3ADIA

Structure of arabidopsis hyl1 and its molecular implications for mirna processing
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
71
Chain Sequence
HVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation/rna
molecule keywords F21M12.9 protein
total genus 18
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adiA00
1IBLE 4B3ME 4JI6E 1ZBTA 1EKZA 1X47A 3J7Yp 2L3JA 4JI0E 4YHHE 4DV5E 1O0WA 3ADGA 4M30A 1T4OA 2F4VE 1IBKE 2DIXA 4DV0E 4X8WA 4DR4E 5LMNE 4WFTA 4DV2E 1YZ9A 4LF4E 4JYAE 5BR8E 2B7TA 2L2MA 2RS6A 4WYQB 2E5LE 4JV5E 2HHHE 1RQ0A 4JI7E 5LMUE 2UUCE 3ADLA 1T4NA 2MDRA 1HNZE 1STUA 1FKAE 3P1XA 2L2NA 2VQFE 2DMYA 1GQEA 2UUBE 4DR6E 4LF7E 4DR2E 4JI3E 4X65E 4DR5E 4JI1E 2LTSA 2LRSA 1XNRE 3VYYA 2UU9E 5IWAE 2JY9A 2B7VA 2CPNA 4YY3E 4B3TE 4K0KE 1FJGE 4B3SE 3T1HE 4DR3E 4LFCE 2LJHA 1WHQA 2JVAA 4LFBE 4GKKE 1HR0E 4GKJE 1QU6A 3ADJA 4DV7E 4LF5E 4DR7E 1YYOA 4NXNE 4AQYE 1N33E 1YYWA 1HNXE 2NUFA 4JI4E 2KHXA 4NXME 2RS7A 1J26A 4DUZE 1X48A 3VYXA 1DI2A 1WHNA 2RSMA 4LF9E 2DB2A 4KHPE 2IHR1 2YT4A 4X62E 3ADIA 4OOGC 4DV1E 2N3GA 2NA2A 2NUGA 2B3TB 3C4BA 4DR1E 4LF8E 2RTXA 2VQEE 2L3CA 4JI5E 4LF6E 2L2KB 1HNWE 1XNQE 3C4TA 2UXCE 1XMOE 1N34E 4LFAE 4DV6E 2L33A 3T1YE 1N32E 2EZ6A 2UXDE 5CFFE 1J5EE 3OTOE 2LTRA 2UXBE 4DV4E 4M2ZA 4X66E 1PKPA 2N3HA 2LUPB 2ZM6E 1RC7A 4JI2E 1XMQE 4DUYE 1X49A 2UUAE 1IBME 4DKKA 1N36E 2NUEA 4DV3E 1T4LB 2LUQA 2LBSB 4B3RE 1YYKA 4OX9E 3HTXA 1UHZA 4X64E 1I94E 1UILA 4JI8E 3LLHA
chains in the Genus database with same CATH superfamily
2EORA 3BF2A 4B3ME 4NZVA 2EPMX 3MHSC 2L3JA 4JI0E 2YTNA 1O0WA 2EJ4A 2EMIA 2L8TA 2YRHA 4WSGA 1LLMC 4LF4E 2GPIA 4JYAE 4MLVA 5BR8E 4BMJA 5IV8B 2FV4B 2EN1A 1A1IA 2EM9A 2I9IA 3JTZA 1ZBQA 5LMUE 1AH5A 2K7IA 2YPNA 2EMFA 5A2QC 1STUA 2EM6A 2EM0A 3P1XA 1KYQA 2JP9A 4R03A 4DMIA 1X3CA 2DMYA 2MDGA 4M9VC 2EMXA 1GQEA 5LLQA 4LF7E 2ADRA 4FK5C 2JYAA 3AV0A 4JI1E 2LTSA 4BCAA 1X5WA 3FIGA 1A1FA 1XNRE 2UU9E 2YTJA 3EPLA 4YY3E 4B3SE 1A1GA 2EPKX 5A6BA 1EH6A 5TSEA 2EOQA 1A1KA 4R2AA 3RMPA 2B9DA 4LF5E 2EP3A 1YYOA 2EMGA 2YTQA 4AQYE 1HNXE 1SR9A 4N4RB 4NXME 2EMKA 2YU8A 3KWRA 2LE2A 2DMIA 2EMYA 1WHNA 5LL6R 2YTDA 2YT4A 4R2RA 5AASA 4X62E 2WZOA 4DV1E 1WJPA 2N3GA 2JOXA 2A25A 4LF8E 3J80C 5AE2A 2L3CA 2ELZA 2EOIA 2M9AA 4BC9A 2UXCE 1PJSA 4TUGA 5KL6A 1N32E 2LV2A 3MHHC 2EZ6A 2UXDE 5KL3A 2WBUA 4BS9A 3IWCA 3EPKA 2CT1A 2EL6A 4M2ZA 1PKPA 1L4SA 3L00A 4F9BB 2ZM6E 4GZNC 1RC7A 1XMQE 3HXLA 1F2IG 2UUAE 2JXPA 2EN8A 1T4LB 2MKNA 4M0VA 4OX9E 1YYKA 3EPHA 3H09A 2EPXA 2KONA 4JI6E 2RQLA 2FGGA 1ZBTA 1X47A 2HGHA 3OMLA 1DGCA 4ZYHA 2EN6A 5A6JA 2EOZA 2DRPA 1T4OA 1JK2A 1IBKE 2DIXA 1ZR9A 4DV0E 2EM8A 4IS1C 4DV2E 2EOSA 2EM2A 2EOYA 2L2MA 2RS6A 1YUJA 4LTYA 4F6MA 2E5LE 1RQ0A 4JI7E 3IWDA 3ADLA 2R1FA 1FKAE 4R2SA 2RPCA 2EMHA 3ZOQB 2VQFE 4ZYDA 4Q28A 2NABA 3UK3C 2EN7A 2EL4A 2JWOA 1PJQA 2L92A 2LRSA 5AC5A 2JY9A 3C6MA 3TQMA 2CPNA 1DQ3A 2WBSA 2EM3A 4DR3E 1WHQA 2EPNA 1P47A 1HR0E 5IXMB 4DV7E 1WRJA 1BBGA 1G2DC 3EPJA 4JI4E 2M1SA 4WXDA 2L6MA 1J26A 1QNTA 1NEIA 4WPYA 2EMLA 4NHRA 2EPRA 4KHPE 2DB2A 2FTXB 2IHR1 2LVHA 2PRTA 2YTOA 2BB8A 2EM4A 2RTXA 3MSWA 2EOFA 3BIDA 3KZZA 2DGCA 2ENAA 1HNWE 2EPPA 3LMLA 2GLIA 3EQ1A 4LFAE 4DV6E 2EOXA 1EH8A 1TF3A 1J5EE 1X6FA 2HJJA 1WXRA 2UXBE 4LU9A 4DV4E 4X66E 3BGHA 5KL5A 3BBGA 3QG5C 4DUYE 1X49A 2BBGA 3DJWA 1NCSA 2LUQA 4O4KA 1T38A 4B3RE 3HTXA 2EQ1A 4MLQA 1UILA 1YFHA 4I8OA 2CTDA 2V83A 2EN4A 2J7JA 1EKZA 3J7Yp 2EOEA 4YHHE 4DV5E 3ADGA 2KOUA 3IWBA 4F9CB 3HPZA 2YRKA 4X8WA 5F3WA 2EOJA 2ENHA 1MGTA 2LO3A 4IJDA 4L8NA 4WYQB 4L5NC 1IMUA 5FLXC 2HHHE 3THNA 3HPSA 2UUCE 1JK1A 2EN2A 4RH8A 3F6HA 2VE7C 2YU5A 2EN3A 2YRMA 4WSPA 4F2JC 3JU0A 4JI3E 4P7DA 4X65E 1N3GA 4DR5E 2DSYA 4KWYA 4R2CA 2ODRD 3VYYA 1X6EA 2B7VA 4F54A 2R76A 4TUIA 1YUIA 1KJKA 4B3TE 4K0KE 1FJGE 1TN9A 2LJHA 2V8QB 2JVAA 4ZYEA 4LFBE 4GKKE 4GKJE 4J8ZA 1QU6A 2LCEA 5A6AA 3ADJA 4DR7E 2GHFA 2MKDA 1N33E 1IQSA 1YYWA 4O24A 4Q35B 4DUZE 2WBTA 1X48A 3VYXA 4O5GA 4R2QA 2EMBA 3THOB 4LF9E 2RSIA 2WCC3 2DLKA 3KZYA 3ADIA 2EM5A 2ENCA 2NA2A 4R8OA 3J81C 2B3TB 2EPOA 2V88A 2VQEE 4F6NA 2YSOA 2EPZA 2EM7A 5ADZA 1XNQE 5KL7A 1XMOE 2L33A 2HC5A 4R2PA 2V89A 5CFFE 1ZAAC 3OTOE 4P78A 2EOMA 4R2DA 2YTIA 2LTRA 1Z1BA 2EE8A 2N3HA 5A6KA 2I13A 2MC6A 4JI2E 1IBME 2YTEA 5AE3A 2VRDA 1N36E 3K6QA 2ELYA 4DV3E 5A6BD 2LBSB 1GZ6A 2K4VA 4JI8E 3LLHA 4JI5E 1IBLE 2JPAA 3HQ1A 2E72A 4BHCA 2D9HA 1UN6B 4M30A 4X9JA 2F4VE 4F9AB 2V85A 2YSPA 5KL4A 4DR4E 5LMNE 4WFTA 2M7QA 1YZ9A 4BHBA 2LJUA 2EMCA 2B7TA 2G7HA 2M4IA 4BC7A 4JV5E 3C6KA 1T39A 1T4NA 2MDRA 1G2FC 1HNZE 2EQ3A 2JR1A 4KZSA 2LMZA 1A1JA 1YSAC 2V87A 1ZU1A 2E1MA 2L2NA 2EOOA 4O43A 5KL2A 2EWLA 2UUBE 4DR6E 4DR2E 2YZTA 1TF6A 5IWAE 3DF6A 4HTGA 5AE1A 1MEYC 2YTPA 2EOHA 3JAMC 4WX9A 2MC5A 3T1HE 4LFCE 2YWQA 1X6HA 2VF1A 2N8XA 4GEQB 1PJTA 2EMAA 3VK6A 4NXNE 3F6GA 5AC4A 2NUFA 2KHXA 2RS7A 3J7AG 3AUZA 1DI2A 2EPLX 2F8BA 1PDAA 2RSMA 4R2EA 1BBOA 1IQOA 2Q8UA 1A1LA 3M99B 1EH7A 4OOGC 2EMZA 4HEIA 2NUGA 3C4BA 4DR1E 2EL5A 1B69A 4LF6E 2L2KB 2EPCA 4WXCA 3VHTB 5T6JA 3C4TA 2JOBA 1AAYA 1N34E 2DLQA 3T1YE 2EMWA 1RMDA 2EPAA 2CSHA 2EPUA 5IT9C 2ODRC 5DNYA 1UBDC 2EQ0A 2LT7A 1SFEA 2V86A 2LUPB 1A1HA 1GTKA 4ZYGA 2H36X 4BBYA 4DKKA 1BB8A 4RHBB 2YTFA 1YPNA 5A69A 2NUEA 2YTGA 3ECRA 1UHZA 4X64E 1I94E
chains in the Genus database with same CATH topology
2KONA 1IBLE 4I8OA 4B3ME 3HQ1A 4JI6E 2V83A 2FGGA 1ZBTA 1EKZA 1X47A 3J7Yp 2L3JA 4JI0E 3OMLA 4YHHE 4DV5E 1O0WA 2KOUA 3ADGA 4M30A 1T4OA 3IWBA 4F9CB 1I94E 3HPZA 4F9AB 1IBKE 2V85A 2F4VE 2DIXA 4DV0E 4X8WA 5F3WA 2L8TA 4DR4E 5LMNE 4WFTA 2M7QA 4DV2E 1YZ9A 4LF4E 4JYAE 5BR8E 2B7TA 4BMJA 2L2MA 4L8NA 2G7HA 2RS6A 2M4IA 4WYQB 4L5NC 4LTYA 2FV4B 5FLXC 4BC7A 2E5LE 4JV5E 2HHHE 3JTZA 1RQ0A 3HPSA 1ZBQA 4JI7E 3IWDA 5LMUE 2UUCE 3ADLA 1T4NA 2MDRA 3F6HA 1HNZE 5A2QC 1STUA 2JR1A 2VE7C 4KZSA 2LMZA 1FKAE 3P1XA 2V87A 2E1MA 2L2NA 4R03A 4DMIA 2VQFE 2DMYA 4WSPA 3ZOQB 1GQEA 4Q28A 2EWLA 2UUBE 4DR6E 3JU0A 4DR2E 4LF7E 4JI3E 4P7DA 2JWOA 4X65E 4DR5E 2DSYA 2YZTA 3AV0A 2L92A 2ODRD 4JI1E 2LTSA 4BCAA 3FIGA 2LRSA 1XNRE 3VYYA 2UU9E 5IWAE 2JY9A 3DF6A 2B7VA 2CPNA 4F54A 4YY3E 1DQ3A 5AE1A 4TUIA 4B3TE 3JAMC 4K0KE 1FJGE 4B3SE 2MC5A 3T1HE 4DR3E 4LFCE 2LJHA 1WHQA 2JVAA 2V8QB 4LFBE 4GKKE 2VF1A 1HR0E 4GKJE 4J8ZA 1QU6A 4GEQB 3RMPA 2B9DA 3ADJA 4DV7E 4LF5E 3VK6A 1YYOA 4NXNE 4DR7E 4AQYE 3F6GA 1N33E 1YYWA 1HNXE 2NUFA 1SR9A 4JI4E 2KHXA 2M1SA 4NXME 2RS7A 2L6MA 1J26A 3J7AG 3AUZA 4DUZE 1X48A 3KWRA 3VYXA 4WPYA 1DI2A 2LE2A 2F8BA 1WHNA 2RSMA 5LL6R 2DB2A 4LF9E 4KHPE 2FTXB 2IHR1 2YT4A 5AASA 4X62E 3ADIA 2WZOA 4OOGC 4DV1E 2N3GA 2NA2A 2JOXA 4R8OA 2NUGA 3J81C 2B3TB 3C4BA 4DR1E 4LF8E 2RTXA 5AE2A 3MSWA 2V88A 3J80C 2L3CA 2VQEE 4JI5E 4LF6E 2L2KB 1HNWE 5ADZA 5T6JA 1XNQE 3LMLA 3C4TA 4BC9A 2JOBA 1XMOE 1N34E 2UXCE 4LFAE 4TUGA 2L33A 4DV6E 3T1YE 1N32E 2V89A 2EZ6A 2UXDE 5CFFE 5IT9C 4BS9A 3IWCA 3OTOE 4P78A 1J5EE 2ODRC 5DNYA 1WXRA 2LTRA 4LU9A 4DV4E 2UXBE 4M2ZA 4X66E 1PKPA 2V86A 2N3HA 2LUPB 4F9BB 2ZM6E 2MC6A 1RC7A 1XMQE 3HXLA 2H36X 4BBYA 4DUYE 4JI2E 1X49A 2UUAE 1IBME 4DKKA 5AE3A 1N36E 3DJWA 3K6QA 2NUEA 4DV3E 1T4LB 2LUQA 2LBSB 4B3RE 4M0VA 4OX9E 1GZ6A 2K4VA 1YYKA 1UHZA 3HTXA 4X64E 3H09A 1UILA 4JI8E 3LLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL E;  4B3M E;  4JI6 E;  1ZBT A;  1EKZ A;  1X47 A;  3J7Y p;  2L3J A;  4JI0 E;  4YHH E;  4DV5 E;  1O0W A;  3ADG A;  4M30 A;  1T4O A;  2F4V E;  1IBK E;  2DIX A;  4DV0 E;  4X8W A;  4DR4 E;  5LMN E;  4WFT A;  4DV2 E;  1YZ9 A;  4LF4 E;  4JYA E;  5BR8 E;  2B7T A;  2L2M A;  2RS6 A;  4WYQ B;  2E5L E;  4JV5 E;  2HHH E;  1RQ0 A;  4JI7 E;  5LMU E;  2UUC E;  3ADL A;  1T4N A;  2MDR A;  1HNZ E;  1STU A;  1FKA E;  3P1X A;  2L2N A;  2VQF E;  2DMY A;  1GQE A;  2UUB E;  4DR6 E;  4LF7 E;  4DR2 E;  4JI3 E;  4X65 E;  4DR5 E;  4JI1 E;  2LTS A;  2LRS A;  1XNR E;  3VYY A;  2UU9 E;  5IWA E;  2JY9 A;  2B7V A;  2CPN A;  4YY3 E;  4B3T E;  4K0K E;  1FJG E;  4B3S E;  3T1H E;  4DR3 E;  4LFC E;  2LJH A;  1WHQ A;  2JVA A;  4LFB E;  4GKK E;  1HR0 E;  4GKJ E;  1QU6 A;  3ADJ A;  4DV7 E;  4LF5 E;  4DR7 E;  1YYO A;  4NXN E;  4AQY E;  1N33 E;  1YYW A;  1HNX E;  2NUF A;  4JI4 E;  2KHX A;  4NXM E;  2RS7 A;  1J26 A;  4DUZ E;  1X48 A;  3VYX A;  1DI2 A;  1WHN A;  2RSM A;  4LF9 E;  2DB2 A;  4KHP E;  2IHR 1;  2YT4 A;  4X62 E;  3ADI A;  4OOG C;  4DV1 E;  2N3G A;  2NA2 A;  2NUG A;  2B3T B;  3C4B A;  4DR1 E;  4LF8 E;  2RTX A;  2VQE E;  2L3C A;  4JI5 E;  4LF6 E;  2L2K B;  1HNW E;  1XNQ E;  3C4T A;  2UXC E;  1XMO E;  1N34 E;  4LFA E;  4DV6 E;  2L33 A;  3T1Y E;  1N32 E;  2EZ6 A;  2UXD E;  5CFF E;  1J5E E;  3OTO E;  2LTR A;  2UXB E;  4DV4 E;  4M2Z A;  4X66 E;  1PKP A;  2N3H A;  2LUP B;  2ZM6 E;  1RC7 A;  4JI2 E;  1XMQ E;  4DUY E;  1X49 A;  2UUA E;  1IBM E;  4DKK A;  1N36 E;  2NUE A;  4DV3 E;  1T4L B;  2LUQ A;  2LBS B;  4B3R E;  1YYK A;  4OX9 E;  3HTX A;  1UHZ A;  4X64 E;  1I94 E;  1UIL A;  4JI8 E;  3LLH A; 
#chains in the Genus database with same CATH topology
 2EOR A;  3BF2 A;  4B3M E;  4NZV A;  2EPM X;  3MHS C;  2L3J A;  4JI0 E;  2YTN A;  1O0W A;  2EJ4 A;  2EMI A;  2L8T A;  2YRH A;  4WSG A;  1LLM C;  4LF4 E;  2GPI A;  4JYA E;  4MLV A;  5BR8 E;  4BMJ A;  5IV8 B;  2FV4 B;  2EN1 A;  1A1I A;  2EM9 A;  2I9I A;  3JTZ A;  1ZBQ A;  5LMU E;  1AH5 A;  2K7I A;  2YPN A;  2EMF A;  5A2Q C;  1STU A;  2EM6 A;  2EM0 A;  3P1X A;  1KYQ A;  2JP9 A;  4R03 A;  4DMI A;  1X3C A;  2DMY A;  2MDG A;  4M9V C;  2EMX A;  1GQE A;  5LLQ A;  4LF7 E;  2ADR A;  4FK5 C;  2JYA A;  3AV0 A;  4JI1 E;  2LTS A;  4BCA A;  1X5W A;  3FIG A;  1A1F A;  1XNR E;  2UU9 E;  2YTJ A;  3EPL A;  4YY3 E;  4B3S E;  1A1G A;  2EPK X;  5A6B A;  1EH6 A;  5TSE A;  2EOQ A;  1A1K A;  4R2A A;  3RMP A;  2B9D A;  4LF5 E;  2EP3 A;  1YYO A;  2EMG A;  2YTQ A;  4AQY E;  1HNX E;  1SR9 A;  4N4R B;  4NXM E;  2EMK A;  2YU8 A;  3KWR A;  2LE2 A;  2DMI A;  2EMY A;  1WHN A;  5LL6 R;  2YTD A;  2YT4 A;  4R2R A;  5AAS A;  4X62 E;  2WZO A;  4DV1 E;  1WJP A;  2N3G A;  2JOX A;  2A25 A;  4LF8 E;  3J80 C;  5AE2 A;  2L3C A;  2ELZ A;  2EOI A;  2M9A A;  4BC9 A;  2UXC E;  1PJS A;  4TUG A;  5KL6 A;  1N32 E;  2LV2 A;  3MHH C;  2EZ6 A;  2UXD E;  5KL3 A;  2WBU A;  4BS9 A;  3IWC A;  3EPK A;  2CT1 A;  2EL6 A;  4M2Z A;  1PKP A;  1L4S A;  3L00 A;  4F9B B;  2ZM6 E;  4GZN C;  1RC7 A;  1XMQ E;  3HXL A;  1F2I G;  2UUA E;  2JXP A;  2EN8 A;  1T4L B;  2MKN A;  4M0V A;  4OX9 E;  1YYK A;  3EPH A;  3H09 A;  2EPX A;  2KON A;  4JI6 E;  2RQL A;  2FGG A;  1ZBT A;  1X47 A;  2HGH A;  3OML A;  1DGC A;  4ZYH A;  2EN6 A;  5A6J A;  2EOZ A;  2DRP A;  1T4O A;  1JK2 A;  1IBK E;  2DIX A;  1ZR9 A;  4DV0 E;  2EM8 A;  4IS1 C;  4DV2 E;  2EOS A;  2EM2 A;  2EOY A;  2L2M A;  2RS6 A;  1YUJ A;  4LTY A;  4F6M A;  2E5L E;  1RQ0 A;  4JI7 E;  3IWD A;  3ADL A;  2R1F A;  1FKA E;  4R2S A;  2RPC A;  2EMH A;  3ZOQ B;  2VQF E;  4ZYD A;  4Q28 A;  2NAB A;  3UK3 C;  2EN7 A;  2EL4 A;  2JWO A;  1PJQ A;  2L92 A;  2LRS A;  5AC5 A;  2JY9 A;  3C6M A;  3TQM A;  2CPN A;  1DQ3 A;  2WBS A;  2EM3 A;  4DR3 E;  1WHQ A;  2EPN A;  1P47 A;  1HR0 E;  5IXM B;  4DV7 E;  1WRJ A;  1BBG A;  1G2D C;  3EPJ A;  4JI4 E;  2M1S A;  4WXD A;  2L6M A;  1J26 A;  1QNT A;  1NEI A;  4WPY A;  2EML A;  4NHR A;  2EPR A;  4KHP E;  2DB2 A;  2FTX B;  2IHR 1;  2LVH A;  2PRT A;  2YTO A;  2BB8 A;  2EM4 A;  2RTX A;  3MSW A;  2EOF A;  3BID A;  3KZZ A;  2DGC A;  2ENA A;  1HNW E;  2EPP A;  3LML A;  2GLI A;  3EQ1 A;  4LFA E;  4DV6 E;  2EOX A;  1EH8 A;  1TF3 A;  1J5E E;  1X6F A;  2HJJ A;  1WXR A;  2UXB E;  4LU9 A;  4DV4 E;  4X66 E;  3BGH A;  5KL5 A;  3BBG A;  3QG5 C;  4DUY E;  1X49 A;  2BBG A;  3DJW A;  1NCS A;  2LUQ A;  4O4K A;  1T38 A;  4B3R E;  3HTX A;  2EQ1 A;  4MLQ A;  1UIL A;  1YFH A;  4I8O A;  2CTD A;  2V83 A;  2EN4 A;  2J7J A;  1EKZ A;  3J7Y p;  2EOE A;  4YHH E;  4DV5 E;  3ADG A;  2KOU A;  3IWB A;  4F9C B;  3HPZ A;  2YRK A;  4X8W A;  5F3W A;  2EOJ A;  2ENH A;  1MGT A;  2LO3 A;  4IJD A;  4L8N A;  4WYQ B;  4L5N C;  1IMU A;  5FLX C;  2HHH E;  3THN A;  3HPS A;  2UUC E;  1JK1 A;  2EN2 A;  4RH8 A;  3F6H A;  2VE7 C;  2YU5 A;  2EN3 A;  2YRM A;  4WSP A;  4F2J C;  3JU0 A;  4JI3 E;  4P7D A;  4X65 E;  1N3G A;  4DR5 E;  2DSY A;  4KWY A;  4R2C A;  2ODR D;  3VYY A;  1X6E A;  2B7V A;  4F54 A;  2R76 A;  4TUI A;  1YUI A;  1KJK A;  4B3T E;  4K0K E;  1FJG E;  1TN9 A;  2LJH A;  2V8Q B;  2JVA A;  4ZYE A;  4LFB E;  4GKK E;  4GKJ E;  4J8Z A;  1QU6 A;  2LCE A;  5A6A A;  3ADJ A;  4DR7 E;  2GHF A;  2MKD A;  1N33 E;  1IQS A;  1YYW A;  4O24 A;  4Q35 B;  4DUZ E;  2WBT A;  1X48 A;  3VYX A;  4O5G A;  4R2Q A;  2EMB A;  3THO B;  4LF9 E;  2RSI A;  2WCC 3;  2DLK A;  3KZY A;  3ADI A;  2EM5 A;  2ENC A;  2NA2 A;  4R8O A;  3J81 C;  2B3T B;  2EPO A;  2V88 A;  2VQE E;  4F6N A;  2YSO A;  2EPZ A;  2EM7 A;  5ADZ A;  1XNQ E;  5KL7 A;  1XMO E;  2L33 A;  2HC5 A;  4R2P A;  2V89 A;  5CFF E;  1ZAA C;  3OTO E;  4P78 A;  2EOM A;  4R2D A;  2YTI A;  2LTR A;  1Z1B A;  2EE8 A;  2N3H A;  5A6K A;  2I13 A;  2MC6 A;  4JI2 E;  1IBM E;  2YTE A;  5AE3 A;  2VRD A;  1N36 E;  3K6Q A;  2ELY A;  4DV3 E;  5A6B D;  2LBS B;  1GZ6 A;  2K4V A;  4JI8 E;  3LLH A;  4JI5 E;  1IBL E;  2JPA A;  3HQ1 A;  2E72 A;  4BHC A;  2D9H A;  1UN6 B;  4M30 A;  4X9J A;  2F4V E;  4F9A B;  2V85 A;  2YSP A;  5KL4 A;  4DR4 E;  5LMN E;  4WFT A;  2M7Q A;  1YZ9 A;  4BHB A;  2LJU A;  2EMC A;  2B7T A;  2G7H A;  2M4I A;  4BC7 A;  4JV5 E;  3C6K A;  1T39 A;  1T4N A;  2MDR A;  1G2F C;  1HNZ E;  2EQ3 A;  2JR1 A;  4KZS A;  2LMZ A;  1A1J A;  1YSA C;  2V87 A;  1ZU1 A;  2E1M A;  2L2N A;  2EOO A;  4O43 A;  5KL2 A;  2EWL A;  2UUB E;  4DR6 E;  4DR2 E;  2YZT A;  1TF6 A;  5IWA E;  3DF6 A;  4HTG A;  5AE1 A;  1MEY C;  2YTP A;  2EOH A;  3JAM C;  4WX9 A;  2MC5 A;  3T1H E;  4LFC E;  2YWQ A;  1X6H A;  2VF1 A;  2N8X A;  4GEQ B;  1PJT A;  2EMA A;  3VK6 A;  4NXN E;  3F6G A;  5AC4 A;  2NUF A;  2KHX A;  2RS7 A;  3J7A G;  3AUZ A;  1DI2 A;  2EPL X;  2F8B A;  1PDA A;  2RSM A;  4R2E A;  1BBO A;  1IQO A;  2Q8U A;  1A1L A;  3M99 B;  1EH7 A;  4OOG C;  2EMZ A;  4HEI A;  2NUG A;  3C4B A;  4DR1 E;  2EL5 A;  1B69 A;  4LF6 E;  2L2K B;  2EPC A;  4WXC A;  3VHT B;  5T6J A;  3C4T A;  2JOB A;  1AAY A;  1N34 E;  2DLQ A;  3T1Y E;  2EMW A;  1RMD A;  2EPA A;  2CSH A;  2EPU A;  5IT9 C;  2ODR C;  5DNY A;  1UBD C;  2EQ0 A;  2LT7 A;  1SFE A;  2V86 A;  2LUP B;  1A1H A;  1GTK A;  4ZYG A;  2H36 X;  4BBY A;  4DKK A;  1BB8 A;  4RHB B;  2YTF A;  1YPN A;  5A69 A;  2NUE A;  2YTG A;  3ECR A;  1UHZ A;  4X64 E;  1I94 E; 
#chains in the Genus database with same CATH homology
 2KON A;  1IBL E;  4I8O A;  4B3M E;  3HQ1 A;  4JI6 E;  2V83 A;  2FGG A;  1ZBT A;  1EKZ A;  1X47 A;  3J7Y p;  2L3J A;  4JI0 E;  3OML A;  4YHH E;  4DV5 E;  1O0W A;  2KOU A;  3ADG A;  4M30 A;  1T4O A;  3IWB A;  4F9C B;  1I94 E;  3HPZ A;  4F9A B;  1IBK E;  2V85 A;  2F4V E;  2DIX A;  4DV0 E;  4X8W A;  5F3W A;  2L8T A;  4DR4 E;  5LMN E;  4WFT A;  2M7Q A;  4DV2 E;  1YZ9 A;  4LF4 E;  4JYA E;  5BR8 E;  2B7T A;  4BMJ A;  2L2M A;  4L8N A;  2G7H A;  2RS6 A;  2M4I A;  4WYQ B;  4L5N C;  4LTY A;  2FV4 B;  5FLX C;  4BC7 A;  2E5L E;  4JV5 E;  2HHH E;  3JTZ A;  1RQ0 A;  3HPS A;  1ZBQ A;  4JI7 E;  3IWD A;  5LMU E;  2UUC E;  3ADL A;  1T4N A;  2MDR A;  3F6H A;  1HNZ E;  5A2Q C;  1STU A;  2JR1 A;  2VE7 C;  4KZS A;  2LMZ A;  1FKA E;  3P1X A;  2V87 A;  2E1M A;  2L2N A;  4R03 A;  4DMI A;  2VQF E;  2DMY A;  4WSP A;  3ZOQ B;  1GQE A;  4Q28 A;  2EWL A;  2UUB E;  4DR6 E;  3JU0 A;  4DR2 E;  4LF7 E;  4JI3 E;  4P7D A;  2JWO A;  4X65 E;  4DR5 E;  2DSY A;  2YZT A;  3AV0 A;  2L92 A;  2ODR D;  4JI1 E;  2LTS A;  4BCA A;  3FIG A;  2LRS A;  1XNR E;  3VYY A;  2UU9 E;  5IWA E;  2JY9 A;  3DF6 A;  2B7V A;  2CPN A;  4F54 A;  4YY3 E;  1DQ3 A;  5AE1 A;  4TUI A;  4B3T E;  3JAM C;  4K0K E;  1FJG E;  4B3S E;  2MC5 A;  3T1H E;  4DR3 E;  4LFC E;  2LJH A;  1WHQ A;  2JVA A;  2V8Q B;  4LFB E;  4GKK E;  2VF1 A;  1HR0 E;  4GKJ E;  4J8Z A;  1QU6 A;  4GEQ B;  3RMP A;  2B9D A;  3ADJ A;  4DV7 E;  4LF5 E;  3VK6 A;  1YYO A;  4NXN E;  4DR7 E;  4AQY E;  3F6G A;  1N33 E;  1YYW A;  1HNX E;  2NUF A;  1SR9 A;  4JI4 E;  2KHX A;  2M1S A;  4NXM E;  2RS7 A;  2L6M A;  1J26 A;  3J7A G;  3AUZ A;  4DUZ E;  1X48 A;  3KWR A;  3VYX A;  4WPY A;  1DI2 A;  2LE2 A;  2F8B A;  1WHN A;  2RSM A;  5LL6 R;  2DB2 A;  4LF9 E;  4KHP E;  2FTX B;  2IHR 1;  2YT4 A;  5AAS A;  4X62 E;  3ADI A;  2WZO A;  4OOG C;  4DV1 E;  2N3G A;  2NA2 A;  2JOX A;  4R8O A;  2NUG A;  3J81 C;  2B3T B;  3C4B A;  4DR1 E;  4LF8 E;  2RTX A;  5AE2 A;  3MSW A;  2V88 A;  3J80 C;  2L3C A;  2VQE E;  4JI5 E;  4LF6 E;  2L2K B;  1HNW E;  5ADZ A;  5T6J A;  1XNQ E;  3LML A;  3C4T A;  4BC9 A;  2JOB A;  1XMO E;  1N34 E;  2UXC E;  4LFA E;  4TUG A;  2L33 A;  4DV6 E;  3T1Y E;  1N32 E;  2V89 A;  2EZ6 A;  2UXD E;  5CFF E;  5IT9 C;  4BS9 A;  3IWC A;  3OTO E;  4P78 A;  1J5E E;  2ODR C;  5DNY A;  1WXR A;  2LTR A;  4LU9 A;  4DV4 E;  2UXB E;  4M2Z A;  4X66 E;  1PKP A;  2V86 A;  2N3H A;  2LUP B;  4F9B B;  2ZM6 E;  2MC6 A;  1RC7 A;  1XMQ E;  3HXL A;  2H36 X;  4BBY A;  4DUY E;  4JI2 E;  1X49 A;  2UUA E;  1IBM E;  4DKK A;  5AE3 A;  1N36 E;  3DJW A;  3K6Q A;  2NUE A;  4DV3 E;  1T4L B;  2LUQ A;  2LBS B;  4B3R E;  4M0V A;  4OX9 E;  1GZ6 A;  2K4V A;  1YYK A;  1UHZ A;  3HTX A;  4X64 E;  3H09 A;  1UIL A;  4JI8 E;  3LLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...