A;  2YSP A;  2EMZ A;  2EN4 A;  1X6F A;  2I13 A;  2EM5 A;  2YTO A;  2DLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...