3ADIA

Structure of arabidopsis hyl1 and its molecular implications for mirna processing
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
71
Chain Sequence
HVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/rna
molecule keywords F21M12.9 protein
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 18
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adiA00
2L2MA 1WHNA 4K0KE 2L33A 1YYWA 4DR6E 4LF9E 1QU6A 2F4VE 2KHXA 2YT4A 4DV4E 1XNQE 4B3ME 2RSMA 4DUYE 4DV7E 1RQ0A 4OX9E 4JI8E 2LJHA 3OTOE 4M30A 4LF4E 2UXDE 3ADIA 2IHR1 2RS6A 3C4TA 2DB2A 3VYXA 1YYOA 3P1XA 4DR2E 4M2ZA 4DV5E 2ZM6E 4X65E 2B7TA 3C4BA 1N32E 2UUCE 2LUQA 1I94E 2LRSA 4JYAE 5LMUE 4JI0E 1IBKE 4DKKA 4DR5E 1XNRE 1FJGE 1N34E 5LMNE 2UXCE 2VQFE 1J26A 4B3RE 2LTRA 1IBME 2UUAE 4X66E 1STUA 2LTSA 1GQEA 2HHHE 4JI7E 3ADLA 3T1HE 3ADJA 4B3SE 4AQYE 2B7VA 3J7Yp 2DMYA 1UHZA 2DIXA 2MDRA 5IWAE 2JY9A 1J5EE 4DV1E 1T4OA 3ADGA 4OOGC 4X64E 2UU9E 1DI2A 1HNWE 5CFFE 2L3JA 2LBSB 2UXBE 4LF8E 1HNXE 1YZ9A 4YHHE 2EZ6A 4JI2E 4DV6E 2RTXA 2CPNA 1T4NA 1XMQE 1IBLE 4NXME 1YYKA 2JVAA 4KHPE 5BR8E 4YY3E 2NUFA 4DV0E 1UILA 4GKJE 3T1YE 4GKKE 4LFAE 4X62E 4LF5E 2NUGA 4X8WA 4NXNE 4LFBE 1X49A 1RC7A 1O0WA 2B3TB 1PKPA 4JI6E 2L2KB 1N33E 4DV3E 4JV5E 2L2NA 4LF6E 1EKZA 2UUBE 4WFTA 2L3CA 4DV2E 1XMOE 1HR0E 2NA2A 2E5LE 4LF7E 2N3HA 1T4LB 2RS7A 4DR1E 4LFCE 1FKAE 1HNZE 4DUZE 4JI3E 3VYYA 1N36E 2N3GA 4DR3E 3LLHA 4JI4E 1X48A 4DR7E 4WYQB 1WHQA 2LUPB 1ZBTA 2VQEE 4JI5E 4B3TE 1X47A 3HTXA 4JI1E 4DR4E 2NUEA
chains in the Genus database with same CATH superfamily
1WHNA 4P7DA 2EM7A 4DR6E 3FIGA 5A69A 4LTYA 4B3ME 2RSMA 2V83A 3EPJA 4DV7E 1IQSA 2EOZA 5IV8B 2LJHA 3BF2A 2YSOA 1DGCA 3AV0A 4IS1C 3KWRA 3P1XA 1PJSA 4M2ZA 2EM3A 2JOBA 2I9IA 3C4BA 4R2PA 2EPXA 2F8BA 2UUCE 2EMKA 2LRSA 3HPSA 5A6BA 1UN6B 1BBOA 4DR5E 3MHSC 1FJGE 1N34E 5LMNE 1J26A 3JAMC 4B3RE 2LTRA 1IBME 5DNYA 4JI7E 2YRHA 4I8OA 1EH8A 2EMGA 2YTEA 3J7Yp 3EQ1A 2BBGA 2V88A 1ZAAC 2EPRA 2YTDA 2EL4A 2L92A 1AAYA 2EM6A 3F6GA 2ELZA 5AE1A 2LCEA 4OOGC 4X64E 2UU9E 4BC9A 1HNWE 2CSHA 4LU9A 4LF8E 3MSWA 1YZ9A 1T38A 4MLVA 2GPIA 2LMZA 2EZ6A 2CPNA 2YTOA 2EP3A 1X6FA 2JVAA 5BR8E 4YY3E 4DV0E 4F2JC 4NZVA 1A1KA 2EOJA 4ZYDA 4BCAA 2E1MA 3EPHA 2NUGA 2YZTA 4NXNE 1N3GA 3IWDA 2B3TB 1PKPA 1IQOA 2EPNA 2YTQA 2V86A 1X6EA 5KL7A 1MEYC 4M9VC 2L2NA 2EWLA 2J7JA 2E5LE 1XMOE 2EM0A 2NA2A 1X3CA 2N3HA 4Q28A 4F54A 1T4LB 1NCSA 2EPCA 4F6NA 2EL6A 2EMBA 2LJUA 3M99B 4WYQB 3JTZA 2LUPB 4JI5E 2WBTA 1L4SA 2NUEA 4NHRA 2EPPA 4WSGA 3EPLA 4K0KE 4N4RB 2L33A 4BBYA 2EOFA 1YYWA 3DF6A 1QU6A 2F4VE 2YT4A 4DV4E 2EJ4A 4DUYE 2M1SA 2MC5A 2DLKA 2EMXA 4LF4E 2UXDE 2RS6A 1YYOA 2KOUA 5KL6A 2Q8UA 2EQ3A 1IMUA 5F3WA 5LMUE 4JI0E 1IBKE 4Q35B 2YSPA 4DKKA 3C6MA 1A1LA 2CTDA 2JP9A 1EH6A 2HC5A 2V8QB 2RPCA 2UUAE 2CT1A 1STUA 2YWQA 1RMDA 2EOMA 4RH8A 4TUGA 2H36X 2M9AA 3ADJA 4L5NC 1WXRA 2FV4B 1UHZA 1WJPA 2MDRA 2DRPA 2GLIA 5IWAE 5AASA 2NABA 1A1JA 1T4OA 5CFFE 2L3JA 2LBSB 5TSEA 2YTJA 3UK3C 3IWBA 2RTXA 2EPOA 1XMQE 1QNTA 4R8OA 2ELYA 2V89A 2MC6A 1YYKA 2NUFA 2EMCA 1UILA 2MKNA 3T1YE 4R2EA 2WCC3 4L8NA 2N8XA 4BC7A 1PJTA 4LFBE 1RC7A 1SR9A 5KL4A 1O0WA 2G7HA 2ENHA 2EN2A 4O5GA 2EMHA 4F6MA 5IT9C 2YU8A 2EPLX 2I13A 2EL5A 2UUBE 4WFTA 1X5WA 4DR1E 4ZYHA 4R2DA 4HEIA 3KZZA 1B69A 1EH7A 4JI3E 2EMIA 1N36E 2HJJA 2N3GA 3H09A 4DR3E 3JU0A 3LLHA 2EMZA 4JI4E 1X48A 2EMFA 4F9BB 4DR7E 2FGGA 5T6JA 2YTPA 4B3TE 2WBUA 3HXLA 2L2MA 2PRTA 1YFHA 2GHFA 1BBGA 1YSAC 4KZSA 2EQ0A 3KZYA 4LF9E 5LLQA 1XNQE 1RQ0A 4OX9E 2JOXA 3OTOE 2JWOA 2EPKX 3J81C 2IHR1 2LVHA 1P47A 1A1IA 3OMLA 2LV2A 2LE2A 2EMAA 4BHCA 3VYXA 4DV5E 4X65E 1Z1BA 4J8ZA 2LUQA 2RSIA 3HPZA 4MLQA 1A1FA 1YPNA 1A1HA 1XNRE 5AE2A 2YTIA 2EPAA 2YRKA 2ENAA 2K4VA 2EOQA 1GQEA 2HHHE 4R03A 4FK5C 2WZOA 1ZR9A 2M7QA 2A25A 3T1HE 1GZ6A 2MKDA 3QG5C 3K6QA 4AQYE 1DQ3A 1YUIA 4R2AA 5A2QC 2EM9A 2DIXA 2EN4A 4DMIA 2JY9A 1G2FC 3THOB 4WXDA 3ADGA 2VE7C 2UXBE 4TUIA 4WSPA 1HNXE 4YHHE 1AH5A 5AC5A 4F9CB 5A6AA 4DV6E 1IBLE 4NXME 5KL2A 1WRJA 2EN3A 4R2QA 2EOIA 2EOHA 2EM8A 2EPUA 2ENCA 4GKJE 1UBDC 4GKKE 5KL3A 4LF5E 1X49A 2EOEA 1KYQA 2VF1A 4JI6E 2EM2A 2M4IA 4DV3E 5A6KA 5ADZA 5A6JA 1A1GA 3DJWA 2E72A 4DV2E 4LF7E 2EN7A 2EOOA 2KONA 2RS7A 2YPNA 4LFCE 4M0VA 1FKAE 3MHHC 1HNZE 4O4KA 2EE8A 3VYYA 3HQ1A 2JXPA 4R2CA 1WHQA 2DLQA 2YU5A 2VQEE 1BB8A 4JI1E 2EMLA 1ZBQA 4P78A 4BHBA 2D9HA 3TQMA 3EPKA 4BMJA 1PDAA 2EM5A 2KHXA 2YTGA 4F9AB 2VRDA 3ECRA 4JI8E 2LO3A 2EN1A 2EN6A 3VHTB 4M30A 3ADIA 1MGTA 3J7AG 2DSYA 3C4TA 2DB2A 2JYAA 4DR2E 1X6HA 2ZM6E 4BS9A 2B7TA 4ZYEA 2MDGA 1N32E 2LT7A 1I94E 4GZNC 1YUJA 4JYAE 3C6KA 3BBGA 4O43A 3IWCA 2V85A 2UXCE 4HTGA 2VQFE 2L8TA 3J80C 4WX9A 2EOSA 4X66E 2EPMX 1NEIA 3RMPA 2LTSA 3BGHA 2EN8A 5KL5A 3ADLA 2JR1A 4R2SA 1G2DC 5A6BD 4B3SE 2B7VA 1TF6A 2DMYA 2DMIA 2JPAA 3VK6A 3L00A 1ZU1A 5IXMB 1TN9A 1J5EE 2EMYA 4DV1E 1DI2A 2V87A 5AC4A 3BIDA 5AE3A 1TF3A 3THNA 4RHBB 4ZYGA 2EOYA 2L6MA 2YTNA 2HGHA 4JI2E 1T4NA 2DGCA 2EQ1A 1PJQA 4WPYA 2EMWA 2B9DA 3LMLA 4KHPE 2EM4A 2EOXA 3ZOQB 2EPZA 5FLXC 4IJDA 4KWYA 4O24A 4LFAE 2YRMA 4X62E 1JK1A 4X8WA 2YTFA 1JK2A 3F6HA 2L2KB 1N33E 1T39A 4JV5E 2EORA 4LF6E 2R1FA 1EKZA 1KJKA 4R2RA 2L3CA 1HR0E 2WBSA 4DUZE 2ODRD 2BB8A 5LL6R 2K7IA 3AUZA 4X9JA 1F2IG 1LLMC 2RQLA 2R76A 4WXCA 1SFEA 2ODRC 2FTXB 1ZBTA 3HTXA 4GEQB 1X47A 2ADRA 1GTKA 4DR4E
chains in the Genus database with same CATH topology
3HXLA 1ZBQA 2L2MA 4P78A 1WHNA 4K0KE 2L33A 4P7DA 4BBYA 1YYWA 4KZSA 4LF9E 4DR6E 3FIGA 4BMJA 3DF6A 4LTYA 1QU6A 2F4VE 2KHXA 2YT4A 4DV4E 1XNQE 4B3ME 2RSMA 2V83A 4F9AB 4DUYE 2M1SA 4DV7E 2MC5A 1RQ0A 4OX9E 2JOXA 4JI8E 2LJHA 2JWOA 3OTOE 4M30A 3J81C 4LF4E 3ADIA 2IHR1 2UXDE 3AV0A 3OMLA 3J7AG 2RS6A 2DSYA 2LE2A 2DB2A 3C4TA 3KWRA 1YYOA 3VYXA 3P1XA 2KOUA 4DR2E 4DV5E 4M2ZA 2JOBA 2ZM6E 4BS9A 4X65E 2B7TA 3C4BA 1N32E 2F8BA 2LUQA 4J8ZA 2UUCE 1I94E 2LRSA 5F3WA 3HPZA 4JYAE 3HPSA 5LMUE 4JI0E 1IBKE 4DKKA 4DR5E 1XNRE 1FJGE 5AE2A 3IWCA 2V85A 1N34E 5LMNE 2UXCE 2VQFE 1J26A 3JAMC 2V8QB 2L8TA 3J80C 4B3RE 2K4VA 2LTRA 1IBME 2UUAE 4X66E 3RMPA 1STUA 2LTSA 1GQEA 5DNYA 4R03A 2HHHE 2WZOA 4JI7E 2M7QA 3ADLA 2JR1A 3T1HE 1GZ6A 4TUGA 2H36X 3ADJA 4I8OA 3K6QA 4AQYE 4B3SE 4L5NC 1DQ3A 2B7VA 1WXRA 3J7Yp 2DMYA 2FV4B 3VK6A 2V88A 5A2QC 1UHZA 2DIXA 2MDRA 4DMIA 4B3TE 2JY9A 5AASA 5IWAE 1J5EE 2L92A 3F6GA 5AE1A 4DV1E 1T4OA 3ADGA 4OOGC 4X64E 4BC9A 2UU9E 1DI2A 1HNWE 2V87A 5CFFE 2L3JA 2VE7C 2LBSB 5AE3A 2UXBE 4LU9A 4TUIA 3MSWA 4WSPA 1HNXE 4LF8E 1YZ9A 4YHHE 2LMZA 2EZ6A 2L6MA 4JI2E 4F9CB 3IWBA 4DV6E 2RTXA 2CPNA 1T4NA 1XMQE 1IBLE 4NXME 4R8OA 4WPYA 2B9DA 2V89A 2MC6A 3LMLA 2JVAA 1YYKA 5BR8E 4KHPE 4YY3E 2NUFA 4DV0E 3ZOQB 1UILA 4GKJE 5FLXC 3T1YE 4GKKE 4LFAE 4BCAA 2E1MA 4X62E 4L8NA 4LF5E 2YZTA 4BC7A 4X8WA 4NXNE 2NUGA 4LFBE 1X49A 1RC7A 1SR9A 3IWDA 1O0WA 2B3TB 1PKPA 2G7HA 2VF1A 4JI6E 3F6HA 2L2KB 1N33E 2M4IA 2V86A 4DV3E 4JV5E 5IT9C 2L2NA 2EWLA 5ADZA 4LF6E 1EKZA 2UUBE 4WFTA 3DJWA 2L3CA 4DV2E 1XMOE 1HR0E 2NA2A 2E5LE 4LF7E 4F54A 2N3HA 4Q28A 1T4LB 2KONA 2RS7A 4DR1E 4LFCE 4M0VA 1FKAE 1HNZE 4DUZE 4JI3E 2ODRD 5LL6R 3VYYA 1N36E 2N3GA 3AUZA 3H09A 3HQ1A 4DR3E 3JU0A 3LLHA 4JI4E 1X48A 4F9BB 4DR7E 2ODRC 2FGGA 3JTZA 4WYQB 5T6JA 1WHQA 2FTXB 2LUPB 1ZBTA 2VQEE 4JI5E 4GEQB 1X47A 3HTXA 4JI1E 4DR4E 2NUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2M A;  1WHN A;  4K0K E;  2L33 A;  1YYW A;  4DR6 E;  4LF9 E;  1QU6 A;  2F4V E;  2KHX A;  2YT4 A;  4DV4 E;  1XNQ E;  4B3M E;  2RSM A;  4DUY E;  4DV7 E;  1RQ0 A;  4OX9 E;  4JI8 E;  2LJH A;  3OTO E;  4M30 A;  4LF4 E;  2UXD E;  3ADI A;  2IHR 1;  2RS6 A;  3C4T A;  2DB2 A;  3VYX A;  1YYO A;  3P1X A;  4DR2 E;  4M2Z A;  4DV5 E;  2ZM6 E;  4X65 E;  2B7T A;  3C4B A;  1N32 E;  2UUC E;  2LUQ A;  1I94 E;  2LRS A;  4JYA E;  5LMU E;  4JI0 E;  1IBK E;  4DKK A;  4DR5 E;  1XNR E;  1FJG E;  1N34 E;  5LMN E;  2UXC E;  2VQF E;  1J26 A;  4B3R E;  2LTR A;  1IBM E;  2UUA E;  4X66 E;  1STU A;  2LTS A;  1GQE A;  2HHH E;  4JI7 E;  3ADL A;  3T1H E;  3ADJ A;  4B3S E;  4AQY E;  2B7V A;  3J7Y p;  2DMY A;  1UHZ A;  2DIX A;  2MDR A;  5IWA E;  2JY9 A;  1J5E E;  4DV1 E;  1T4O A;  3ADG A;  4OOG C;  4X64 E;  2UU9 E;  1DI2 A;  1HNW E;  5CFF E;  2L3J A;  2LBS B;  2UXB E;  4LF8 E;  1HNX E;  1YZ9 A;  4YHH E;  2EZ6 A;  4JI2 E;  4DV6 E;  2RTX A;  2CPN A;  1T4N A;  1XMQ E;  1IBL E;  4NXM E;  1YYK A;  2JVA A;  4KHP E;  5BR8 E;  4YY3 E;  2NUF A;  4DV0 E;  1UIL A;  4GKJ E;  3T1Y E;  4GKK E;  4LFA E;  4X62 E;  4LF5 E;  2NUG A;  4X8W A;  4NXN E;  4LFB E;  1X49 A;  1RC7 A;  1O0W A;  2B3T B;  1PKP A;  4JI6 E;  2L2K B;  1N33 E;  4DV3 E;  4JV5 E;  2L2N A;  4LF6 E;  1EKZ A;  2UUB E;  4WFT A;  2L3C A;  4DV2 E;  1XMO E;  1HR0 E;  2NA2 A;  2E5L E;  4LF7 E;  2N3H A;  1T4L B;  2RS7 A;  4DR1 E;  4LFC E;  1FKA E;  1HNZ E;  4DUZ E;  4JI3 E;  3VYY A;  1N36 E;  2N3G A;  4DR3 E;  3LLH A;  4JI4 E;  1X48 A;  4DR7 E;  4WYQ B;  1WHQ A;  2LUP B;  1ZBT A;  2VQE E;  4JI5 E;  4B3T E;  1X47 A;  3HTX A;  4JI1 E;  4DR4 E;  2NUE A; 
#chains in the Genus database with same CATH topology
 1WHN A;  4P7D A;  2EM7 A;  4DR6 E;  3FIG A;  5A69 A;  4LTY A;  4B3M E;  2RSM A;  2V83 A;  3EPJ A;  4DV7 E;  1IQS A;  2EOZ A;  5IV8 B;  2LJH A;  3BF2 A;  2YSO A;  1DGC A;  3AV0 A;  4IS1 C;  3KWR A;  3P1X A;  1PJS A;  4M2Z A;  2EM3 A;  2JOB A;  2I9I A;  3C4B A;  4R2P A;  2EPX A;  2F8B A;  2UUC E;  2EMK A;  2LRS A;  3HPS A;  5A6B A;  1UN6 B;  1BBO A;  4DR5 E;  3MHS C;  1FJG E;  1N34 E;  5LMN E;  1J26 A;  3JAM C;  4B3R E;  2LTR A;  1IBM E;  5DNY A;  4JI7 E;  2YRH A;  4I8O A;  1EH8 A;  2EMG A;  2YTE A;  3J7Y p;  3EQ1 A;  2BBG A;  2V88 A;  1ZAA C;  2EPR A;  2YTD A;  2EL4 A;  2L92 A;  1AAY A;  2EM6 A;  3F6G A;  2ELZ A;  5AE1 A;  2LCE A;  4OOG C;  4X64 E;  2UU9 E;  4BC9 A;  1HNW E;  2CSH A;  4LU9 A;  4LF8 E;  3MSW A;  1YZ9 A;  1T38 A;  4MLV A;  2GPI A;  2LMZ A;  2EZ6 A;  2CPN A;  2YTO A;  2EP3 A;  1X6F A;  2JVA A;  5BR8 E;  4YY3 E;  4DV0 E;  4F2J C;  4NZV A;  1A1K A;  2EOJ A;  4ZYD A;  4BCA A;  2E1M A;  3EPH A;  2NUG A;  2YZT A;  4NXN E;  1N3G A;  3IWD A;  2B3T B;  1PKP A;  1IQO A;  2EPN A;  2YTQ A;  2V86 A;  1X6E A;  5KL7 A;  1MEY C;  4M9V C;  2L2N A;  2EWL A;  2J7J A;  2E5L E;  1XMO E;  2EM0 A;  2NA2 A;  1X3C A;  2N3H A;  4Q28 A;  4F54 A;  1T4L B;  1NCS A;  2EPC A;  4F6N A;  2EL6 A;  2EMB A;  2LJU A;  3M99 B;  4WYQ B;  3JTZ A;  2LUP B;  4JI5 E;  2WBT A;  1L4S A;  2NUE A;  4NHR A;  2EPP A;  4WSG A;  3EPL A;  4K0K E;  4N4R B;  2L33 A;  4BBY A;  2EOF A;  1YYW A;  3DF6 A;  1QU6 A;  2F4V E;  2YT4 A;  4DV4 E;  2EJ4 A;  4DUY E;  2M1S A;  2MC5 A;  2DLK A;  2EMX A;  4LF4 E;  2UXD E;  2RS6 A;  1YYO A;  2KOU A;  5KL6 A;  2Q8U A;  2EQ3 A;  1IMU A;  5F3W A;  5LMU E;  4JI0 E;  1IBK E;  4Q35 B;  2YSP A;  4DKK A;  3C6M A;  1A1L A;  2CTD A;  2JP9 A;  1EH6 A;  2HC5 A;  2V8Q B;  2RPC A;  2UUA E;  2CT1 A;  1STU A;  2YWQ A;  1RMD A;  2EOM A;  4RH8 A;  4TUG A;  2H36 X;  2M9A A;  3ADJ A;  4L5N C;  1WXR A;  2FV4 B;  1UHZ A;  1WJP A;  2MDR A;  2DRP A;  2GLI A;  5IWA E;  5AAS A;  2NAB A;  1A1J A;  1T4O A;  5CFF E;  2L3J A;  2LBS B;  5TSE A;  2YTJ A;  3UK3 C;  3IWB A;  2RTX A;  2EPO A;  1XMQ E;  1QNT A;  4R8O A;  2ELY A;  2V89 A;  2MC6 A;  1YYK A;  2NUF A;  2EMC A;  1UIL A;  2MKN A;  3T1Y E;  4R2E A;  2WCC 3;  4L8N A;  2N8X A;  4BC7 A;  1PJT A;  4LFB E;  1RC7 A;  1SR9 A;  5KL4 A;  1O0W A;  2G7H A;  2ENH A;  2EN2 A;  4O5G A;  2EMH A;  4F6M A;  5IT9 C;  2YU8 A;  2EPL X;  2I13 A;  2EL5 A;  2UUB E;  4WFT A;  1X5W A;  4DR1 E;  4ZYH A;  4R2D A;  4HEI A;  3KZZ A;  1B69 A;  1EH7 A;  4JI3 E;  2EMI A;  1N36 E;  2HJJ A;  2N3G A;  3H09 A;  4DR3 E;  3JU0 A;  3LLH A;  2EMZ A;  4JI4 E;  1X48 A;  2EMF A;  4F9B B;  4DR7 E;  2FGG A;  5T6J A;  2YTP A;  4B3T E;  2WBU A;  3HXL A;  2L2M A;  2PRT A;  1YFH A;  2GHF A;  1BBG A;  1YSA C;  4KZS A;  2EQ0 A;  3KZY A;  4LF9 E;  5LLQ A;  1XNQ E;  1RQ0 A;  4OX9 E;  2JOX A;  3OTO E;  2JWO A;  2EPK X;  3J81 C;  2IHR 1;  2LVH A;  1P47 A;  1A1I A;  3OML A;  2LV2 A;  2LE2 A;  2EMA A;  4BHC A;  3VYX A;  4DV5 E;  4X65 E;  1Z1B A;  4J8Z A;  2LUQ A;  2RSI A;  3HPZ A;  4MLQ A;  1A1F A;  1YPN A;  1A1H A;  1XNR E;  5AE2 A;  2YTI A;  2EPA A;  2YRK A;  2ENA A;  2K4V A;  2EOQ A;  1GQE A;  2HHH E;  4R03 A;  4FK5 C;  2WZO A;  1ZR9 A;  2M7Q A;  2A25 A;  3T1H E;  1GZ6 A;  2MKD A;  3QG5 C;  3K6Q A;  4AQY E;  1DQ3 A;  1YUI A;  4R2A A;  5A2Q C;  2EM9 A;  2DIX A;  2EN4 A;  4DMI A;  2JY9 A;  1G2F C;  3THO B;  4WXD A;  3ADG A;  2VE7 C;  2UXB E;  4TUI A;  4WSP A;  1HNX E;  4YHH E;  1AH5 A;  5AC5 A;  4F9C B;  5A6A A;  4DV6 E;  1IBL E;  4NXM E;  5KL2 A;  1WRJ A;  2EN3 A;  4R2Q A;  2EOI A;  2EOH A;  2EM8 A;  2EPU A;  2ENC A;  4GKJ E;  1UBD C;  4GKK E;  5KL3 A;  4LF5 E;  1X49 A;  2EOE A;  1KYQ A;  2VF1 A;  4JI6 E;  2EM2 A;  2M4I A;  4DV3 E;  5A6K A;  5ADZ A;  5A6J A;  1A1G A;  3DJW A;  2E72 A;  4DV2 E;  4LF7 E;  2EN7 A;  2EOO A;  2KON A;  2RS7 A;  2YPN A;  4LFC E;  4M0V A;  1FKA E;  3MHH C;  1HNZ E;  4O4K A;  2EE8 A;  3VYY A;  3HQ1 A;  2JXP A;  4R2C A;  1WHQ A;  2DLQ A;  2YU5 A;  2VQE E;  1BB8 A;  4JI1 E;  2EML A;  1ZBQ A;  4P78 A;  4BHB A;  2D9H A;  3TQM A;  3EPK A;  4BMJ A;  1PDA A;  2EM5 A;  2KHX A;  2YTG A;  4F9A B;  2VRD A;  3ECR A;  4JI8 E;  2LO3 A;  2EN1 A;  2EN6 A;  3VHT B;  4M30 A;  3ADI A;  1MGT A;  3J7A G;  2DSY A;  3C4T A;  2DB2 A;  2JYA A;  4DR2 E;  1X6H A;  2ZM6 E;  4BS9 A;  2B7T A;  4ZYE A;  2MDG A;  1N32 E;  2LT7 A;  1I94 E;  4GZN C;  1YUJ A;  4JYA E;  3C6K A;  3BBG A;  4O43 A;  3IWC A;  2V85 A;  2UXC E;  4HTG A;  2VQF E;  2L8T A;  3J80 C;  4WX9 A;  2EOS A;  4X66 E;  2EPM X;  1NEI A;  3RMP A;  2LTS A;  3BGH A;  2EN8 A;  5KL5 A;  3ADL A;  2JR1 A;  4R2S A;  1G2D C;  5A6B D;  4B3S E;  2B7V A;  1TF6 A;  2DMY A;  2DMI A;  2JPA A;  3VK6 A;  3L00 A;  1ZU1 A;  5IXM B;  1TN9 A;  1J5E E;  2EMY A;  4DV1 E;  1DI2 A;  2V87 A;  5AC4 A;  3BID A;  5AE3 A;  1TF3 A;  3THN A;  4RHB B;  4ZYG A;  2EOY A;  2L6M A;  2YTN A;  2HGH A;  4JI2 E;  1T4N A;  2DGC A;  2EQ1 A;  1PJQ A;  4WPY A;  2EMW A;  2B9D A;  3LML A;  4KHP E;  2EM4 A;  2EOX A;  3ZOQ B;  2EPZ A;  5FLX C;  4IJD A;  4KWY A;  4O24 A;  4LFA E;  2YRM A;  4X62 E;  1JK1 A;  4X8W A;  2YTF A;  1JK2 A;  3F6H A;  2L2K B;  1N33 E;  1T39 A;  4JV5 E;  2EOR A;  4LF6 E;  2R1F A;  1EKZ A;  1KJK A;  4R2R A;  2L3C A;  1HR0 E;  2WBS A;  4DUZ E;  2ODR D;  2BB8 A;  5LL6 R;  2K7I A;  3AUZ A;  4X9J A;  1F2I G;  1LLM C;  2RQL A;  2R76 A;  4WXC A;  1SFE A;  2ODR C;  2FTX B;  1ZBT A;  3HTX A;  4GEQ B;  1X47 A;  2ADR A;  1GTK A;  4DR4 E; 
#chains in the Genus database with same CATH homology
 3HXL A;  1ZBQ A;  2L2M A;  4P78 A;  1WHN A;  4K0K E;  2L33 A;  4P7D A;  4BBY A;  1YYW A;  4KZS A;  4LF9 E;  4DR6 E;  3FIG A;  4BMJ A;  3DF6 A;  4LTY A;  1QU6 A;  2F4V E;  2KHX A;  2YT4 A;  4DV4 E;  1XNQ E;  4B3M E;  2RSM A;  2V83 A;  4F9A B;  4DUY E;  2M1S A;  4DV7 E;  2MC5 A;  1RQ0 A;  4OX9 E;  2JOX A;  4JI8 E;  2LJH A;  2JWO A;  3OTO E;  4M30 A;  3J81 C;  4LF4 E;  3ADI A;  2IHR 1;  2UXD E;  3AV0 A;  3OML A;  3J7A G;  2RS6 A;  2DSY A;  2LE2 A;  2DB2 A;  3C4T A;  3KWR A;  1YYO A;  3VYX A;  3P1X A;  2KOU A;  4DR2 E;  4DV5 E;  4M2Z A;  2JOB A;  2ZM6 E;  4BS9 A;  4X65 E;  2B7T A;  3C4B A;  1N32 E;  2F8B A;  2LUQ A;  4J8Z A;  2UUC E;  1I94 E;  2LRS A;  5F3W A;  3HPZ A;  4JYA E;  3HPS A;  5LMU E;  4JI0 E;  1IBK E;  4DKK A;  4DR5 E;  1XNR E;  1FJG E;  5AE2 A;  3IWC A;  2V85 A;  1N34 E;  5LMN E;  2UXC E;  2VQF E;  1J26 A;  3JAM C;  2V8Q B;  2L8T A;  3J80 C;  4B3R E;  2K4V A;  2LTR A;  1IBM E;  2UUA E;  4X66 E;  3RMP A;  1STU A;  2LTS A;  1GQE A;  5DNY A;  4R03 A;  2HHH E;  2WZO A;  4JI7 E;  2M7Q A;  3ADL A;  2JR1 A;  3T1H E;  1GZ6 A;  4TUG A;  2H36 X;  3ADJ A;  4I8O A;  3K6Q A;  4AQY E;  4B3S E;  4L5N C;  1DQ3 A;  2B7V A;  1WXR A;  3J7Y p;  2DMY A;  2FV4 B;  3VK6 A;  2V88 A;  5A2Q C;  1UHZ A;  2DIX A;  2MDR A;  4DMI A;  4B3T E;  2JY9 A;  5AAS A;  5IWA E;  1J5E E;  2L92 A;  3F6G A;  5AE1 A;  4DV1 E;  1T4O A;  3ADG A;  4OOG C;  4X64 E;  4BC9 A;  2UU9 E;  1DI2 A;  1HNW E;  2V87 A;  5CFF E;  2L3J A;  2VE7 C;  2LBS B;  5AE3 A;  2UXB E;  4LU9 A;  4TUI A;  3MSW A;  4WSP A;  1HNX E;  4LF8 E;  1YZ9 A;  4YHH E;  2LMZ A;  2EZ6 A;  2L6M A;  4JI2 E;  4F9C B;  3IWB A;  4DV6 E;  2RTX A;  2CPN A;  1T4N A;  1XMQ E;  1IBL E;  4NXM E;  4R8O A;  4WPY A;  2B9D A;  2V89 A;  2MC6 A;  3LML A;  2JVA A;  1YYK A;  5BR8 E;  4KHP E;  4YY3 E;  2NUF A;  4DV0 E;  3ZOQ B;  1UIL A;  4GKJ E;  5FLX C;  3T1Y E;  4GKK E;  4LFA E;  4BCA A;  2E1M A;  4X62 E;  4L8N A;  4LF5 E;  2YZT A;  4BC7 A;  4X8W A;  4NXN E;  2NUG A;  4LFB E;  1X49 A;  1RC7 A;  1SR9 A;  3IWD A;  1O0W A;  2B3T B;  1PKP A;  2G7H A;  2VF1 A;  4JI6 E;  3F6H A;  2L2K B;  1N33 E;  2M4I A;  2V86 A;  4DV3 E;  4JV5 E;  5IT9 C;  2L2N A;  2EWL A;  5ADZ A;  4LF6 E;  1EKZ A;  2UUB E;  4WFT A;  3DJW A;  2L3C A;  4DV2 E;  1XMO E;  1HR0 E;  2NA2 A;  2E5L E;  4LF7 E;  4F54 A;  2N3H A;  4Q28 A;  1T4L B;  2KON A;  2RS7 A;  4DR1 E;  4LFC E;  4M0V A;  1FKA E;  1HNZ E;  4DUZ E;  4JI3 E;  2ODR D;  5LL6 R;  3VYY A;  1N36 E;  2N3G A;  3AUZ A;  3H09 A;  3HQ1 A;  4DR3 E;  3JU0 A;  3LLH A;  4JI4 E;  1X48 A;  4F9B B;  4DR7 E;  2ODR C;  2FGG A;  3JTZ A;  4WYQ B;  5T6J A;  1WHQ A;  2FTX B;  2LUP B;  1ZBT A;  2VQE E;  4JI5 E;  4GEQ B;  1X47 A;  3HTX A;  4JI1 E;  4DR4 E;  2NUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...