2L92A

Solution structure of the c-terminal domain of h-ns like protein bv3f
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
44
structure length
44
Chain Sequence
b'MSTVPKYRDPATGKTWSGRGRQPAWLGNDPAAFLIQPDLPAILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone family protein nucleoid-structuring protein H-NS
publication title Structural basis for recognition of AT-rich DNA by unrelated xenogeneic silencing proteins
pubmed doi rcsb
source organism Burkholderia vietnamiensis
molecule tags Dna binding protein
total genus 3
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2011-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.420 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l92A01
2L92A
chains in the Genus database with same CATH superfamily
1XMQE 2EMHA 2M1SA 1A1LA 2EMZA 1HNXE 5IT9C 4B3RE 4B3TE 3RMPA 2MKDA 1EH7A 1WXRA 4R2SA 2FTXB 2DIXA 2L2MA 2CSHA 3ECRA 2A25A 3BF2A 2WBTA 1A1JA 4P78A 2EM5A 3M99B 3LLHA 3C6KA 2R1FA 1N33E 4DV4E 3VHTB 1X6EA 2DMYA 5KL6A 2MDRA 1X5WA 2JOBA 1N34E 3DF6A 4X66E 4N4RB 1IBKE 1EH6A 2EN1A 2YRMA 4HEIA 2JR1A 1TF3A 1ZBQA 2EMCA 4R2EA 4TUGA 4MLQA 4KZSA 1ZBTA 4P7DA 2DMIA 2ENHA 4WXCA 2YZTA 1STUA 3C4BA 4RHBB 2ZM6E 4R2QA 1T4NA 4F2JC 5LMUE 2H36X 3ZOQB 2UXCE 4LF8E 2R76A 4O24A 2CT1A 2EM7A 3IWCA 2VQEE 2MDGA 2EORA 1MGTA 3UK3C 4DV2E 4F6MA 3ADIA 2EPNA 4FK5C 2NUFA 4F6NA 3HPZA 2EP3A 2EN8A 3THNA 4JYAE 2ODRC 2F8BA 3LMLA 4DR7E 2CPNA 4MLVA 4R2AA 4Q35B 2V8QB 2LVHA 1XNRE 2EOXA 4DR1E 3JAMC 4NXNE 4GKKE 4GZNC 2YU5A 4LFCE 4DR4E 2JYAA 3DJWA 5AE3A 2LRSA 4LFAE 2BB8A 2N3HA 4F9BB 2YTJA 3P1XA 3F6HA 2GHFA 4NZVA 2HGHA 2JXPA 1T38A 1TN9A 1GTKA 4OOGC 2J7JA 4B3ME 5IXMB 2EOFA 4YY3E 2LT7A 2VE7C 2YTGA 4BHBA 1YPNA 1BBGA 2RQLA 2HJJA 2ADRA 4JI3E 4HTGA 1IQSA 2B7VA 4O5GA 4M2ZA 1EKZA 4KWYA 2I9IA 2EOZA 3J7AG 1DQ3A 2EM2A 1YUJA 5AC5A 2EQ1A 4WFTA 2ENCA 1XNQE 3TQMA 1NCSA 4BHCA 3T1HE 1YYWA 2M4IA 2HHHE 4BBYA 2LJHA 1HNWE 1AAYA 2EMBA 1BB8A 5BR8E 4J8ZA 3JU0A 3VYYA 1WHNA 2EM0A 1X6FA 4X9JA 1ZAAC 4L5NC 2FGGA 4JI5E 2EPLX 4X64E 2EMYA 2JVAA 3K6QA 5KL5A 5A6BA 1N3GA 2LCEA 2Q8UA 1JK1A 2V86A 1FKAE 2GPIA 4JV5E 2EPCA 1RQ0A 2RPCA 3KWRA 3HTXA 2L2KB 3BGHA 4R2PA 5A6BD 2EOQA 2YSOA 3QG5C 2UXDE 5A6JA 2YTIA 3HQ1A 3VK6A 1WHQA 2EPZA 2IHR1 2LBSB 2B9DA 2EPAA 1DI2A 2EMLA 4M9VC 5CFFE 4O4KA 2WCC3 2BBGA 2LMZA 1UBDC 2V83A 3ADGA 4LF5E 3OMLA 4OX9E 2KHXA 1WJPA 2EOIA 2RSIA 3EPHA 2MC5A 4F9CB 1MEYC 1PJQA 2B7TA 2RTXA 4L8NA 2JPAA 1A1FA 2YTPA 2DSYA 1YSAC 4X65E 4DR3E 2B3TB 5A69A 2YPNA 1X49A 1HR0E 4M30A 4BMJA 2DRPA 3FIGA 1QNTA 4DV6E 4DV7E 2M7QA 2VF1A 3H09A 2RS7A 4DMIA 2L8TA 2WBSA 2L6MA 5IWAE 2JOXA 2LE2A 1QU6A 4JI6E 2KONA 3AV0A 4R2CA 2LTSA 5AASA 1PJTA 4ZYGA 2K7IA 1X3CA 1IBME 3AUZA 2YTNA 3T1YE 4NHRA 1F2IG 2EN7A 4LFBE 1KYQA 3EPJA 2YTQA 3KZZA 4KHPE 4WX9A 4AQYE 1JK2A 2EOJA 4JI8E 4ZYDA 5KL2A 1T39A 4DV1E 2L3CA 1NEIA 5IV8B 1A1GA 2V88A 4LF7E 1IQOA 2MKNA 3EQ1A 4M0VA 1N36E 2EMGA 2EQ0A 1XMOE 2YRKA 3JTZA 4BC9A 2L33A 2EN6A 3VYXA 2KOUA 1HNZE 4DKKA 1X47A 3C4TA 2N3GA 5AE1A 5DNYA 4R8OA 4JI4E 4R03A 2EN3A 3MHHC 4IJDA 2LO3A 4DR6E 2EOOA 2NABA 2YTEA 1YYKA 2EL5A 2EPKX 1G2FC 2E72A 3EPKA 1GQEA 4IS1C 1A1KA 2JP9A 2EN2A 4DUZE 4X8WA 2LUPB 3BBGA 4LF4E 1SR9A 2EM9A 2LV2A 3J7Yp 5KL3A 4BS9A 4JI7E 2M9AA 5LL6R 4I8OA 3ADJA 4F9AB 2E5LE 2YTDA 2EOSA 2LUQA 2UUAE 2N8XA 5ADZA 1J5EE 1TF6A 2EE8A 1IBLE 2EMKA 2EPPA 5A6KA 2EPUA 1N32E 1T4OA 1X48A 2V87A 1A1IA 2EM3A 2EOEA 2V85A 2VRDA 2F4VE 2EQ3A 1ZU1A 2EN4A 2JY9A 2EPXA 4WSGA 4R2RA 1GZ6A 2EM6A 2L3JA 2EM4A 2CTDA 1RMDA 2L92A 4R2DA 1A1HA 2V89A 4LTYA 5T6JA 2GLIA 1UN6B 3MSWA 3L00A 2ENAA 4DR2E 4ZYEA 2EL4A 1YZ9A 2YWQA 1I94E 5A6AA 4F54A 2FV4B 4LU9A 2YTFA 4BC7A 2L2NA 3IWDA 1LLMC 4JI1E 4B3SE 1SFEA 3J81C 4JI2E 5FLXC 2RSMA 4BCAA 3BIDA 4JI0E 4GKJE 2WBUA 3EPLA 1J26A 2DB2A 2EWLA 2DLKA 2NA2A 2YRHA 4DR5E 5A2QC 2EMAA 2VQFE 2E1MA 2EM8A 2HC5A 2RS6A 4WXDA 1KJKA 2YT4A 3MHSC 2NUEA 1PDAA 2G7HA 2WZOA 3F6GA 1T4LB 2EOHA 2PRTA 2NUGA 4X62E 2ELYA 1ZR9A 1O0WA 3HXLA 5LLQA 4WSPA 4DV5E 4DUYE 2UUCE 2D9HA 4RH8A 4GEQB 1YFHA 1G2DC 2EMXA 1WRJA 2EPOA 2EJ4A 4Q28A 5AE2A 2EMWA 2DLQA 4O43A 4DV3E 1L4SA 3THOB 2UXBE 3KZYA 5KL7A 4YHHE 1DGCA 2K4VA 1B69A 1IMUA 1BBOA 2UUBE 4LF6E 2ELZA 2EMFA 5LMNE 2ODRD 1EH8A 2LTRA 2EPRA 5F3WA 1AH5A 1UHZA 1PKPA 2YTOA 2YU8A 4ZYHA 5AC4A 1Z1BA 4TUIA 3J80C 1RC7A 1FJGE 5TSEA 4LF9E 1X6HA 3C6MA 2UU9E 4NXME 2EL6A 2EOYA 2MC6A 3HPSA 2I13A 1PJSA 1YYOA 2EMIA 2DGCA 4K0KE 4WYQB 2EOMA 2EPMX 1YUIA 1UILA 4DV0E 3ADLA 3IWBA 2EZ6A 4WPYA 1P47A 3OTOE 2JWOA 2YSPA 5KL4A 2LJUA
chains in the Genus database with same CATH topology
2L6MA 5IWAE 2JOXA 2LE2A 1QU6A 2M1SA 2V89A 2VE7C 2KONA 4LTYA 3AV0A 5T6JA 3MSWA 1HNXE 5IT9C 2LTSA 5AASA 4DR2E 1YZ9A 1IBME 1I94E 4JI3E 4B3RE 2B7VA 3AUZA 4F54A 3T1YE 4B3TE 2FV4B 4M2ZA 1EKZA 3RMPA 4LU9A 4LFBE 3J7AG 1WXRA 1DQ3A 4BC7A 2L2NA 3IWDA 4JI1E 4KHPE 4WFTA 4B3SE 4AQYE 1XNQE 3J81C 2FTXB 4JI8E 4JI2E 2DIXA 2L2MA 5FLXC 2RSMA 4BCAA 3T1HE 4JI0E 1YYWA 2M4IA 4GKJE 2HHHE 4BBYA 4DV1E 1J26A 2L3CA 2DB2A 2EWLA 2LJHA 1HNWE 2NA2A 4DR5E 5A2QC 2V88A 2VQFE 4LF7E 2E1MA 4P78A 4M0VA 5BR8E 1N36E 4J8ZA 1XMOE 3LLHA 1N33E 3JTZA 4DV4E 2RS6A 3JU0A 4BC9A 2YT4A 3VYYA 2DMYA 2L33A 2MDRA 1WHNA 2JOBA 1N34E 2NUEA 3VYXA 2G7HA 2WZOA 2KOUA 3DF6A 3F6GA 4L5NC 4X66E 1T4LB 1HNZE 1IBKE 2FGGA 4X62E 4JI5E 2NUGA 4DKKA 1X47A 4X64E 2JR1A 1O0WA 2JVAA 2N3GA 1ZBQA 3C4TA 3HXLA 5AE1A 3K6QA 4WSPA 5DNYA 4R8OA 1XMQE 4DV5E 4JI4E 4R03A 4TUGA 4DUYE 2V86A 4DR6E 1FKAE 2UUCE 4KZSA 1ZBTA 4JV5E 1RQ0A 4P7DA 3KWRA 1YYKA 4GEQB 2L2KB 2YZTA 3HTXA 1STUA 3C4BA 2ZM6E 1T4NA 4Q28A 5AE2A 2UXDE 5LMUE 2H36X 3ZOQB 2UXCE 4LF8E 4DV3E 4DUZE 3VK6A 3HQ1A 1WHQA 2IHR1 2LBSB 2B9DA 4X8WA 4JI6E 3IWCA 1DI2A 2LUPB 5CFFE 2VQEE 4LF4E 2UXBE 1SR9A 2LMZA 4DV2E 3ADIA 2V83A 3ADGA 3J7Yp 4BS9A 2NUFA 4JI7E 4LF5E 3OMLA 3HPZA 4YHHE 4OX9E 5LL6R 4I8OA 3ADJA 4F9AB 2KHXA 2E5LE 4JYAE 2K4VA 2ODRC 2LUQA 2F8BA 3LMLA 2UUAE 2UUBE 4DR7E 5ADZA 1J5EE 2CPNA 1IBLE 4LF6E 1XNRE 2V8QB 2MC5A 4F9CB 5LMNE 4DR1E 2ODRD 3JAMC 1N32E 1T4OA 1X48A 2LTRA 2V87A 2B7TA 4NXNE 4GKKE 2RTXA 4L8NA 1UHZA 1PKPA 5F3WA 4LFCE 4DR4E 2DSYA 3DJWA 5AE3A 2LRSA 2V85A 4X65E 2F4VE 4TUIA 4LFAE 4DR3E 3J80C 2N3HA 1RC7A 1FJGE 2B3TB 4F9BB 3P1XA 4LF9E 3F6HA 2JY9A 2UU9E 4NXME 3HPSA 2MC6A 1X49A 1HR0E 4M30A 1YYOA 4BMJA 3FIGA 1GZ6A 4K0KE 2L3JA 4OOGC 4WYQB 1UILA 4DV0E 4B3ME 3ADLA 4DV6E 4DV7E 2M7QA 2VF1A 3IWBA 3H09A 2RS7A 2EZ6A 2L92A 4WPYA 4DMIA 4YY3E 3OTOE 2JWOA 1GQEA 2L8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L92 A; 
#chains in the Genus database with same CATH topology
 1XMQ E;  2EMH A;  2M1S A;  1A1L A;  2EMZ A;  1HNX E;  5IT9 C;  4B3R E;  4B3T E;  3RMP A;  2MKD A;  1EH7 A;  1WXR A;  4R2S A;  2FTX B;  2DIX A;  2L2M A;  2CSH A;  3ECR A;  2A25 A;  3BF2 A;  2WBT A;  1A1J A;  4P78 A;  2EM5 A;  3M99 B;  3LLH A;  3C6K A;  2R1F A;  1N33 E;  4DV4 E;  3VHT B;  1X6E A;  2DMY A;  5KL6 A;  2MDR A;  1X5W A;  2JOB A;  1N34 E;  3DF6 A;  4X66 E;  4N4R B;  1IBK E;  1EH6 A;  2EN1 A;  2YRM A;  4HEI A;  2JR1 A;  1TF3 A;  1ZBQ A;  2EMC A;  4R2E A;  4TUG A;  4MLQ A;  4KZS A;  1ZBT A;  4P7D A;  2DMI A;  2ENH A;  4WXC A;  2YZT A;  1STU A;  3C4B A;  4RHB B;  2ZM6 E;  4R2Q A;  1T4N A;  4F2J C;  5LMU E;  2H36 X;  3ZOQ B;  2UXC E;  4LF8 E;  2R76 A;  4O24 A;  2CT1 A;  2EM7 A;  3IWC A;  2VQE E;  2MDG A;  2EOR A;  1MGT A;  3UK3 C;  4DV2 E;  4F6M A;  3ADI A;  2EPN A;  4FK5 C;  2NUF A;  4F6N A;  3HPZ A;  2EP3 A;  2EN8 A;  3THN A;  4JYA E;  2ODR C;  2F8B A;  3LML A;  4DR7 E;  2CPN A;  4MLV A;  4R2A A;  4Q35 B;  2V8Q B;  2LVH A;  1XNR E;  2EOX A;  4DR1 E;  3JAM C;  4NXN E;  4GKK E;  4GZN C;  2YU5 A;  4LFC E;  4DR4 E;  2JYA A;  3DJW A;  5AE3 A;  2LRS A;  4LFA E;  2BB8 A;  2N3H A;  4F9B B;  2YTJ A;  3P1X A;  3F6H A;  2GHF A;  4NZV A;  2HGH A;  2JXP A;  1T38 A;  1TN9 A;  1GTK A;  4OOG C;  2J7J A;  4B3M E;  5IXM B;  2EOF A;  4YY3 E;  2LT7 A;  2VE7 C;  2YTG A;  4BHB A;  1YPN A;  1BBG A;  2RQL A;  2HJJ A;  2ADR A;  4JI3 E;  4HTG A;  1IQS A;  2B7V A;  4O5G A;  4M2Z A;  1EKZ A;  4KWY A;  2I9I A;  2EOZ A;  3J7A G;  1DQ3 A;  2EM2 A;  1YUJ A;  5AC5 A;  2EQ1 A;  4WFT A;  2ENC A;  1XNQ E;  3TQM A;  1NCS A;  4BHC A;  3T1H E;  1YYW A;  2M4I A;  2HHH E;  4BBY A;  2LJH A;  1HNW E;  1AAY A;  2EMB A;  1BB8 A;  5BR8 E;  4J8Z A;  3JU0 A;  3VYY A;  1WHN A;  2EM0 A;  1X6F A;  4X9J A;  1ZAA C;  4L5N C;  2FGG A;  4JI5 E;  2EPL X;  4X64 E;  2EMY A;  2JVA A;  3K6Q A;  5KL5 A;  5A6B A;  1N3G A;  2LCE A;  2Q8U A;  1JK1 A;  2V86 A;  1FKA E;  2GPI A;  4JV5 E;  2EPC A;  1RQ0 A;  2RPC A;  3KWR A;  3HTX A;  2L2K B;  3BGH A;  4R2P A;  5A6B D;  2EOQ A;  2YSO A;  3QG5 C;  2UXD E;  5A6J A;  2YTI A;  3HQ1 A;  3VK6 A;  1WHQ A;  2EPZ A;  2IHR 1;  2LBS B;  2B9D A;  2EPA A;  1DI2 A;  2EML A;  4M9V C;  5CFF E;  4O4K A;  2WCC 3;  2BBG A;  2LMZ A;  1UBD C;  2V83 A;  3ADG A;  4LF5 E;  3OML A;  4OX9 E;  2KHX A;  1WJP A;  2EOI A;  2RSI A;  3EPH A;  2MC5 A;  4F9C B;  1MEY C;  1PJQ A;  2B7T A;  2RTX A;  4L8N A;  2JPA A;  1A1F A;  2YTP A;  2DSY A;  1YSA C;  4X65 E;  4DR3 E;  2B3T B;  5A69 A;  2YPN A;  1X49 A;  1HR0 E;  4M30 A;  4BMJ A;  2DRP A;  3FIG A;  1QNT A;  4DV6 E;  4DV7 E;  2M7Q A;  2VF1 A;  3H09 A;  2RS7 A;  4DMI A;  2L8T A;  2WBS A;  2L6M A;  5IWA E;  2JOX A;  2LE2 A;  1QU6 A;  4JI6 E;  2KON A;  3AV0 A;  4R2C A;  2LTS A;  5AAS A;  1PJT A;  4ZYG A;  2K7I A;  1X3C A;  1IBM E;  3AUZ A;  2YTN A;  3T1Y E;  4NHR A;  1F2I G;  2EN7 A;  4LFB E;  1KYQ A;  3EPJ A;  2YTQ A;  3KZZ A;  4KHP E;  4WX9 A;  4AQY E;  1JK2 A;  2EOJ A;  4JI8 E;  4ZYD A;  5KL2 A;  1T39 A;  4DV1 E;  2L3C A;  1NEI A;  5IV8 B;  1A1G A;  2V88 A;  4LF7 E;  1IQO A;  2MKN A;  3EQ1 A;  4M0V A;  1N36 E;  2EMG A;  2EQ0 A;  1XMO E;  2YRK A;  3JTZ A;  4BC9 A;  2L33 A;  2EN6 A;  3VYX A;  2KOU A;  1HNZ E;  4DKK A;  1X47 A;  3C4T A;  2N3G A;  5AE1 A;  5DNY A;  4R8O A;  4JI4 E;  4R03 A;  2EN3 A;  3MHH C;  4IJD A;  2LO3 A;  4DR6 E;  2EOO A;  2NAB A;  2YTE A;  1YYK A;  2EL5 A;  2EPK X;  1G2F C;  2E72 A;  3EPK A;  1GQE A;  4IS1 C;  1A1K A;  2JP9 A;  2EN2 A;  4DUZ E;  4X8W A;  2LUP B;  3BBG A;  4LF4 E;  1SR9 A;  2EM9 A;  2LV2 A;  3J7Y p;  5KL3 A;  4BS9 A;  4JI7 E;  2M9A A;  5LL6 R;  4I8O A;  3ADJ A;  4F9A B;  2E5L E;  2YTD A;  2EOS A;  2LUQ A;  2UUA E;  2N8X A;  5ADZ A;  1J5E E;  1TF6 A;  2EE8 A;  1IBL E;  2EMK A;  2EPP A;  5A6K A;  2EPU A;  1N32 E;  1T4O A;  1X48 A;  2V87 A;  1A1I A;  2EM3 A;  2EOE A;  2V85 A;  2VRD A;  2F4V E;  2EQ3 A;  1ZU1 A;  2EN4 A;  2JY9 A;  2EPX A;  4WSG A;  4R2R A;  1GZ6 A;  2EM6 A;  2L3J A;  2EM4 A;  2CTD A;  1RMD A;  2L92 A;  4R2D A;  1A1H A;  2V89 A;  4LTY A;  5T6J A;  2GLI A;  1UN6 B;  3MSW A;  3L00 A;  2ENA A;  4DR2 E;  4ZYE A;  2EL4 A;  1YZ9 A;  2YWQ A;  1I94 E;  5A6A A;  4F54 A;  2FV4 B;  4LU9 A;  2YTF A;  4BC7 A;  2L2N A;  3IWD A;  1LLM C;  4JI1 E;  4B3S E;  1SFE A;  3J81 C;  4JI2 E;  5FLX C;  2RSM A;  4BCA A;  3BID A;  4JI0 E;  4GKJ E;  2WBU A;  3EPL A;  1J26 A;  2DB2 A;  2EWL A;  2DLK A;  2NA2 A;  2YRH A;  4DR5 E;  5A2Q C;  2EMA A;  2VQF E;  2E1M A;  2EM8 A;  2HC5 A;  2RS6 A;  4WXD A;  1KJK A;  2YT4 A;  3MHS C;  2NUE A;  1PDA A;  2G7H A;  2WZO A;  3F6G A;  1T4L B;  2EOH A;  2PRT A;  2NUG A;  4X62 E;  2ELY A;  1ZR9 A;  1O0W A;  3HXL A;  5LLQ A;  4WSP A;  4DV5 E;  4DUY E;  2UUC E;  2D9H A;  4RH8 A;  4GEQ B;  1YFH A;  1G2D C;  2EMX A;  1WRJ A;  2EPO A;  2EJ4 A;  4Q28 A;  5AE2 A;  2EMW A;  2DLQ A;  4O43 A;  4DV3 E;  1L4S A;  3THO B;  2UXB E;  3KZY A;  5KL7 A;  4YHH E;  1DGC A;  2K4V A;  1B69 A;  1IMU A;  1BBO A;  2UUB E;  4LF6 E;  2ELZ A;  2EMF A;  5LMN E;  2ODR D;  1EH8 A;  2LTR A;  2EPR A;  5F3W A;  1AH5 A;  1UHZ A;  1PKP A;  2YTO A;  2YU8 A;  4ZYH A;  5AC4 A;  1Z1B A;  4TUI A;  3J80 C;  1RC7 A;  1FJG E;  5TSE A;  4LF9 E;  1X6H A;  3C6M A;  2UU9 E;  4NXM E;  2EL6 A;  2EOY A;  2MC6 A;  3HPS A;  2I13 A;  1PJS A;  1YYO A;  2EMI A;  2DGC A;  4K0K E;  4WYQ B;  2EOM A;  2EPM X;  1YUI A;  1UIL A;  4DV0 E;  3ADL A;  3IWB A;  2EZ6 A;  4WPY A;  1P47 A;  3OTO E;  2JWO A;  2YSP A;  5KL4 A;  2LJU A; 
#chains in the Genus database with same CATH homology
 2L6M A;  5IWA E;  2JOX A;  2LE2 A;  1QU6 A;  2M1S A;  2V89 A;  2VE7 C;  2KON A;  4LTY A;  3AV0 A;  5T6J A;  3MSW A;  1HNX E;  5IT9 C;  2LTS A;  5AAS A;  4DR2 E;  1YZ9 A;  1IBM E;  1I94 E;  4JI3 E;  4B3R E;  2B7V A;  3AUZ A;  4F54 A;  3T1Y E;  4B3T E;  2FV4 B;  4M2Z A;  1EKZ A;  3RMP A;  4LU9 A;  4LFB E;  3J7A G;  1WXR A;  1DQ3 A;  4BC7 A;  2L2N A;  3IWD A;  4JI1 E;  4KHP E;  4WFT A;  4B3S E;  4AQY E;  1XNQ E;  3J81 C;  2FTX B;  4JI8 E;  4JI2 E;  2DIX A;  2L2M A;  5FLX C;  2RSM A;  4BCA A;  3T1H E;  4JI0 E;  1YYW A;  2M4I A;  4GKJ E;  2HHH E;  4BBY A;  4DV1 E;  1J26 A;  2L3C A;  2DB2 A;  2EWL A;  2LJH A;  1HNW E;  2NA2 A;  4DR5 E;  5A2Q C;  2V88 A;  2VQF E;  4LF7 E;  2E1M A;  4P78 A;  4M0V A;  5BR8 E;  1N36 E;  4J8Z A;  1XMO E;  3LLH A;  1N33 E;  3JTZ A;  4DV4 E;  2RS6 A;  3JU0 A;  4BC9 A;  2YT4 A;  3VYY A;  2DMY A;  2L33 A;  2MDR A;  1WHN A;  2JOB A;  1N34 E;  2NUE A;  3VYX A;  2G7H A;  2WZO A;  2KOU A;  3DF6 A;  3F6G A;  4L5N C;  4X66 E;  1T4L B;  1HNZ E;  1IBK E;  2FGG A;  4X62 E;  4JI5 E;  2NUG A;  4DKK A;  1X47 A;  4X64 E;  2JR1 A;  1O0W A;  2JVA A;  2N3G A;  1ZBQ A;  3C4T A;  3HXL A;  5AE1 A;  3K6Q A;  4WSP A;  5DNY A;  4R8O A;  1XMQ E;  4DV5 E;  4JI4 E;  4R03 A;  4TUG A;  4DUY E;  2V86 A;  4DR6 E;  1FKA E;  2UUC E;  4KZS A;  1ZBT A;  4JV5 E;  1RQ0 A;  4P7D A;  3KWR A;  1YYK A;  4GEQ B;  2L2K B;  2YZT A;  3HTX A;  1STU A;  3C4B A;  2ZM6 E;  1T4N A;  4Q28 A;  5AE2 A;  2UXD E;  5LMU E;  2H36 X;  3ZOQ B;  2UXC E;  4LF8 E;  4DV3 E;  4DUZ E;  3VK6 A;  3HQ1 A;  1WHQ A;  2IHR 1;  2LBS B;  2B9D A;  4X8W A;  4JI6 E;  3IWC A;  1DI2 A;  2LUP B;  5CFF E;  2VQE E;  4LF4 E;  2UXB E;  1SR9 A;  2LMZ A;  4DV2 E;  3ADI A;  2V83 A;  3ADG A;  3J7Y p;  4BS9 A;  2NUF A;  4JI7 E;  4LF5 E;  3OML A;  3HPZ A;  4YHH E;  4OX9 E;  5LL6 R;  4I8O A;  3ADJ A;  4F9A B;  2KHX A;  2E5L E;  4JYA E;  2K4V A;  2ODR C;  2LUQ A;  2F8B A;  3LML A;  2UUA E;  2UUB E;  4DR7 E;  5ADZ A;  1J5E E;  2CPN A;  1IBL E;  4LF6 E;  1XNR E;  2V8Q B;  2MC5 A;  4F9C B;  5LMN E;  4DR1 E;  2ODR D;  3JAM C;  1N32 E;  1T4O A;  1X48 A;  2LTR A;  2V87 A;  2B7T A;  4NXN E;  4GKK E;  2RTX A;  4L8N A;  1UHZ A;  1PKP A;  5F3W A;  4LFC E;  4DR4 E;  2DSY A;  3DJW A;  5AE3 A;  2LRS A;  2V85 A;  4X65 E;  2F4V E;  4TUI A;  4LFA E;  4DR3 E;  3J80 C;  2N3H A;  1RC7 A;  1FJG E;  2B3T B;  4F9B B;  3P1X A;  4LF9 E;  3F6H A;  2JY9 A;  2UU9 E;  4NXM E;  3HPS A;  2MC6 A;  1X49 A;  1HR0 E;  4M30 A;  1YYO A;  4BMJ A;  3FIG A;  1GZ6 A;  4K0K E;  2L3J A;  4OOG C;  4WYQ B;  1UIL A;  4DV0 E;  4B3M E;  3ADL A;  4DV6 E;  4DV7 E;  2M7Q A;  2VF1 A;  3IWB A;  3H09 A;  2RS7 A;  2EZ6 A;  2L92 A;  4WPY A;  4DMI A;  4YY3 E;  3OTO E;  2JWO A;  1GQE A;  2L8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...