3ADIA

Structure of arabidopsis hyl1 and its molecular implications for mirna processing
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
71
Chain Sequence
HVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation/rna
molecule keywords F21M12.9 protein
total genus 18
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adiA00
1HNWE 2L3JA 2MDRA 2CPNA 2L2MA 2RS7A 5IWAE 5LMUE 2L2KB 4DV2E 1YYKA 1ZBTA 4DV3E 2DMYA 2UUAE 2B7VA 1STUA 3C4TA 1UILA 1J5EE 1IBKE 2HHHE 4KHPE 4DV0E 2N3GA 1RC7A 1HNZE 4K0KE 4LF8E 2EZ6A 2UU9E 4DR7E 2NUFA 1N33E 1IBLE 4X8WA 4DKKA 4DV7E 2RSMA 1N34E 4B3TE 4LFCE 2JY9A 2UXBE 3ADGA 1I94E 1DI2A 2LBSB 2IHR1 4DR1E 5LMNE 4JI8E 3OTOE 2NUGA 2LJHA 1T4NA 4LF7E 4JI3E 2L33A 1EKZA 2JVAA 2NA2A 3HTXA 1WHQA 4DR4E 4DUZE 3ADLA 4B3SE 2DIXA 2UXCE 4DR6E 2KHXA 2E5LE 4LF5E 3LLHA 4M30A 2RTXA 1XMOE 4DR3E 1GQEA 4JV5E 4M2ZA 4JI4E 1RQ0A 4OX9E 2LTRA 2RS6A 1O0WA 3VYYA 3T1YE 1WHNA 1HR0E 4X64E 4JI6E 4GKKE 2F4VE 4DUYE 4OOGC 1YYOA 3T1HE 4DV5E 1FKAE 4X65E 4WFTA 5CFFE 2B3TB 1N36E 4NXME 1PKPA 4LFAE 2VQEE 4LF9E 1T4OA 4DV1E 4DV4E 3J7Yp 4JI7E 4AQYE 4X62E 1HNXE 4JI0E 3VYXA 1YZ9A 3C4BA 2LUQA 2N3HA 3ADJA 1UHZA 1X49A 1IBME 2YT4A 2LTSA 2DB2A 1QU6A 4NXNE 2UXDE 4LF6E 4DV6E 2B7TA 1XNQE 4LFBE 4DR2E 4B3ME 4X66E 3P1XA 4GKJE 2UUBE 3ADIA 2UUCE 2LRSA 4YHHE 1X48A 2VQFE 2LUPB 2L3CA 4DR5E 4LF4E 4JI1E 1T4LB 2NUEA 1N32E 4JI2E 1X47A 2ZM6E 4JI5E 1YYWA 4YY3E 1FJGE 1XMQE 1J26A 4JYAE 1XNRE 4WYQB 2L2NA 5BR8E 4B3RE
chains in the Genus database with same CATH superfamily
2EN7A 3BF2A 4ZYGA 1ZBTA 2LJUA 1TF6A 1G2DC 1AAYA 2DMYA 1STUA 5AC5A 2FV4B 2MKDA 5LL6R 4K0KE 2EZ6A 4R2SA 4BC9A 1N33E 2LT7A 1IBLE 4DV7E 1PJQA 1WJPA 2BB8A 4LFCE 2YTOA 2EMHA 1BBOA 4HEIA 4R2PA 3IWCA 2EM8A 1JK1A 5KL5A 2EQ1A 5A6BD 4O5GA 1EKZA 1WHQA 2EM3A 4L8NA 2V86A 2E72A 3IWDA 4TUGA 2HC5A 1WRJA 2K4VA 2KHXA 2E5LE 1JK2A 4TUIA 4KWYA 4M0VA 4IJDA 4WSPA 2J7JA 1QNTA 4F2JC 2H36X 1UBDC 2FTXB 1RQ0A 2EMLA 5AE2A 1O0WA 3VYYA 3T1YE 1IMUA 1SFEA 2RPCA 4DUYE 2GHFA 1YYOA 2EPXA 1YFHA 1PJSA 2DLQA 4Q35B 2YRHA 2JOBA 2VQEE 4R2AA 4R2CA 2CTDA 2R1FA 1T4OA 4AQYE 3J7Yp 4JI7E 1HNXE 2EN2A 1A1GA 2WZOA 2N3HA 1UHZA 2LTSA 2DB2A 5A69A 3THOB 4KZSA 3EQ1A 3BBGA 4WSGA 3BIDA 4LF6E 2V88A 2M4IA 4X66E 1MGTA 2ELZA 3J7AG 2Q8UA 1X48A 2EMAA 4WPYA 3EPJA 2VQFE 2EOFA 4LF4E 1T4LB 1X6HA 2EM2A 1BBGA 5A6JA 2GPIA 5A6KA 2EOZA 1P47A 2A25A 4YY3E 5IV8B 4FK5C 1ZU1A 4WYQB 2EQ3A 2EOHA 2EPOA 4RH8A 2L3JA 5IXMB 5IWAE 2ENHA 2EMWA 2E1MA 2EPUA 1B69A 2EOSA 2EPZA 1BB8A 1J5EE 2EPNA 3LMLA 4F54A 4RHBB 2DGCA 1HNZE 4LF8E 2VRDA 4GEQB 2YTQA 4DR7E 2WBTA 4X8WA 2M1SA 2YWQA 4F6NA 1T38A 2EOQA 4BMJA 1GZ6A 4R2QA 2IHR1 2D9HA 2EL5A 4JI8E 2YTDA 5FLXC 2LJHA 4F9BB 1YUIA 2NUGA 1T4NA 2ELYA 4GZNC 2JVAA 4LTYA 3JAMC 2NA2A 2LVHA 2EOXA 2PRTA 4DR4E 1YUJA 2EMCA 4F9CB 5KL3A 4M9VC 2EM4A 2EPLX 2M9AA 2K7IA 2EOMA 2CT1A 2EMXA 2RTXA 5A2QC 4NZVA 3HPZA 3OMLA 4JI4E 2LTRA 2RS6A 4IS1C 1WHNA 2V89A 1HR0E 1NCSA 2EN8A 1X6FA 2F4VE 1NEIA 2YTFA 2WCC3 2VE7C 2YU5A 2MC5A 1A1IA 1PKPA 3THNA 4LFAE 2G7HA 4N4RB 4R2RA 2EMBA 2EPPA 4LF9E 2JYAA 4DV1E 4DV4E 2V83A 2L8TA 3KZZA 4X62E 3J80C 4JI0E 2YTIA 3C4BA 2EOJA 2RSIA 2EP3A 2CSHA 1QU6A 4NXNE 4MLQA 2FGGA 3F6HA 2JR1A 2EPMX 2B7TA 1RMDA 2EM7A 2JPAA 1G2FC 3ADIA 1TF3A 3AUZA 2MC6A 3EPHA 1PDAA 2NUEA 4L5NC 4JI2E 1X47A 2KONA 1FJGE 1XMQE 1ZR9A 3H09A 2YRKA 4R2EA 2EMGA 4JYAE 2L2NA 4F6MA 2DMIA 2EM0A 4B3RE 1HNWE 1KJKA 3ZOQB 2CPNA 2L2MA 2RS7A 5LMUE 2L6MA 1YYKA 2ODRC 2ENCA 2UUAE 2B7VA 1DGCA 2HHHE 2YTJA 4KHPE 4WXDA 2LCEA 2UU9E 2EOIA 1X6EA 2RSMA 2YSPA 2V87A 1IQSA 1YPNA 4BHBA 4B3TE 2RQLA 1YSAC 4MLVA 1A1HA 2UXBE 4Q28A 1I94E 2JOXA 1DI2A 2ODRD 2N8XA 2YZTA 1SR9A 2EMYA 4NHRA 4ZYHA 3OTOE 2DRPA 2MKNA 2EN4A 5AE1A 4JI3E 2L33A 2WBSA 2HJJA 3RMPA 5A6BA 3HTXA 4J8ZA 4DUZE 3KZYA 1MEYC 4ZYEA 4ZYDA 4LF5E 4R8OA 5KL4A 2YU8A 1A1LA 2JP9A 4O24A 2ENAA 2EOOA 3MHSC 1XMOE 2EN6A 4JV5E 4M2ZA 5KL7A 2EORA 2DLKA 4JI6E 4X64E 2EPAA 5ADZA 4OOGC 2EM6A 3T1HE 2EMZA 1A1FA 5CFFE 2EWLA 2YSOA 2EOEA 2V8QB 1WXRA 3VK6A 4WX9A 3UK3C 2YTEA 2EPCA 1EH6A 4P78A 1YZ9A 3VYXA 2YTGA 3ADJA 1X49A 4BBYA 2YT4A 3AV0A 5AASA 1PJTA 1X5WA 4I8OA 2UXDE 2I9IA 4DMIA 1ZBQA 2LE2A 1T39A 4DR2E 4LFBE 3P1XA 2UUBE 3EPLA 3J81C 2EL4A 2B9DA 2M7QA 2LRSA 5A6AA 2UUCE 2LUPB 4DR5E 2EM9A 3BGHA 5KL6A 1DQ3A 2YTNA 2JXPA 2HGHA 1N32E 4JI5E 1L4SA 3K6QA 5BR8E 4O43A 2EPKX 2MDRA 3DF6A 2VF1A 2BBGA 2L2KB 4DV2E 3VHTB 3TQMA 1TN9A 4BHCA 1EH8A 4DV3E 2WBUA 3C4TA 1UILA 1IBKE 4DV0E 2MDGA 2N3GA 2LMZA 1RC7A 1X3CA 2NUFA 5TSEA 4BC7A 4DKKA 1N34E 2I13A 5KL2A 3L00A 2JY9A 3F6GA 3M99B 3ADGA 2LBSB 4WXCA 4DR1E 4HTGA 5IT9C 5LMNE 2EN1A 5T6JA 4LF7E 2YTPA 1KYQA 1EH7A 1UN6B 3JTZA 3ADLA 1A1JA 4B3SE 2DIXA 2EL6A 5F3WA 2UXCE 4DR6E 4LU9A 2EMKA 3MSWA 1ZAAC 3LLHA 4M30A 1A1KA 3FIGA 1GQEA 4DR3E 2JWOA 2LO3A 2EQ0A 4OX9E 4GKKE 4BCAA 1LLMC 3ECRA 3HPSA 4DV5E 1FKAE 5DNYA 4X65E 4WFTA 2B3TB 2R76A 1N36E 4NXME 2LV2A 2GLIA 4X9JA 3KWRA 2EE8A 2YRMA 2DSYA 3C6MA 4F9AB 1GTKA 2LUQA 3HQ1A 2L92A 1F2IG 2YPNA 5AE3A 1IBME 2V85A 3MHHC 4P7DA 2EM5A 2EPRA 3JU0A 1IQOA 2EOYA 4O4KA 3EPKA 2EN3A 4DV6E 1XNQE 2KOUA 2EJ4A 4GKJE 4B3ME 1Z1BA 2F8BA 2EMFA 3HXLA 4R03A 4YHHE 5LLQA 2L3CA 2EMIA 3DJWA 4JI1E 1AH5A 3QG5C 2NABA 2ZM6E 1YYWA 4R2DA 1J26A 2ADRA 4BS9A 1XNRE 3C6KA 3IWBA 1N3GA 5AC4A
chains in the Genus database with same CATH topology
1HNWE 2L3JA 2MDRA 3ZOQB 2CPNA 2L2MA 2RS7A 2VF1A 3DF6A 5IWAE 5LMUE 2L2KB 4DV2E 2E1MA 2L6MA 1YYKA 2ODRC 1ZBTA 4DV3E 2DMYA 2UUAE 2B7VA 1STUA 3C4TA 1UILA 1J5EE 3LMLA 1IBKE 2FV4B 2HHHE 4KHPE 5LL6R 4F54A 4DV0E 2N3GA 2LMZA 1RC7A 1HNZE 4LF8E 2EZ6A 4K0KE 2UU9E 4BC9A 4GEQB 4DR7E 2NUFA 1N33E 4BC7A 1IBLE 4X8WA 4DKKA 4DV7E 2RSMA 1N34E 2M1SA 2V87A 4B3TE 4LFCE 2JY9A 4BMJA 3F6GA 2UXBE 3ADGA 4Q28A 2JOXA 1GZ6A 1I94E 1DI2A 2ODRD 2LBSB 2IHR1 4DR1E 5IT9C 3IWCA 2YZTA 4JI8E 1SR9A 5LMNE 3OTOE 5FLXC 2LJHA 5T6JA 4F9BB 2NUGA 1T4NA 4LF7E 5AE1A 4JI3E 2L33A 1EKZA 2JVAA 4LTYA 3JAMC 3RMPA 2NA2A 3HTXA 1WHQA 4J8ZA 2UUCE 4DUZE 4DR4E 3JTZA 3ADLA 4F9CB 4L8NA 2V86A 4B3SE 4GKKE 2DIXA 3IWDA 5F3WA 4TUGA 2UXCE 2K4VA 2KHXA 2E5LE 4R8OA 4LF5E 4LU9A 4TUIA 4DR6E 4M0VA 3MSWA 3LLHA 4M30A 4WSPA 2RTXA 5A2QC 1XMOE 3FIGA 1GQEA 2H36X 4DR3E 3HPZA 3OMLA 2FTXB 2JWOA 4JI4E 1RQ0A 4M2ZA 4OX9E 2LTRA 2RS6A 1O0WA 5AE2A 3VYYA 1WHNA 2V89A 4BCAA 4X64E 3T1YE 1HR0E 5ADZA 4JI6E 4DUYE 4OOGC 2F4VE 1YYOA 3HPSA 3T1HE 2VE7C 4DV5E 1FKAE 2MC5A 5DNYA 4X65E 4WFTA 5CFFE 2EWLA 2B3TB 1N36E 4NXME 1PKPA 2JOBA 4LFAE 2G7HA 2VQEE 4LF9E 1T4OA 2V8QB 1WXRA 4DV1E 3J7Yp 4JI7E 2V83A 3KWRA 3VK6A 4DV4E 2L8TA 4X62E 3J80C 1HNXE 4JI0E 2DSYA 4P78A 1YZ9A 3VYXA 3C4BA 4F9AB 2LUQA 2WZOA 3HQ1A 2N3HA 3ADJA 1UHZA 2L92A 1X49A 4BBYA 2YT4A 5AE3A 1IBME 3AV0A 2V85A 5AASA 2LTSA 2DB2A 4P7DA 3JU0A 1QU6A 4KZSA 4I8OA 4NXNE 2FGGA 2UXDE 3F6HA 4DMIA 2JR1A 4LF6E 1ZBQA 2B7TA 2V88A 4DV6E 2KOUA 4AQYE 1XNQE 2M4IA 2LE2A 4LFBE 4DR2E 4B3ME 4X66E 3P1XA 4GKJE 2F8BA 2UUBE 3J7AG 3J81C 3ADIA 2B9DA 2LRSA 3HXLA 3AUZA 1X48A 2MC6A 4R03A 4WPYA 2M7QA 4YHHE 2L3CA 3DJWA 2VQFE 4DR5E 2LUPB 4LF4E 4JI1E 1DQ3A 1T4LB 2NUEA 1N32E 4L5NC 4JI2E 1X47A 2ZM6E 4JI5E 1YYWA 4YY3E 2KONA 1FJGE 1XMQE 1J26A 3H09A 4BS9A 1XNRE 4WYQB 3IWBA 4JYAE 4JV5E 2L2NA 3K6QA 5BR8E 4B3RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW E;  2L3J A;  2MDR A;  2CPN A;  2L2M A;  2RS7 A;  5IWA E;  5LMU E;  2L2K B;  4DV2 E;  1YYK A;  1ZBT A;  4DV3 E;  2DMY A;  2UUA E;  2B7V A;  1STU A;  3C4T A;  1UIL A;  1J5E E;  1IBK E;  2HHH E;  4KHP E;  4DV0 E;  2N3G A;  1RC7 A;  1HNZ E;  4K0K E;  4LF8 E;  2EZ6 A;  2UU9 E;  4DR7 E;  2NUF A;  1N33 E;  1IBL E;  4X8W A;  4DKK A;  4DV7 E;  2RSM A;  1N34 E;  4B3T E;  4LFC E;  2JY9 A;  2UXB E;  3ADG A;  1I94 E;  1DI2 A;  2LBS B;  2IHR 1;  4DR1 E;  5LMN E;  4JI8 E;  3OTO E;  2NUG A;  2LJH A;  1T4N A;  4LF7 E;  4JI3 E;  2L33 A;  1EKZ A;  2JVA A;  2NA2 A;  3HTX A;  1WHQ A;  4DR4 E;  4DUZ E;  3ADL A;  4B3S E;  2DIX A;  2UXC E;  4DR6 E;  2KHX A;  2E5L E;  4LF5 E;  3LLH A;  4M30 A;  2RTX A;  1XMO E;  4DR3 E;  1GQE A;  4JV5 E;  4M2Z A;  4JI4 E;  1RQ0 A;  4OX9 E;  2LTR A;  2RS6 A;  1O0W A;  3VYY A;  3T1Y E;  1WHN A;  1HR0 E;  4X64 E;  4JI6 E;  4GKK E;  2F4V E;  4DUY E;  4OOG C;  1YYO A;  3T1H E;  4DV5 E;  1FKA E;  4X65 E;  4WFT A;  5CFF E;  2B3T B;  1N36 E;  4NXM E;  1PKP A;  4LFA E;  2VQE E;  4LF9 E;  1T4O A;  4DV1 E;  4DV4 E;  3J7Y p;  4JI7 E;  4AQY E;  4X62 E;  1HNX E;  4JI0 E;  3VYX A;  1YZ9 A;  3C4B A;  2LUQ A;  2N3H A;  3ADJ A;  1UHZ A;  1X49 A;  1IBM E;  2YT4 A;  2LTS A;  2DB2 A;  1QU6 A;  4NXN E;  2UXD E;  4LF6 E;  4DV6 E;  2B7T A;  1XNQ E;  4LFB E;  4DR2 E;  4B3M E;  4X66 E;  3P1X A;  4GKJ E;  2UUB E;  3ADI A;  2UUC E;  2LRS A;  4YHH E;  1X48 A;  2VQF E;  2LUP B;  2L3C A;  4DR5 E;  4LF4 E;  4JI1 E;  1T4L B;  2NUE A;  1N32 E;  4JI2 E;  1X47 A;  2ZM6 E;  4JI5 E;  1YYW A;  4YY3 E;  1FJG E;  1XMQ E;  1J26 A;  4JYA E;  1XNR E;  4WYQ B;  2L2N A;  5BR8 E;  4B3R E; 
#chains in the Genus database with same CATH topology
 2EN7 A;  3BF2 A;  4ZYG A;  1ZBT A;  2LJU A;  1TF6 A;  1G2D C;  1AAY A;  2DMY A;  1STU A;  5AC5 A;  2FV4 B;  2MKD A;  5LL6 R;  4K0K E;  2EZ6 A;  4R2S A;  4BC9 A;  1N33 E;  2LT7 A;  1IBL E;  4DV7 E;  1PJQ A;  1WJP A;  2BB8 A;  4LFC E;  2YTO A;  2EMH A;  1BBO A;  4HEI A;  4R2P A;  3IWC A;  2EM8 A;  1JK1 A;  5KL5 A;  2EQ1 A;  5A6B D;  4O5G A;  1EKZ A;  1WHQ A;  2EM3 A;  4L8N A;  2V86 A;  2E72 A;  3IWD A;  4TUG A;  2HC5 A;  1WRJ A;  2K4V A;  2KHX A;  2E5L E;  1JK2 A;  4TUI A;  4KWY A;  4M0V A;  4IJD A;  4WSP A;  2J7J A;  1QNT A;  4F2J C;  2H36 X;  1UBD C;  2FTX B;  1RQ0 A;  2EML A;  5AE2 A;  1O0W A;  3VYY A;  3T1Y E;  1IMU A;  1SFE A;  2RPC A;  4DUY E;  2GHF A;  1YYO A;  2EPX A;  1YFH A;  1PJS A;  2DLQ A;  4Q35 B;  2YRH A;  2JOB A;  2VQE E;  4R2A A;  4R2C A;  2CTD A;  2R1F A;  1T4O A;  4AQY E;  3J7Y p;  4JI7 E;  1HNX E;  2EN2 A;  1A1G A;  2WZO A;  2N3H A;  1UHZ A;  2LTS A;  2DB2 A;  5A69 A;  3THO B;  4KZS A;  3EQ1 A;  3BBG A;  4WSG A;  3BID A;  4LF6 E;  2V88 A;  2M4I A;  4X66 E;  1MGT A;  2ELZ A;  3J7A G;  2Q8U A;  1X48 A;  2EMA A;  4WPY A;  3EPJ A;  2VQF E;  2EOF A;  4LF4 E;  1T4L B;  1X6H A;  2EM2 A;  1BBG A;  5A6J A;  2GPI A;  5A6K A;  2EOZ A;  1P47 A;  2A25 A;  4YY3 E;  5IV8 B;  4FK5 C;  1ZU1 A;  4WYQ B;  2EQ3 A;  2EOH A;  2EPO A;  4RH8 A;  2L3J A;  5IXM B;  5IWA E;  2ENH A;  2EMW A;  2E1M A;  2EPU A;  1B69 A;  2EOS A;  2EPZ A;  1BB8 A;  1J5E E;  2EPN A;  3LML A;  4F54 A;  4RHB B;  2DGC A;  1HNZ E;  4LF8 E;  2VRD A;  4GEQ B;  2YTQ A;  4DR7 E;  2WBT A;  4X8W A;  2M1S A;  2YWQ A;  4F6N A;  1T38 A;  2EOQ A;  4BMJ A;  1GZ6 A;  4R2Q A;  2IHR 1;  2D9H A;  2EL5 A;  4JI8 E;  2YTD A;  5FLX C;  2LJH A;  4F9B B;  1YUI A;  2NUG A;  1T4N A;  2ELY A;  4GZN C;  2JVA A;  4LTY A;  3JAM C;  2NA2 A;  2LVH A;  2EOX A;  2PRT A;  4DR4 E;  1YUJ A;  2EMC A;  4F9C B;  5KL3 A;  4M9V C;  2EM4 A;  2EPL X;  2M9A A;  2K7I A;  2EOM A;  2CT1 A;  2EMX A;  2RTX A;  5A2Q C;  4NZV A;  3HPZ A;  3OML A;  4JI4 E;  2LTR A;  2RS6 A;  4IS1 C;  1WHN A;  2V89 A;  1HR0 E;  1NCS A;  2EN8 A;  1X6F A;  2F4V E;  1NEI A;  2YTF A;  2WCC 3;  2VE7 C;  2YU5 A;  2MC5 A;  1A1I A;  1PKP A;  3THN A;  4LFA E;  2G7H A;  4N4R B;  4R2R A;  2EMB A;  2EPP A;  4LF9 E;  2JYA A;  4DV1 E;  4DV4 E;  2V83 A;  2L8T A;  3KZZ A;  4X62 E;  3J80 C;  4JI0 E;  2YTI A;  3C4B A;  2EOJ A;  2RSI A;  2EP3 A;  2CSH A;  1QU6 A;  4NXN E;  4MLQ A;  2FGG A;  3F6H A;  2JR1 A;  2EPM X;  2B7T A;  1RMD A;  2EM7 A;  2JPA A;  1G2F C;  3ADI A;  1TF3 A;  3AUZ A;  2MC6 A;  3EPH A;  1PDA A;  2NUE A;  4L5N C;  4JI2 E;  1X47 A;  2KON A;  1FJG E;  1XMQ E;  1ZR9 A;  3H09 A;  2YRK A;  4R2E A;  2EMG A;  4JYA E;  2L2N A;  4F6M A;  2DMI A;  2EM0 A;  4B3R E;  1HNW E;  1KJK A;  3ZOQ B;  2CPN A;  2L2M A;  2RS7 A;  5LMU E;  2L6M A;  1YYK A;  2ODR C;  2ENC A;  2UUA E;  2B7V A;  1DGC A;  2HHH E;  2YTJ A;  4KHP E;  4WXD A;  2LCE A;  2UU9 E;  2EOI A;  1X6E A;  2RSM A;  2YSP A;  2V87 A;  1IQS A;  1YPN A;  4BHB A;  4B3T E;  2RQL A;  1YSA C;  4MLV A;  1A1H A;  2UXB E;  4Q28 A;  1I94 E;  2JOX A;  1DI2 A;  2ODR D;  2N8X A;  2YZT A;  1SR9 A;  2EMY A;  4NHR A;  4ZYH A;  3OTO E;  2DRP A;  2MKN A;  2EN4 A;  5AE1 A;  4JI3 E;  2L33 A;  2WBS A;  2HJJ A;  3RMP A;  5A6B A;  3HTX A;  4J8Z A;  4DUZ E;  3KZY A;  1MEY C;  4ZYE A;  4ZYD A;  4LF5 E;  4R8O A;  5KL4 A;  2YU8 A;  1A1L A;  2JP9 A;  4O24 A;  2ENA A;  2EOO A;  3MHS C;  1XMO E;  2EN6 A;  4JV5 E;  4M2Z A;  5KL7 A;  2EOR A;  2DLK A;  4JI6 E;  4X64 E;  2EPA A;  5ADZ A;  4OOG C;  2EM6 A;  3T1H E;  2EMZ A;  1A1F A;  5CFF E;  2EWL A;  2YSO A;  2EOE A;  2V8Q B;  1WXR A;  3VK6 A;  4WX9 A;  3UK3 C;  2YTE A;  2EPC A;  1EH6 A;  4P78 A;  1YZ9 A;  3VYX A;  2YTG A;  3ADJ A;  1X49 A;  4BBY A;  2YT4 A;  3AV0 A;  5AAS A;  1PJT A;  1X5W A;  4I8O A;  2UXD E;  2I9I A;  4DMI A;  1ZBQ A;  2LE2 A;  1T39 A;  4DR2 E;  4LFB E;  3P1X A;  2UUB E;  3EPL A;  3J81 C;  2EL4 A;  2B9D A;  2M7Q A;  2LRS A;  5A6A A;  2UUC E;  2LUP B;  4DR5 E;  2EM9 A;  3BGH A;  5KL6 A;  1DQ3 A;  2YTN A;  2JXP A;  2HGH A;  1N32 E;  4JI5 E;  1L4S A;  3K6Q A;  5BR8 E;  4O43 A;  2EPK X;  2MDR A;  3DF6 A;  2VF1 A;  2BBG A;  2L2K B;  4DV2 E;  3VHT B;  3TQM A;  1TN9 A;  4BHC A;  1EH8 A;  4DV3 E;  2WBU A;  3C4T A;  1UIL A;  1IBK E;  4DV0 E;  2MDG A;  2N3G A;  2LMZ A;  1RC7 A;  1X3C A;  2NUF A;  5TSE A;  4BC7 A;  4DKK A;  1N34 E;  2I13 A;  5KL2 A;  3L00 A;  2JY9 A;  3F6G A;  3M99 B;  3ADG A;  2LBS B;  4WXC A;  4DR1 E;  4HTG A;  5IT9 C;  5LMN E;  2EN1 A;  5T6J A;  4LF7 E;  2YTP A;  1KYQ A;  1EH7 A;  1UN6 B;  3JTZ A;  3ADL A;  1A1J A;  4B3S E;  2DIX A;  2EL6 A;  5F3W A;  2UXC E;  4DR6 E;  4LU9 A;  2EMK A;  3MSW A;  1ZAA C;  3LLH A;  4M30 A;  1A1K A;  3FIG A;  1GQE A;  4DR3 E;  2JWO A;  2LO3 A;  2EQ0 A;  4OX9 E;  4GKK E;  4BCA A;  1LLM C;  3ECR A;  3HPS A;  4DV5 E;  1FKA E;  5DNY A;  4X65 E;  4WFT A;  2B3T B;  2R76 A;  1N36 E;  4NXM E;  2LV2 A;  2GLI A;  4X9J A;  3KWR A;  2EE8 A;  2YRM A;  2DSY A;  3C6M A;  4F9A B;  1GTK A;  2LUQ A;  3HQ1 A;  2L92 A;  1F2I G;  2YPN A;  5AE3 A;  1IBM E;  2V85 A;  3MHH C;  4P7D A;  2EM5 A;  2EPR A;  3JU0 A;  1IQO A;  2EOY A;  4O4K A;  3EPK A;  2EN3 A;  4DV6 E;  1XNQ E;  2KOU A;  2EJ4 A;  4GKJ E;  4B3M E;  1Z1B A;  2F8B A;  2EMF A;  3HXL A;  4R03 A;  4YHH E;  5LLQ A;  2L3C A;  2EMI A;  3DJW A;  4JI1 E;  1AH5 A;  3QG5 C;  2NAB A;  2ZM6 E;  1YYW A;  4R2D A;  1J26 A;  2ADR A;  4BS9 A;  1XNR E;  3C6K A;  3IWB A;  1N3G A;  5AC4 A; 
#chains in the Genus database with same CATH homology
 1HNW E;  2L3J A;  2MDR A;  3ZOQ B;  2CPN A;  2L2M A;  2RS7 A;  2VF1 A;  3DF6 A;  5IWA E;  5LMU E;  2L2K B;  4DV2 E;  2E1M A;  2L6M A;  1YYK A;  2ODR C;  1ZBT A;  4DV3 E;  2DMY A;  2UUA E;  2B7V A;  1STU A;  3C4T A;  1UIL A;  1J5E E;  3LML A;  1IBK E;  2FV4 B;  2HHH E;  4KHP E;  5LL6 R;  4F54 A;  4DV0 E;  2N3G A;  2LMZ A;  1RC7 A;  1HNZ E;  4LF8 E;  2EZ6 A;  4K0K E;  2UU9 E;  4BC9 A;  4GEQ B;  4DR7 E;  2NUF A;  1N33 E;  4BC7 A;  1IBL E;  4X8W A;  4DKK A;  4DV7 E;  2RSM A;  1N34 E;  2M1S A;  2V87 A;  4B3T E;  4LFC E;  2JY9 A;  4BMJ A;  3F6G A;  2UXB E;  3ADG A;  4Q28 A;  2JOX A;  1GZ6 A;  1I94 E;  1DI2 A;  2ODR D;  2LBS B;  2IHR 1;  4DR1 E;  5IT9 C;  3IWC A;  2YZT A;  4JI8 E;  1SR9 A;  5LMN E;  3OTO E;  5FLX C;  2LJH A;  5T6J A;  4F9B B;  2NUG A;  1T4N A;  4LF7 E;  5AE1 A;  4JI3 E;  2L33 A;  1EKZ A;  2JVA A;  4LTY A;  3JAM C;  3RMP A;  2NA2 A;  3HTX A;  1WHQ A;  4J8Z A;  2UUC E;  4DUZ E;  4DR4 E;  3JTZ A;  3ADL A;  4F9C B;  4L8N A;  2V86 A;  4B3S E;  4GKK E;  2DIX A;  3IWD A;  5F3W A;  4TUG A;  2UXC E;  2K4V A;  2KHX A;  2E5L E;  4R8O A;  4LF5 E;  4LU9 A;  4TUI A;  4DR6 E;  4M0V A;  3MSW A;  3LLH A;  4M30 A;  4WSP A;  2RTX A;  5A2Q C;  1XMO E;  3FIG A;  1GQE A;  2H36 X;  4DR3 E;  3HPZ A;  3OML A;  2FTX B;  2JWO A;  4JI4 E;  1RQ0 A;  4M2Z A;  4OX9 E;  2LTR A;  2RS6 A;  1O0W A;  5AE2 A;  3VYY A;  1WHN A;  2V89 A;  4BCA A;  4X64 E;  3T1Y E;  1HR0 E;  5ADZ A;  4JI6 E;  4DUY E;  4OOG C;  2F4V E;  1YYO A;  3HPS A;  3T1H E;  2VE7 C;  4DV5 E;  1FKA E;  2MC5 A;  5DNY A;  4X65 E;  4WFT A;  5CFF E;  2EWL A;  2B3T B;  1N36 E;  4NXM E;  1PKP A;  2JOB A;  4LFA E;  2G7H A;  2VQE E;  4LF9 E;  1T4O A;  2V8Q B;  1WXR A;  4DV1 E;  3J7Y p;  4JI7 E;  2V83 A;  3KWR A;  3VK6 A;  4DV4 E;  2L8T A;  4X62 E;  3J80 C;  1HNX E;  4JI0 E;  2DSY A;  4P78 A;  1YZ9 A;  3VYX A;  3C4B A;  4F9A B;  2LUQ A;  2WZO A;  3HQ1 A;  2N3H A;  3ADJ A;  1UHZ A;  2L92 A;  1X49 A;  4BBY A;  2YT4 A;  5AE3 A;  1IBM E;  3AV0 A;  2V85 A;  5AAS A;  2LTS A;  2DB2 A;  4P7D A;  3JU0 A;  1QU6 A;  4KZS A;  4I8O A;  4NXN E;  2FGG A;  2UXD E;  3F6H A;  4DMI A;  2JR1 A;  4LF6 E;  1ZBQ A;  2B7T A;  2V88 A;  4DV6 E;  2KOU A;  4AQY E;  1XNQ E;  2M4I A;  2LE2 A;  4LFB E;  4DR2 E;  4B3M E;  4X66 E;  3P1X A;  4GKJ E;  2F8B A;  2UUB E;  3J7A G;  3J81 C;  3ADI A;  2B9D A;  2LRS A;  3HXL A;  3AUZ A;  1X48 A;  2MC6 A;  4R03 A;  4WPY A;  2M7Q A;  4YHH E;  2L3C A;  3DJW A;  2VQF E;  4DR5 E;  2LUP B;  4LF4 E;  4JI1 E;  1DQ3 A;  1T4L B;  2NUE A;  1N32 E;  4L5N C;  4JI2 E;  1X47 A;  2ZM6 E;  4JI5 E;  1YYW A;  4YY3 E;  2KON A;  1FJG E;  1XMQ E;  1J26 A;  3H09 A;  4BS9 A;  1XNR E;  4WYQ B;  3IWB A;  4JYA E;  4JV5 E;  2L2N A;  3K6Q A;  5BR8 E;  4B3R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...