3ADIA

Structure of arabidopsis hyl1 and its molecular implications for mirna processing
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
71
Chain Sequence
HVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F21M12.9 protein
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation/rna
total genus 18
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adiA00
4NXME 3HTXA 1ZBTA 4LFCE 1HNWE 2L3CA 4DV7E 3VYXA 4JV5E 1T4LB 4M30A 4B3TE 2MDRA 4YHHE 1XMOE 4JI1E 2RS6A 2LJHA 3ADGA 2L2MA 4WFTA 4LF7E 3ADLA 4DV2E 2NA2A 4X62E 2DMYA 2VQEE 1IBKE 2UUCE 2LTRA 2YT4A 4B3RE 1PKPA 5LMUE 4DR2E 3ADIA 1UILA 1N34E 3OTOE 2L33A 1I94E 1WHNA 1XMQE 4K0KE 1STUA 1WHQA 4DUYE 1XNQE 2LTSA 5CFFE 3T1HE 4LF9E 1HNZE 4JI0E 4X64E 4DR5E 3P1XA 2B7TA 1DI2A 2NUFA 2LUQA 2N3HA 3J7Yp 5IWAE 3LLHA 4DV6E 4DR4E 2EZ6A 2N3GA 4DV0E 1XNRE 1X47A 2HHHE 1YZ9A 2E5LE 4JI2E 2JVAA 4B3ME 1QU6A 4DR7E 4DKKA 2UXCE 4X65E 3T1YE 4DUZE 4YY3E 2CPNA 4LFAE 2ZM6E 2B3TB 2RTXA 2NUEA 2NUGA 1YYKA 2L2KB 2UU9E 4DV3E 2DIXA 4AQYE 2DB2A 4JI6E 1T4OA 4JI7E 2RS7A 4DV4E 1N36E 1EKZA 1YYOA 2LBSB 4LF6E 4DR6E 3C4BA 4B3SE 4X8WA 1T4NA 1O0WA 5LMNE 4JI8E 4DV1E 1N32E 2KHXA 1N33E 1FJGE 5BR8E 2JY9A 4LFBE 4NXNE 2L2NA 4KHPE 2VQFE 1HR0E 3ADJA 3VYYA 2UUBE 4OOGC 1RQ0A 4WYQB 4GKJE 4JI3E 1IBLE 4DR3E 2B7VA 4JI5E 4X66E 2UXBE 4OX9E 1IBME 2IHR1 3C4TA 4DV5E 1HNXE 4DR1E 2RSMA 4M2ZA 2LUPB 2L3JA 2UUAE 1FKAE 4JI4E 1YYWA 1J5EE 1UHZA 1RC7A 1GQEA 2LRSA 4LF8E 4GKKE 4JYAE 1J26A 1X49A 1X48A 4LF4E 2UXDE 2F4VE 4LF5E
chains in the Genus database with same CATH superfamily
3HTXA 4LFCE 2H36X 4R2SA 2ENAA 5AASA 4DV7E 2YTDA 4WSPA 2ELZA 2EM8A 3JU0A 3F6GA 2YTQA 2EN3A 3JTZA 5DNYA 4O4KA 1A1LA 4IJDA 3AUZA 3IWDA 4WFTA 3ADLA 2EOHA 2DMYA 1IBKE 1KJKA 1A1KA 2L6MA 4KWYA 3HXLA 3TQMA 4DR2E 3ADIA 2ENCA 1UILA 2RPCA 4R8OA 4RHBB 1WHNA 2EMHA 2EMXA 2YTNA 1STUA 2KOUA 2V85A 1A1IA 2EMAA 1IQSA 3IWCA 3P1XA 2N3HA 3J7Yp 2WBUA 4HTGA 2HC5A 2ENHA 4ZYDA 1X5WA 4DV0E 1X47A 2YSOA 2YTGA 2EJ4A 2EMWA 4O24A 4X65E 1YUIA 3T1YE 4LFAE 2EM6A 1X3CA 2J7JA 2ZM6E 4R2PA 2RTXA 5ADZA 1NCSA 2JP9A 2L2KB 2D9HA 5AE2A 2YU5A 1TN9A 2YTPA 2RS7A 1YFHA 1EKZA 4LF6E 3L00A 4R2EA 4ZYHA 2DGCA 3LMLA 2EMBA 4X8WA 2EMIA 1X6FA 5LL6R 1O0WA 5LMNE 2V87A 1JK1A 2LT7A 1FJGE 4L5NC 1EH7A 3ADJA 1Z1BA 4X66E 1PJQA 4MLQA 1A1FA 2LMZA 1X6HA 1IBME 2EN6A 2MDGA 1RMDA 4DMIA 1HNXE 3DJWA 4R03A 2JXPA 2YWQA 4MLVA 2MC6A 1YYWA 1FKAE 4BMJA 4F2JC 4WXDA 1G2FC 1ZAAC 3FIGA 2V8QB 1SR9A 2EPMX 3BGHA 4Q35B 2EM2A 4LF5E 2V88A 1MEYC 1PJSA 2CT1A 1GTKA 2WBTA 2EPNA 2E72A 4WSGA 4M30A 4B3TE 3MHSC 1XMOE 5F3WA 2EM7A 3ADGA 3VK6A 2EPCA 5A6AA 2L2MA 2YRMA 4DV2E 2NA2A 4X62E 2UUCE 2YRHA 5A6BA 1JK2A 4O43A 4F9CB 2EOQA 4ZYEA 1PKPA 4HEIA 2LJUA 4Q28A 5LMUE 2EN8A 2EM9A 2EMYA 1N34E 2ADRA 1I94E 2LTSA 5CFFE 2EE8A 3EPHA 1EH6A 2EPZA 4X64E 1AH5A 2I9IA 2B7TA 2RQLA 1DI2A 2LCEA 2EOXA 3LLHA 2EZ6A 2YTJA 3AV0A 4R2QA 2YSPA 3VHTB 2N8XA 2EPPA 2LO3A 2JVAA 2EOZA 2UXCE 3QG5C 2EM0A 4NZVA 4YY3E 2VF1A 3BIDA 4X9JA 1WXRA 3THOB 2EM4A 4DV3E 2GLIA 4GZNC 2M7QA 4I8OA 4ZYGA 2YZTA 1ZBQA 2EL4A 3OMLA 5KL2A 1YYOA 1N36E 2LBSB 4P78A 5AC5A 2F8BA 4B3SE 1A1JA 3MHHC 4IS1C 2VRDA 4DV1E 2EQ0A 1N33E 3J7AG 2M1SA 4KHPE 2KONA 5IT9C 2YTFA 4TUIA 1IBLE 2EN4A 2B7VA 2UXBE 2YTOA 3M99B 4NHRA 1PDAA 3EPJA 1TF6A 4RH8A 3C4TA 1YSAC 2BB8A 4WPYA 5AE1A 3BBGA 1QNTA 1PJTA 2L3JA 2UUAE 1G2DC 1UHZA 1F2IG 2EQ1A 1DGCA 1RC7A 1TF3A 2YTIA 2DSYA 5A2QC 1GZ6A 4LF8E 2JYAA 1J26A 3HPZA 2WZOA 4LU9A 4NXME 2EPRA 1HNWE 2EMFA 4JV5E 4BC7A 4F6NA 2EPUA 2M4IA 2LJHA 2GHFA 2EN7A 2EOMA 2YT4A 4R2RA 4B3RE 2EPLX 2EQ3A 3OTOE 2L33A 4LTYA 1XMQE 1XNQE 1N3GA 1EH8A 4LF9E 1HNZE 4R2AA 4M9VC 1T38A 2JR1A 2NUFA 3ZOQB 2LUQA 4BHCA 2JOXA 5IWAE 4DV6E 3H09A 1A1HA 2EPKX 2EOIA 2JWOA 2HJJA 2HHHE 1YZ9A 2NABA 2RSIA 4JI2E 4B3ME 5KL6A 1QU6A 4DR7E 4O5GA 2EL6A 4DKKA 2EM5A 5A6BD 5KL3A 4DUZE 3C6MA 2CPNA 3F6HA 2B3TB 1YYKA 2EMKA 2UU9E 5IXMB 4F9AB 2R76A 2EMGA 4BS9A 4AQYE 2EMZA 1KYQA 2I13A 1DQ3A 5KL7A 2WBSA 2EL5A 2K7IA 2M9AA 4JI7E 2FGGA 2DMIA 2DLKA 1UN6B 2JOBA 4DV4E 2BBGA 4F54A 2ELYA 2WCC3 1L4SA 5A6JA 3K6QA 4WX9A 2EOFA 2ODRD 1MGTA 2JPAA 4L8NA 2K4VA 2G7HA 2CTDA 1P47A 4LFBE 2VQFE 1HR0E 3VYYA 2UUBE 4OOGC 4WYQB 2MC5A 4JI3E 4GKJE 1BB8A 4DR3E 5AE3A 4GEQB 5FLXC 2L8TA 2IHR1 3KZZA 2EOSA 2EOEA 4TUGA 4DV5E 3C6KA 1IQOA 2LE2A 4DR1E 4WXCA 4BBYA 4JI4E 2FTXB 3THNA 1GQEA 4GKKE 4JYAE 1SFEA 4LF4E 3EPLA 1NEIA 2F4VE 2EPAA 1ZBTA 2DLQA 2L3CA 3VYXA 1T4LB 2LV2A 2MDRA 4YHHE 4JI1E 2RS6A 2EN1A 2EOOA 4LF7E 2V86A 3ECRA 2A25A 2VQEE 2EM3A 2LTRA 2EPOA 1A1GA 4BCAA 3J81C 1LLMC 1YUJA 2EWLA 4F6MA 4K0KE 1X6EA 2L92A 4J8ZA 1WHQA 4DUYE 3T1HE 4JI0E 4DR5E 2E1MA 4N4RB 2HGHA 2EMCA 2EORA 2EOYA 2MKNA 3HPSA 4DR4E 2Q8UA 2N3GA 1XNRE 1WJPA 2PRTA 5TSEA 2E5LE 2VE7C 2ODRC 5T6JA 3BF2A 3HQ1A 4KZSA 5AC4A 2NUEA 2NUGA 2CSHA 2DIXA 3IWBA 2DB2A 1BBOA 5A6KA 4JI6E 1T4OA 3MSWA 2MKDA 3J80C 5KL5A 3RMPA 2YRKA 1IMUA 4R2CA 2YPNA 1YPNA 3EPKA 4DR6E 3C4BA 3UK3C 4FK5C 4R2DA 2V89A 1AAYA 3KWRA 3EQ1A 1T4NA 2EN2A 2LVHA 2DRPA 4JI8E 2YTEA 1N32E 2EOJA 1WRJA 2KHXA 2EP3A 5IV8B 1B69A 5BR8E 2JY9A 4BHBA 4NXNE 2L2NA 2GPIA 2R1FA 2EPXA 1RQ0A 1ZR9A 2EMLA 4JI5E 2YU8A 3KZYA 4OX9E 1BBGA 1ZU1A 5KL4A 4P7DA 3DF6A 1T39A 5A69A 2RSMA 5LLQA 4M2ZA 2LUPB 4BC9A 4M0VA 2FV4B 1J5EE 2B9DA 2LRSA 1UBDC 3JAMC 1X49A 1X48A 4F9BB 2V83A 2UXDE
chains in the Genus database with same CATH topology
4NXME 3HTXA 1ZBTA 4LFCE 2H36X 2V88A 1HNWE 5AASA 2L3CA 4WSPA 4BC7A 4DV7E 3VYXA 4JV5E 1T4LB 4M30A 2M4IA 4B3TE 3JU0A 2MDRA 3F6GA 4YHHE 1XMOE 4JI1E 2RS6A 5F3WA 2LJHA 3ADGA 3JTZA 3VK6A 5DNYA 2L2MA 3AUZA 3IWDA 4WFTA 4LF7E 3ADLA 2V86A 4DV2E 2NA2A 4X62E 2DMYA 2VQEE 1IBKE 2UUCE 2LTRA 4JI4E 2YT4A 4B3RE 4F9CB 2L6MA 1PKPA 4Q28A 3HXLA 4BCAA 3J81C 5LMUE 4DR2E 3ADIA 1UILA 4R8OA 1N34E 3OTOE 2L33A 1I94E 1WHNA 4LTYA 1XMQE 2EWLA 4K0KE 2L92A 4J8ZA 2KOUA 1STUA 1WHQA 4DUYE 1XNQE 2LTSA 5CFFE 3T1HE 2V85A 4LF9E 3IWCA 1HNZE 4JI0E 4X64E 4DR5E 2E1MA 3P1XA 2B7TA 2JR1A 1DI2A 2NUFA 3ZOQB 2LUQA 2N3HA 3J7Yp 2JOXA 3LLHA 3HPSA 5IWAE 3H09A 4DV6E 2EZ6A 2N3GA 3AV0A 4DR4E 2JWOA 4DV0E 1XNRE 1X47A 2HHHE 1YZ9A 2E5LE 4JI2E 2JVAA 4B3ME 1QU6A 2VE7C 4DR7E 4DKKA 2ODRC 2UXCE 5T6JA 4X65E 3T1YE 4DUZE 4YY3E 2CPNA 2VF1A 3F6HA 4LFAE 3HQ1A 4KZSA 2ZM6E 1WXRA 2B3TB 2RTXA 5ADZA 2NUEA 2NUGA 1YYKA 2L2KB 2UU9E 4F9AB 4DV3E 2DIXA 3IWBA 2DB2A 2M7QA 4BS9A 4AQYE 1DQ3A 4JI6E 1T4OA 3MSWA 4I8OA 5AE2A 4JI7E 2YZTA 2FGGA 1ZBQA 2JOBA 2RS7A 3J80C 4DV4E 3RMPA 3OMLA 4F54A 1YYOA 1N36E 1EKZA 2LBSB 4LF6E 4P78A 4DR6E 3C4BA 2F8BA 2V89A 3LMLA 4B3SE 4X8WA 3K6QA 5LL6R 3KWRA 2ODRD 1T4NA 1O0WA 5LMNE 2V87A 4JI8E 4DV1E 4L8NA 1N32E 2K4VA 2KHXA 2G7HA 1N33E 1FJGE 5BR8E 2JY9A 4LFBE 4NXNE 2L2NA 2M1SA 4L5NC 3J7AG 4KHPE 2KONA 2VQFE 5IT9C 1HR0E 3ADJA 4TUIA 3VYYA 1RQ0A 4OOGC 2UUBE 4WYQB 2MC5A 4JI3E 4GKJE 1IBLE 4DR3E 2B7VA 4JI5E 4X66E 2UXBE 5AE3A 4GEQB 2LMZA 5FLXC 4OX9E 2L8TA 4P7DA 2IHR1 1IBME 3C4TA 3DF6A 4DMIA 4TUGA 4DV5E 1HNXE 4WPYA 5AE1A 3DJWA 4R03A 2LE2A 4DR1E 2RSMA 2MC6A 4M2ZA 2LUPB 4BBYA 4BC9A 4M0VA 4BMJA 2FTXB 2L3JA 1FKAE 2UUAE 2FV4B 1J5EE 1YYWA 1UHZA 1RC7A 2B9DA 1GQEA 2LRSA 5A2QC 2DSYA 3JAMC 1GZ6A 4LF8E 4GKKE 4JYAE 1J26A 1X49A 3HPZA 3FIGA 2WZOA 2V8QB 1SR9A 1X48A 4LF4E 4F9BB 2V83A 2UXDE 2F4VE 4LF5E 4LU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM E;  3HTX A;  1ZBT A;  4LFC E;  1HNW E;  2L3C A;  4DV7 E;  3VYX A;  4JV5 E;  1T4L B;  4M30 A;  4B3T E;  2MDR A;  4YHH E;  1XMO E;  4JI1 E;  2RS6 A;  2LJH A;  3ADG A;  2L2M A;  4WFT A;  4LF7 E;  3ADL A;  4DV2 E;  2NA2 A;  4X62 E;  2DMY A;  2VQE E;  1IBK E;  2UUC E;  2LTR A;  2YT4 A;  4B3R E;  1PKP A;  5LMU E;  4DR2 E;  3ADI A;  1UIL A;  1N34 E;  3OTO E;  2L33 A;  1I94 E;  1WHN A;  1XMQ E;  4K0K E;  1STU A;  1WHQ A;  4DUY E;  1XNQ E;  2LTS A;  5CFF E;  3T1H E;  4LF9 E;  1HNZ E;  4JI0 E;  4X64 E;  4DR5 E;  3P1X A;  2B7T A;  1DI2 A;  2NUF A;  2LUQ A;  2N3H A;  3J7Y p;  5IWA E;  3LLH A;  4DV6 E;  4DR4 E;  2EZ6 A;  2N3G A;  4DV0 E;  1XNR E;  1X47 A;  2HHH E;  1YZ9 A;  2E5L E;  4JI2 E;  2JVA A;  4B3M E;  1QU6 A;  4DR7 E;  4DKK A;  2UXC E;  4X65 E;  3T1Y E;  4DUZ E;  4YY3 E;  2CPN A;  4LFA E;  2ZM6 E;  2B3T B;  2RTX A;  2NUE A;  2NUG A;  1YYK A;  2L2K B;  2UU9 E;  4DV3 E;  2DIX A;  4AQY E;  2DB2 A;  4JI6 E;  1T4O A;  4JI7 E;  2RS7 A;  4DV4 E;  1N36 E;  1EKZ A;  1YYO A;  2LBS B;  4LF6 E;  4DR6 E;  3C4B A;  4B3S E;  4X8W A;  1T4N A;  1O0W A;  5LMN E;  4JI8 E;  4DV1 E;  1N32 E;  2KHX A;  1N33 E;  1FJG E;  5BR8 E;  2JY9 A;  4LFB E;  4NXN E;  2L2N A;  4KHP E;  2VQF E;  1HR0 E;  3ADJ A;  3VYY A;  2UUB E;  4OOG C;  1RQ0 A;  4WYQ B;  4GKJ E;  4JI3 E;  1IBL E;  4DR3 E;  2B7V A;  4JI5 E;  4X66 E;  2UXB E;  4OX9 E;  1IBM E;  2IHR 1;  3C4T A;  4DV5 E;  1HNX E;  4DR1 E;  2RSM A;  4M2Z A;  2LUP B;  2L3J A;  2UUA E;  1FKA E;  4JI4 E;  1YYW A;  1J5E E;  1UHZ A;  1RC7 A;  1GQE A;  2LRS A;  4LF8 E;  4GKK E;  4JYA E;  1J26 A;  1X49 A;  1X48 A;  4LF4 E;  2UXD E;  2F4V E;  4LF5 E; 
#chains in the Genus database with same CATH topology
 3HTX A;  4LFC E;  2H36 X;  4R2S A;  2ENA A;  5AAS A;  4DV7 E;  2YTD A;  4WSP A;  2ELZ A;  2EM8 A;  3JU0 A;  3F6G A;  2YTQ A;  2EN3 A;  3JTZ A;  5DNY A;  4O4K A;  1A1L A;  4IJD A;  3AUZ A;  3IWD A;  4WFT A;  3ADL A;  2EOH A;  2DMY A;  1IBK E;  1KJK A;  1A1K A;  2L6M A;  4KWY A;  3HXL A;  3TQM A;  4DR2 E;  3ADI A;  2ENC A;  1UIL A;  2RPC A;  4R8O A;  4RHB B;  1WHN A;  2EMH A;  2EMX A;  2YTN A;  1STU A;  2KOU A;  2V85 A;  1A1I A;  2EMA A;  1IQS A;  3IWC A;  3P1X A;  2N3H A;  3J7Y p;  2WBU A;  4HTG A;  2HC5 A;  2ENH A;  4ZYD A;  1X5W A;  4DV0 E;  1X47 A;  2YSO A;  2YTG A;  2EJ4 A;  2EMW A;  4O24 A;  4X65 E;  1YUI A;  3T1Y E;  4LFA E;  2EM6 A;  1X3C A;  2J7J A;  2ZM6 E;  4R2P A;  2RTX A;  5ADZ A;  1NCS A;  2JP9 A;  2L2K B;  2D9H A;  5AE2 A;  2YU5 A;  1TN9 A;  2YTP A;  2RS7 A;  1YFH A;  1EKZ A;  4LF6 E;  3L00 A;  4R2E A;  4ZYH A;  2DGC A;  3LML A;  2EMB A;  4X8W A;  2EMI A;  1X6F A;  5LL6 R;  1O0W A;  5LMN E;  2V87 A;  1JK1 A;  2LT7 A;  1FJG E;  4L5N C;  1EH7 A;  3ADJ A;  1Z1B A;  4X66 E;  1PJQ A;  4MLQ A;  1A1F A;  2LMZ A;  1X6H A;  1IBM E;  2EN6 A;  2MDG A;  1RMD A;  4DMI A;  1HNX E;  3DJW A;  4R03 A;  2JXP A;  2YWQ A;  4MLV A;  2MC6 A;  1YYW A;  1FKA E;  4BMJ A;  4F2J C;  4WXD A;  1G2F C;  1ZAA C;  3FIG A;  2V8Q B;  1SR9 A;  2EPM X;  3BGH A;  4Q35 B;  2EM2 A;  4LF5 E;  2V88 A;  1MEY C;  1PJS A;  2CT1 A;  1GTK A;  2WBT A;  2EPN A;  2E72 A;  4WSG A;  4M30 A;  4B3T E;  3MHS C;  1XMO E;  5F3W A;  2EM7 A;  3ADG A;  3VK6 A;  2EPC A;  5A6A A;  2L2M A;  2YRM A;  4DV2 E;  2NA2 A;  4X62 E;  2UUC E;  2YRH A;  5A6B A;  1JK2 A;  4O43 A;  4F9C B;  2EOQ A;  4ZYE A;  1PKP A;  4HEI A;  2LJU A;  4Q28 A;  5LMU E;  2EN8 A;  2EM9 A;  2EMY A;  1N34 E;  2ADR A;  1I94 E;  2LTS A;  5CFF E;  2EE8 A;  3EPH A;  1EH6 A;  2EPZ A;  4X64 E;  1AH5 A;  2I9I A;  2B7T A;  2RQL A;  1DI2 A;  2LCE A;  2EOX A;  3LLH A;  2EZ6 A;  2YTJ A;  3AV0 A;  4R2Q A;  2YSP A;  3VHT B;  2N8X A;  2EPP A;  2LO3 A;  2JVA A;  2EOZ A;  2UXC E;  3QG5 C;  2EM0 A;  4NZV A;  4YY3 E;  2VF1 A;  3BID A;  4X9J A;  1WXR A;  3THO B;  2EM4 A;  4DV3 E;  2GLI A;  4GZN C;  2M7Q A;  4I8O A;  4ZYG A;  2YZT A;  1ZBQ A;  2EL4 A;  3OML A;  5KL2 A;  1YYO A;  1N36 E;  2LBS B;  4P78 A;  5AC5 A;  2F8B A;  4B3S E;  1A1J A;  3MHH C;  4IS1 C;  2VRD A;  4DV1 E;  2EQ0 A;  1N33 E;  3J7A G;  2M1S A;  4KHP E;  2KON A;  5IT9 C;  2YTF A;  4TUI A;  1IBL E;  2EN4 A;  2B7V A;  2UXB E;  2YTO A;  3M99 B;  4NHR A;  1PDA A;  3EPJ A;  1TF6 A;  4RH8 A;  3C4T A;  1YSA C;  2BB8 A;  4WPY A;  5AE1 A;  3BBG A;  1QNT A;  1PJT A;  2L3J A;  2UUA E;  1G2D C;  1UHZ A;  1F2I G;  2EQ1 A;  1DGC A;  1RC7 A;  1TF3 A;  2YTI A;  2DSY A;  5A2Q C;  1GZ6 A;  4LF8 E;  2JYA A;  1J26 A;  3HPZ A;  2WZO A;  4LU9 A;  4NXM E;  2EPR A;  1HNW E;  2EMF A;  4JV5 E;  4BC7 A;  4F6N A;  2EPU A;  2M4I A;  2LJH A;  2GHF A;  2EN7 A;  2EOM A;  2YT4 A;  4R2R A;  4B3R E;  2EPL X;  2EQ3 A;  3OTO E;  2L33 A;  4LTY A;  1XMQ E;  1XNQ E;  1N3G A;  1EH8 A;  4LF9 E;  1HNZ E;  4R2A A;  4M9V C;  1T38 A;  2JR1 A;  2NUF A;  3ZOQ B;  2LUQ A;  4BHC A;  2JOX A;  5IWA E;  4DV6 E;  3H09 A;  1A1H A;  2EPK X;  2EOI A;  2JWO A;  2HJJ A;  2HHH E;  1YZ9 A;  2NAB A;  2RSI A;  4JI2 E;  4B3M E;  5KL6 A;  1QU6 A;  4DR7 E;  4O5G A;  2EL6 A;  4DKK A;  2EM5 A;  5A6B D;  5KL3 A;  4DUZ E;  3C6M A;  2CPN A;  3F6H A;  2B3T B;  1YYK A;  2EMK A;  2UU9 E;  5IXM B;  4F9A B;  2R76 A;  2EMG A;  4BS9 A;  4AQY E;  2EMZ A;  1KYQ A;  2I13 A;  1DQ3 A;  5KL7 A;  2WBS A;  2EL5 A;  2K7I A;  2M9A A;  4JI7 E;  2FGG A;  2DMI A;  2DLK A;  1UN6 B;  2JOB A;  4DV4 E;  2BBG A;  4F54 A;  2ELY A;  2WCC 3;  1L4S A;  5A6J A;  3K6Q A;  4WX9 A;  2EOF A;  2ODR D;  1MGT A;  2JPA A;  4L8N A;  2K4V A;  2G7H A;  2CTD A;  1P47 A;  4LFB E;  2VQF E;  1HR0 E;  3VYY A;  2UUB E;  4OOG C;  4WYQ B;  2MC5 A;  4JI3 E;  4GKJ E;  1BB8 A;  4DR3 E;  5AE3 A;  4GEQ B;  5FLX C;  2L8T A;  2IHR 1;  3KZZ A;  2EOS A;  2EOE A;  4TUG A;  4DV5 E;  3C6K A;  1IQO A;  2LE2 A;  4DR1 E;  4WXC A;  4BBY A;  4JI4 E;  2FTX B;  3THN A;  1GQE A;  4GKK E;  4JYA E;  1SFE A;  4LF4 E;  3EPL A;  1NEI A;  2F4V E;  2EPA A;  1ZBT A;  2DLQ A;  2L3C A;  3VYX A;  1T4L B;  2LV2 A;  2MDR A;  4YHH E;  4JI1 E;  2RS6 A;  2EN1 A;  2EOO A;  4LF7 E;  2V86 A;  3ECR A;  2A25 A;  2VQE E;  2EM3 A;  2LTR A;  2EPO A;  1A1G A;  4BCA A;  3J81 C;  1LLM C;  1YUJ A;  2EWL A;  4F6M A;  4K0K E;  1X6E A;  2L92 A;  4J8Z A;  1WHQ A;  4DUY E;  3T1H E;  4JI0 E;  4DR5 E;  2E1M A;  4N4R B;  2HGH A;  2EMC A;  2EOR A;  2EOY A;  2MKN A;  3HPS A;  4DR4 E;  2Q8U A;  2N3G A;  1XNR E;  1WJP A;  2PRT A;  5TSE A;  2E5L E;  2VE7 C;  2ODR C;  5T6J A;  3BF2 A;  3HQ1 A;  4KZS A;  5AC4 A;  2NUE A;  2NUG A;  2CSH A;  2DIX A;  3IWB A;  2DB2 A;  1BBO A;  5A6K A;  4JI6 E;  1T4O A;  3MSW A;  2MKD A;  3J80 C;  5KL5 A;  3RMP A;  2YRK A;  1IMU A;  4R2C A;  2YPN A;  1YPN A;  3EPK A;  4DR6 E;  3C4B A;  3UK3 C;  4FK5 C;  4R2D A;  2V89 A;  1AAY A;  3KWR A;  3EQ1 A;  1T4N A;  2EN2 A;  2LVH A;  2DRP A;  4JI8 E;  2YTE A;  1N32 E;  2EOJ A;  1WRJ A;  2KHX A;  2EP3 A;  5IV8 B;  1B69 A;  5BR8 E;  2JY9 A;  4BHB A;  4NXN E;  2L2N A;  2GPI A;  2R1F A;  2EPX A;  1RQ0 A;  1ZR9 A;  2EML A;  4JI5 E;  2YU8 A;  3KZY A;  4OX9 E;  1BBG A;  1ZU1 A;  5KL4 A;  4P7D A;  3DF6 A;  1T39 A;  5A69 A;  2RSM A;  5LLQ A;  4M2Z A;  2LUP B;  4BC9 A;  4M0V A;  2FV4 B;  1J5E E;  2B9D A;  2LRS A;  1UBD C;  3JAM C;  1X49 A;  1X48 A;  4F9B B;  2V83 A;  2UXD E; 
#chains in the Genus database with same CATH homology
 4NXM E;  3HTX A;  1ZBT A;  4LFC E;  2H36 X;  2V88 A;  1HNW E;  5AAS A;  2L3C A;  4WSP A;  4BC7 A;  4DV7 E;  3VYX A;  4JV5 E;  1T4L B;  4M30 A;  2M4I A;  4B3T E;  3JU0 A;  2MDR A;  3F6G A;  4YHH E;  1XMO E;  4JI1 E;  2RS6 A;  5F3W A;  2LJH A;  3ADG A;  3JTZ A;  3VK6 A;  5DNY A;  2L2M A;  3AUZ A;  3IWD A;  4WFT A;  4LF7 E;  3ADL A;  2V86 A;  4DV2 E;  2NA2 A;  4X62 E;  2DMY A;  2VQE E;  1IBK E;  2UUC E;  2LTR A;  4JI4 E;  2YT4 A;  4B3R E;  4F9C B;  2L6M A;  1PKP A;  4Q28 A;  3HXL A;  4BCA A;  3J81 C;  5LMU E;  4DR2 E;  3ADI A;  1UIL A;  4R8O A;  1N34 E;  3OTO E;  2L33 A;  1I94 E;  1WHN A;  4LTY A;  1XMQ E;  2EWL A;  4K0K E;  2L92 A;  4J8Z A;  2KOU A;  1STU A;  1WHQ A;  4DUY E;  1XNQ E;  2LTS A;  5CFF E;  3T1H E;  2V85 A;  4LF9 E;  3IWC A;  1HNZ E;  4JI0 E;  4X64 E;  4DR5 E;  2E1M A;  3P1X A;  2B7T A;  2JR1 A;  1DI2 A;  2NUF A;  3ZOQ B;  2LUQ A;  2N3H A;  3J7Y p;  2JOX A;  3LLH A;  3HPS A;  5IWA E;  3H09 A;  4DV6 E;  2EZ6 A;  2N3G A;  3AV0 A;  4DR4 E;  2JWO A;  4DV0 E;  1XNR E;  1X47 A;  2HHH E;  1YZ9 A;  2E5L E;  4JI2 E;  2JVA A;  4B3M E;  1QU6 A;  2VE7 C;  4DR7 E;  4DKK A;  2ODR C;  2UXC E;  5T6J A;  4X65 E;  3T1Y E;  4DUZ E;  4YY3 E;  2CPN A;  2VF1 A;  3F6H A;  4LFA E;  3HQ1 A;  4KZS A;  2ZM6 E;  1WXR A;  2B3T B;  2RTX A;  5ADZ A;  2NUE A;  2NUG A;  1YYK A;  2L2K B;  2UU9 E;  4F9A B;  4DV3 E;  2DIX A;  3IWB A;  2DB2 A;  2M7Q A;  4BS9 A;  4AQY E;  1DQ3 A;  4JI6 E;  1T4O A;  3MSW A;  4I8O A;  5AE2 A;  4JI7 E;  2YZT A;  2FGG A;  1ZBQ A;  2JOB A;  2RS7 A;  3J80 C;  4DV4 E;  3RMP A;  3OML A;  4F54 A;  1YYO A;  1N36 E;  1EKZ A;  2LBS B;  4LF6 E;  4P78 A;  4DR6 E;  3C4B A;  2F8B A;  2V89 A;  3LML A;  4B3S E;  4X8W A;  3K6Q A;  5LL6 R;  3KWR A;  2ODR D;  1T4N A;  1O0W A;  5LMN E;  2V87 A;  4JI8 E;  4DV1 E;  4L8N A;  1N32 E;  2K4V A;  2KHX A;  2G7H A;  1N33 E;  1FJG E;  5BR8 E;  2JY9 A;  4LFB E;  4NXN E;  2L2N A;  2M1S A;  4L5N C;  3J7A G;  4KHP E;  2KON A;  2VQF E;  5IT9 C;  1HR0 E;  3ADJ A;  4TUI A;  3VYY A;  1RQ0 A;  4OOG C;  2UUB E;  4WYQ B;  2MC5 A;  4JI3 E;  4GKJ E;  1IBL E;  4DR3 E;  2B7V A;  4JI5 E;  4X66 E;  2UXB E;  5AE3 A;  4GEQ B;  2LMZ A;  5FLX C;  4OX9 E;  2L8T A;  4P7D A;  2IHR 1;  1IBM E;  3C4T A;  3DF6 A;  4DMI A;  4TUG A;  4DV5 E;  1HNX E;  4WPY A;  5AE1 A;  3DJW A;  4R03 A;  2LE2 A;  4DR1 E;  2RSM A;  2MC6 A;  4M2Z A;  2LUP B;  4BBY A;  4BC9 A;  4M0V A;  4BMJ A;  2FTX B;  2L3J A;  1FKA E;  2UUA E;  2FV4 B;  1J5E E;  1YYW A;  1UHZ A;  1RC7 A;  2B9D A;  1GQE A;  2LRS A;  5A2Q C;  2DSY A;  3JAM C;  1GZ6 A;  4LF8 E;  4GKK E;  4JYA E;  1J26 A;  1X49 A;  3HPZ A;  3FIG A;  2WZO A;  2V8Q B;  1SR9 A;  1X48 A;  4LF4 E;  4F9B B;  2V83 A;  2UXD E;  2F4V E;  4LF5 E;  4LU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...