2L92A

Solution structure of the c-terminal domain of h-ns like protein bv3f
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
44
structure length
44
Chain Sequence
MSTVPKYRDPATGKTWSGRGRQPAWLGNDPAAFLIQPDLPAILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone family protein nucleoid-structuring protein H-NS
publication title Structural basis for recognition of AT-rich DNA by unrelated xenogeneic silencing proteins
pubmed doi rcsb
source organism Burkholderia vietnamiensis
molecule tags Dna binding protein
total genus 3
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2011-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.420 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l92A01
2L92A
chains in the Genus database with same CATH superfamily
2JPAA 2V85A 4RH8A 2EMLA 2L3JA 5AE2A 2DGCA 2A25A 2YPNA 2YTEA 4R2PA 2CT1A 2EN8A 3IWCA 5TSEA 2PRTA 4B3ME 4LFCE 1IQOA 4JV5E 1GTKA 2EPLX 1YYOA 2EN1A 2KONA 1EH6A 4FK5C 2YT4A 1UILA 4M0VA 2EMYA 2N3GA 2LVHA 2FGGA 2GHFA 2RS7A 4RHBB 3VYYA 4DR6E 1X6HA 2RPCA 4OOGC 1UBDC 2FV4B 2YTNA 5AC4A 2JOBA 4WXCA 1TN9A 5AE3A 4HEIA 5BR8E 1X47A 1IBLE 2EMGA 4IJDA 3MHSC 4ZYEA 2EN2A 2JOXA 1YYKA 4TUGA 5ADZA 1QU6A 1SR9A 3K6QA 4DR5E 2UXBE 2L2KB 2ENAA 3J81C 2EPUA 2EPCA 2ADRA 1HNWE 1T4LB 1KYQA 2WBUA 3BF2A 4NZVA 4BCAA 4K0KE 4GKJE 2GLIA 2LT7A 1IQSA 2ELYA 2EM6A 4TUIA 3TQMA 1ZBQA 1MGTA 3P1XA 4P78A 1X6FA 1WHNA 4J8ZA 1XNRE 1X5WA 1X49A 2RQLA 2JP9A 1P47A 2L33A 1YPNA 2YU5A 3IWDA 4DV1E 1GZ6A 2G7HA 1T4NA 4R2QA 4JI3E 1RMDA 5LLQA 2NUFA 2DLKA 2E5LE 1YUIA 4M9VC 2Q8UA 2N8XA 3EPJA 3UK3C 5AE1A 1STUA 4WYQB 2EMCA 2UUBE 2YTGA 2I9IA 2EMZA 2EM7A 2VQEE 2JYAA 2EOMA 2JR1A 2EMIA 2VE7C 1PJQA 4BMJA 4LFAE 4L8NA 3LMLA 1ZR9A 4BHBA 4DKKA 2MKNA 1YYWA 1Z1BA 2UUCE 3RMPA 2UXCE 2L2NA 3C4BA 4BHCA 4BBYA 4P7DA 2EN3A 4LF7E 2NABA 1T38A 4KZSA 1GQEA 5T6JA 2EOOA 2R1FA 2N3HA 4X64E 1F2IG 2DRPA 2YTDA 2ENCA 1WXRA 2EORA 4R2RA 2NUEA 2WZOA 3F6HA 5AASA 5IT9C 1KJKA 5FLXC 4X9JA 1DGCA 4O5GA 4KHPE 2EMKA 4JI2E 4JI4E 4O43A 1G2DC 1X48A 4DR3E 1FJGE 1N36E 2IHR1 1A1FA 2YTOA 2RTXA 4YHHE 4F9BB 2EQ1A 4WXDA 3ADGA 2V8QB 1LLMC 2EM5A 2EM2A 4OX9E 2UUAE 1BBGA 1L4SA 4YY3E 2RSIA 4Q28A 1JK2A 3J7AG 1EH7A 1TF3A 2DLQA 1MEYC 5LMUE 1PJSA 2EOEA 5KL5A 2LMZA 4DV0E 4NXNE 2E72A 3L00A 2NUGA 4R03A 3DF6A 3EPHA 2EPNA 4JI0E 1WRJA 2EOHA 4JYAE 2YTIA 1EKZA 2EOSA 4X62E 5IXMB 3BGHA 4DUZE 2EPZA 1ZU1A 4DV6E 2B7TA 4R8OA 2YRHA 2E1MA 3JU0A 3DJWA 1AAYA 1N33E 2F4VE 4X66E 2EPMX 1DQ3A 1J26A 3ZOQB 2V87A 4R2DA 5A6AA 3OMLA 5LMNE 2K7IA 3LLHA 1X3CA 3HPZA 2EMBA 2VQFE 1B69A 4JI1E 3OTOE 3ADLA 4MLVA 4F6MA 5A6BD 1RC7A 3MHHC 2EM9A 2EOXA 2EOIA 3EPLA 1NCSA 2EM4A 2LO3A 2MC5A 5F3WA 1WJPA 5A69A 3AV0A 2KHXA 2RSMA 2MDRA 2EN6A 3KZZA 2L3CA 2WCC3 4DV7E 2EN7A 2JY9A 2DMIA 1UN6B 1PKPA 4M30A 4F9CB 1N34E 4NXME 2NA2A 2WBTA 1SFEA 2BB8A 1YFHA 3MSWA 2JVAA 4B3RE 1XMQE 3VYXA 2YTQA 3M99B 2EPAA 2M7QA 2WBSA 1A1LA 5A6KA 2YRMA 2EMAA 2EM8A 4WX9A 2YZTA 2DB2A 4O24A 2EQ0A 4JI6E 2MC6A 4F54A 4DR2E 2EPPA 4LF4E 4DV3E 2LV2A 1T39A 2EZ6A 2EE8A 2F8BA 2LRSA 2L92A 2D9HA 2BBGA 3HXLA 5KL4A 4HTGA 2K4VA 2LTSA 2EWLA 2EPKX 2EOZA 2DMYA 4F2JC 2EOJA 3JAMC 1YUJA 5KL2A 1ZBTA 2ODRC 2YSOA 3VHTB 2L2MA 4F6NA 2EMWA 2LUPB 2EMXA 1EH8A 4LF8E 2MKDA 1XMOE 2YU8A 4L5NC 3THOB 4MLQA 4GZNC 3THNA 4JI8E 1IMUA 4M2ZA 3T1HE 4LFBE 2VF1A 3BIDA 2HJJA 4LTYA 1A1IA 1FKAE 2DSYA 2EL6A 2EL4A 1UHZA 4F9AB 1TF6A 2HGHA 3HQ1A 4R2EA 5A6JA 3H09A 1BBOA 2J7JA 5DNYA 2EPOA 2V88A 2YWQA 2LUQA 2R76A 5CFFE 4LF5E 2UU9E 5IWAE 2JWOA 2EOYA 2B9DA 4R2CA 2ZM6E 2B3TB 3VK6A 3C6KA 3ECRA 1HNZE 3KZYA 2EPRA 1IBME 1A1GA 4GEQB 3C4TA 1X6EA 2M9AA 2LJUA 4DR1E 4DUYE 2B7VA 2GPIA 4WSPA 5A6BA 1T4OA 4Q35B 2EOFA 2ELZA 2EMHA 2HHHE 3KWRA 5KL6A 2EP3A 3EQ1A 1N3GA 4DV2E 2ENHA 2I13A 4O4KA 2H36X 3FIGA 3J80C 5LL6R 5KL3A 3HPSA 4DR4E 1G2FC 1YZ9A 4R2SA 3JTZA 4X8WA 2YSPA 4BC9A 2DIXA 2HC5A 2YTJA 2EMFA 1XNQE 4GKKE 4N4RB 4DV5E 4R2AA 2RS6A 1I94E 1PJTA 4WFTA 2M4IA 2V86A 2CSHA 4BC7A 4ZYGA 5IV8B 1N32E 1HNXE 1YSAC 2EM3A 3QG5C 2LJHA 2LCEA 4DV4E 3ADIA 2UXDE 3IWBA 4NHRA 1NEIA 1WHQA 2KOUA 4IS1C 4LF6E 3J7Yp 1A1HA 2MDGA 2EJ4A 4JI5E 3ADJA 4KWYA 4ZYHA 4BS9A 4X65E 4LU9A 1IBKE 2EQ3A 4B3SE 1AH5A 4LF9E 1HR0E 2EL5A 2YTFA 3F6GA 2EPXA 1J5EE 2L8TA 1ZAAC 4JI7E 4DR7E 4WSGA 2LTRA 2V83A 4AQYE 3C6MA 1A1JA 2LE2A 1QNTA 3HTXA 1O0WA 1PDAA 2YTPA 2LBSB 5A2QC 2EN4A 2FTXB 2L6MA 4WPYA 2V89A 4ZYDA 3T1YE 2JXPA 5AC5A 3BBGA 1BB8A 2EOQA 2CTDA 5KL7A 1JK1A 4I8OA 1A1KA 4B3TE 2YRKA 2M1SA 2ODRD 2EM0A 3AUZA 2CPNA 4DMIA 2VRDA 3EPKA 1DI2A 1RQ0A
chains in the Genus database with same CATH topology
1HNZE 3HPZA 2VQFE 2JR1A 4JI1E 2V85A 1IBME 2VE7C 4BMJA 3OTOE 4LFAE 2L3JA 3ADLA 4L8NA 3LMLA 5AE2A 4GEQB 4DKKA 3C4TA 1RC7A 1YYWA 2UUCE 4DR1E 3RMPA 2UXCE 3IWCA 4DUYE 2L2NA 3C4BA 4BBYA 2MC5A 5F3WA 2B7VA 4P7DA 4B3ME 4LFCE 3AV0A 2KHXA 1T4OA 2RSMA 2MDRA 4WSPA 2L3CA 4LF7E 2HHHE 3KWRA 4JV5E 4DV2E 4DV7E 4KZSA 1YYOA 1GQEA 5T6JA 2JY9A 2KONA 2H36X 1PKPA 2N3HA 3FIGA 4M30A 5LL6R 2YT4A 4F9CB 4X64E 1UILA 3J80C 4M0VA 2NA2A 3HPSA 1N34E 4NXME 4DR4E 2N3GA 2FGGA 1WXRA 2RS7A 3VYYA 3JTZA 4X8WA 1YZ9A 3MSWA 4DR6E 4BC9A 2NUEA 2DIXA 4OOGC 2JVAA 2WZOA 1XMQE 1XNQE 4B3RE 3VYXA 4GKKE 2FV4B 3F6HA 4DV5E 2JOBA 2RS6A 1I94E 2M7QA 5AASA 4WFTA 2M4IA 2V86A 5IT9C 5FLXC 5AE3A 5BR8E 4JI6E 4BC7A 2YZTA 1X47A 2DB2A 1IBLE 1N32E 1HNXE 2MC6A 4F54A 4KHPE 2JOXA 4DR2E 4JI2E 1YYKA 4TUGA 4JI4E 4LF4E 1X48A 4DV3E 4DR3E 5ADZA 1QU6A 1SR9A 3K6QA 4DR5E 1FJGE 1N36E 2IHR1 2L2KB 2EZ6A 2UXBE 2LJHA 2RTXA 4YHHE 4F9BB 3J81C 2LRSA 2F8BA 2L92A 4DV4E 3ADIA 3HXLA 3ADGA 2V8QB 2UXDE 3IWBA 2K4VA 2LTSA 2EWLA 4OX9E 1HNWE 1T4LB 2DMYA 2UUAE 1WHQA 2KOUA 4LF6E 3JAMC 4YY3E 3J7Yp 4BCAA 4Q28A 3J7AG 4K0KE 4JI5E 3ADJA 1ZBTA 4GKJE 4BS9A 2ODRC 4LU9A 4X65E 1IBKE 2L2MA 5LMUE 4B3SE 4TUIA 2LUPB 4LF9E 1HR0E 4LF8E 2LMZA 4DV0E 3F6GA 1J5EE 2L8TA 1ZBQA 1XMOE 4JI7E 1DI2A 4NXNE 4DR7E 3P1XA 2LTRA 4P78A 4R03A 2V83A 4L5NC 3DF6A 4AQYE 2NUGA 4JI0E 1WHNA 4JI8E 2LE2A 4J8ZA 1EKZA 1XNRE 1X49A 3HTXA 4M2ZA 4JYAE 1O0WA 3T1HE 2VF1A 2LBSB 4X62E 4LFBE 5A2QC 2L33A 4LTYA 1FKAE 2FTXB 4DUZE 2DSYA 4DV6E 2L6MA 2B7TA 4WPYA 1UHZA 4R8OA 4F9AB 3IWDA 4DV1E 1GZ6A 2E1MA 2V89A 3JU0A 3HQ1A 3DJWA 3T1YE 2G7HA 3H09A 1N33E 1T4NA 5DNYA 4JI3E 2V88A 2F4VE 4X66E 2NUFA 4I8OA 1DQ3A 2LUQA 4B3TE 5CFFE 4LF5E 2M1SA 2E5LE 2UU9E 1J26A 5IWAE 2JWOA 2ODRD 3AUZA 3ZOQB 5AE1A 2B9DA 2V87A 2ZM6E 1STUA 2CPNA 4WYQB 2B3TB 2UUBE 3OMLA 4DMIA 3VK6A 5LMNE 3LLHA 2VQEE 1RQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L92 A; 
#chains in the Genus database with same CATH topology
 2JPA A;  2V85 A;  4RH8 A;  2EML A;  2L3J A;  5AE2 A;  2DGC A;  2A25 A;  2YPN A;  2YTE A;  4R2P A;  2CT1 A;  2EN8 A;  3IWC A;  5TSE A;  2PRT A;  4B3M E;  4LFC E;  1IQO A;  4JV5 E;  1GTK A;  2EPL X;  1YYO A;  2EN1 A;  2KON A;  1EH6 A;  4FK5 C;  2YT4 A;  1UIL A;  4M0V A;  2EMY A;  2N3G A;  2LVH A;  2FGG A;  2GHF A;  2RS7 A;  4RHB B;  3VYY A;  4DR6 E;  1X6H A;  2RPC A;  4OOG C;  1UBD C;  2FV4 B;  2YTN A;  5AC4 A;  2JOB A;  4WXC A;  1TN9 A;  5AE3 A;  4HEI A;  5BR8 E;  1X47 A;  1IBL E;  2EMG A;  4IJD A;  3MHS C;  4ZYE A;  2EN2 A;  2JOX A;  1YYK A;  4TUG A;  5ADZ A;  1QU6 A;  1SR9 A;  3K6Q A;  4DR5 E;  2UXB E;  2L2K B;  2ENA A;  3J81 C;  2EPU A;  2EPC A;  2ADR A;  1HNW E;  1T4L B;  1KYQ A;  2WBU A;  3BF2 A;  4NZV A;  4BCA A;  4K0K E;  4GKJ E;  2GLI A;  2LT7 A;  1IQS A;  2ELY A;  2EM6 A;  4TUI A;  3TQM A;  1ZBQ A;  1MGT A;  3P1X A;  4P78 A;  1X6F A;  1WHN A;  4J8Z A;  1XNR E;  1X5W A;  1X49 A;  2RQL A;  2JP9 A;  1P47 A;  2L33 A;  1YPN A;  2YU5 A;  3IWD A;  4DV1 E;  1GZ6 A;  2G7H A;  1T4N A;  4R2Q A;  4JI3 E;  1RMD A;  5LLQ A;  2NUF A;  2DLK A;  2E5L E;  1YUI A;  4M9V C;  2Q8U A;  2N8X A;  3EPJ A;  3UK3 C;  5AE1 A;  1STU A;  4WYQ B;  2EMC A;  2UUB E;  2YTG A;  2I9I A;  2EMZ A;  2EM7 A;  2VQE E;  2JYA A;  2EOM A;  2JR1 A;  2EMI A;  2VE7 C;  1PJQ A;  4BMJ A;  4LFA E;  4L8N A;  3LML A;  1ZR9 A;  4BHB A;  4DKK A;  2MKN A;  1YYW A;  1Z1B A;  2UUC E;  3RMP A;  2UXC E;  2L2N A;  3C4B A;  4BHC A;  4BBY A;  4P7D A;  2EN3 A;  4LF7 E;  2NAB A;  1T38 A;  4KZS A;  1GQE A;  5T6J A;  2EOO A;  2R1F A;  2N3H A;  4X64 E;  1F2I G;  2DRP A;  2YTD A;  2ENC A;  1WXR A;  2EOR A;  4R2R A;  2NUE A;  2WZO A;  3F6H A;  5AAS A;  5IT9 C;  1KJK A;  5FLX C;  4X9J A;  1DGC A;  4O5G A;  4KHP E;  2EMK A;  4JI2 E;  4JI4 E;  4O43 A;  1G2D C;  1X48 A;  4DR3 E;  1FJG E;  1N36 E;  2IHR 1;  1A1F A;  2YTO A;  2RTX A;  4YHH E;  4F9B B;  2EQ1 A;  4WXD A;  3ADG A;  2V8Q B;  1LLM C;  2EM5 A;  2EM2 A;  4OX9 E;  2UUA E;  1BBG A;  1L4S A;  4YY3 E;  2RSI A;  4Q28 A;  1JK2 A;  3J7A G;  1EH7 A;  1TF3 A;  2DLQ A;  1MEY C;  5LMU E;  1PJS A;  2EOE A;  5KL5 A;  2LMZ A;  4DV0 E;  4NXN E;  2E72 A;  3L00 A;  2NUG A;  4R03 A;  3DF6 A;  3EPH A;  2EPN A;  4JI0 E;  1WRJ A;  2EOH A;  4JYA E;  2YTI A;  1EKZ A;  2EOS A;  4X62 E;  5IXM B;  3BGH A;  4DUZ E;  2EPZ A;  1ZU1 A;  4DV6 E;  2B7T A;  4R8O A;  2YRH A;  2E1M A;  3JU0 A;  3DJW A;  1AAY A;  1N33 E;  2F4V E;  4X66 E;  2EPM X;  1DQ3 A;  1J26 A;  3ZOQ B;  2V87 A;  4R2D A;  5A6A A;  3OML A;  5LMN E;  2K7I A;  3LLH A;  1X3C A;  3HPZ A;  2EMB A;  2VQF E;  1B69 A;  4JI1 E;  3OTO E;  3ADL A;  4MLV A;  4F6M A;  5A6B D;  1RC7 A;  3MHH C;  2EM9 A;  2EOX A;  2EOI A;  3EPL A;  1NCS A;  2EM4 A;  2LO3 A;  2MC5 A;  5F3W A;  1WJP A;  5A69 A;  3AV0 A;  2KHX A;  2RSM A;  2MDR A;  2EN6 A;  3KZZ A;  2L3C A;  2WCC 3;  4DV7 E;  2EN7 A;  2JY9 A;  2DMI A;  1UN6 B;  1PKP A;  4M30 A;  4F9C B;  1N34 E;  4NXM E;  2NA2 A;  2WBT A;  1SFE A;  2BB8 A;  1YFH A;  3MSW A;  2JVA A;  4B3R E;  1XMQ E;  3VYX A;  2YTQ A;  3M99 B;  2EPA A;  2M7Q A;  2WBS A;  1A1L A;  5A6K A;  2YRM A;  2EMA A;  2EM8 A;  4WX9 A;  2YZT A;  2DB2 A;  4O24 A;  2EQ0 A;  4JI6 E;  2MC6 A;  4F54 A;  4DR2 E;  2EPP A;  4LF4 E;  4DV3 E;  2LV2 A;  1T39 A;  2EZ6 A;  2EE8 A;  2F8B A;  2LRS A;  2L92 A;  2D9H A;  2BBG A;  3HXL A;  5KL4 A;  4HTG A;  2K4V A;  2LTS A;  2EWL A;  2EPK X;  2EOZ A;  2DMY A;  4F2J C;  2EOJ A;  3JAM C;  1YUJ A;  5KL2 A;  1ZBT A;  2ODR C;  2YSO A;  3VHT B;  2L2M A;  4F6N A;  2EMW A;  2LUP B;  2EMX A;  1EH8 A;  4LF8 E;  2MKD A;  1XMO E;  2YU8 A;  4L5N C;  3THO B;  4MLQ A;  4GZN C;  3THN A;  4JI8 E;  1IMU A;  4M2Z A;  3T1H E;  4LFB E;  2VF1 A;  3BID A;  2HJJ A;  4LTY A;  1A1I A;  1FKA E;  2DSY A;  2EL6 A;  2EL4 A;  1UHZ A;  4F9A B;  1TF6 A;  2HGH A;  3HQ1 A;  4R2E A;  5A6J A;  3H09 A;  1BBO A;  2J7J A;  5DNY A;  2EPO A;  2V88 A;  2YWQ A;  2LUQ A;  2R76 A;  5CFF E;  4LF5 E;  2UU9 E;  5IWA E;  2JWO A;  2EOY A;  2B9D A;  4R2C A;  2ZM6 E;  2B3T B;  3VK6 A;  3C6K A;  3ECR A;  1HNZ E;  3KZY A;  2EPR A;  1IBM E;  1A1G A;  4GEQ B;  3C4T A;  1X6E A;  2M9A A;  2LJU A;  4DR1 E;  4DUY E;  2B7V A;  2GPI A;  4WSP A;  5A6B A;  1T4O A;  4Q35 B;  2EOF A;  2ELZ A;  2EMH A;  2HHH E;  3KWR A;  5KL6 A;  2EP3 A;  3EQ1 A;  1N3G A;  4DV2 E;  2ENH A;  2I13 A;  4O4K A;  2H36 X;  3FIG A;  3J80 C;  5LL6 R;  5KL3 A;  3HPS A;  4DR4 E;  1G2F C;  1YZ9 A;  4R2S A;  3JTZ A;  4X8W A;  2YSP A;  4BC9 A;  2DIX A;  2HC5 A;  2YTJ A;  2EMF A;  1XNQ E;  4GKK E;  4N4R B;  4DV5 E;  4R2A A;  2RS6 A;  1I94 E;  1PJT A;  4WFT A;  2M4I A;  2V86 A;  2CSH A;  4BC7 A;  4ZYG A;  5IV8 B;  1N32 E;  1HNX E;  1YSA C;  2EM3 A;  3QG5 C;  2LJH A;  2LCE A;  4DV4 E;  3ADI A;  2UXD E;  3IWB A;  4NHR A;  1NEI A;  1WHQ A;  2KOU A;  4IS1 C;  4LF6 E;  3J7Y p;  1A1H A;  2MDG A;  2EJ4 A;  4JI5 E;  3ADJ A;  4KWY A;  4ZYH A;  4BS9 A;  4X65 E;  4LU9 A;  1IBK E;  2EQ3 A;  4B3S E;  1AH5 A;  4LF9 E;  1HR0 E;  2EL5 A;  2YTF A;  3F6G A;  2EPX A;  1J5E E;  2L8T A;  1ZAA C;  4JI7 E;  4DR7 E;  4WSG A;  2LTR A;  2V83 A;  4AQY E;  3C6M A;  1A1J A;  2LE2 A;  1QNT A;  3HTX A;  1O0W A;  1PDA A;  2YTP A;  2LBS B;  5A2Q C;  2EN4 A;  2FTX B;  2L6M A;  4WPY A;  2V89 A;  4ZYD A;  3T1Y E;  2JXP A;  5AC5 A;  3BBG A;  1BB8 A;  2EOQ A;  2CTD A;  5KL7 A;  1JK1 A;  4I8O A;  1A1K A;  4B3T E;  2YRK A;  2M1S A;  2ODR D;  2EM0 A;  3AUZ A;  2CPN A;  4DMI A;  2VRD A;  3EPK A;  1DI2 A;  1RQ0 A; 
#chains in the Genus database with same CATH homology
 1HNZ E;  3HPZ A;  2VQF E;  2JR1 A;  4JI1 E;  2V85 A;  1IBM E;  2VE7 C;  4BMJ A;  3OTO E;  4LFA E;  2L3J A;  3ADL A;  4L8N A;  3LML A;  5AE2 A;  4GEQ B;  4DKK A;  3C4T A;  1RC7 A;  1YYW A;  2UUC E;  4DR1 E;  3RMP A;  2UXC E;  3IWC A;  4DUY E;  2L2N A;  3C4B A;  4BBY A;  2MC5 A;  5F3W A;  2B7V A;  4P7D A;  4B3M E;  4LFC E;  3AV0 A;  2KHX A;  1T4O A;  2RSM A;  2MDR A;  4WSP A;  2L3C A;  4LF7 E;  2HHH E;  3KWR A;  4JV5 E;  4DV2 E;  4DV7 E;  4KZS A;  1YYO A;  1GQE A;  5T6J A;  2JY9 A;  2KON A;  2H36 X;  1PKP A;  2N3H A;  3FIG A;  4M30 A;  5LL6 R;  2YT4 A;  4F9C B;  4X64 E;  1UIL A;  3J80 C;  4M0V A;  2NA2 A;  3HPS A;  1N34 E;  4NXM E;  4DR4 E;  2N3G A;  2FGG A;  1WXR A;  2RS7 A;  3VYY A;  3JTZ A;  4X8W A;  1YZ9 A;  3MSW A;  4DR6 E;  4BC9 A;  2NUE A;  2DIX A;  4OOG C;  2JVA A;  2WZO A;  1XMQ E;  1XNQ E;  4B3R E;  3VYX A;  4GKK E;  2FV4 B;  3F6H A;  4DV5 E;  2JOB A;  2RS6 A;  1I94 E;  2M7Q A;  5AAS A;  4WFT A;  2M4I A;  2V86 A;  5IT9 C;  5FLX C;  5AE3 A;  5BR8 E;  4JI6 E;  4BC7 A;  2YZT A;  1X47 A;  2DB2 A;  1IBL E;  1N32 E;  1HNX E;  2MC6 A;  4F54 A;  4KHP E;  2JOX A;  4DR2 E;  4JI2 E;  1YYK A;  4TUG A;  4JI4 E;  4LF4 E;  1X48 A;  4DV3 E;  4DR3 E;  5ADZ A;  1QU6 A;  1SR9 A;  3K6Q A;  4DR5 E;  1FJG E;  1N36 E;  2IHR 1;  2L2K B;  2EZ6 A;  2UXB E;  2LJH A;  2RTX A;  4YHH E;  4F9B B;  3J81 C;  2LRS A;  2F8B A;  2L92 A;  4DV4 E;  3ADI A;  3HXL A;  3ADG A;  2V8Q B;  2UXD E;  3IWB A;  2K4V A;  2LTS A;  2EWL A;  4OX9 E;  1HNW E;  1T4L B;  2DMY A;  2UUA E;  1WHQ A;  2KOU A;  4LF6 E;  3JAM C;  4YY3 E;  3J7Y p;  4BCA A;  4Q28 A;  3J7A G;  4K0K E;  4JI5 E;  3ADJ A;  1ZBT A;  4GKJ E;  4BS9 A;  2ODR C;  4LU9 A;  4X65 E;  1IBK E;  2L2M A;  5LMU E;  4B3S E;  4TUI A;  2LUP B;  4LF9 E;  1HR0 E;  4LF8 E;  2LMZ A;  4DV0 E;  3F6G A;  1J5E E;  2L8T A;  1ZBQ A;  1XMO E;  4JI7 E;  1DI2 A;  4NXN E;  4DR7 E;  3P1X A;  2LTR A;  4P78 A;  4R03 A;  2V83 A;  4L5N C;  3DF6 A;  4AQY E;  2NUG A;  4JI0 E;  1WHN A;  4JI8 E;  2LE2 A;  4J8Z A;  1EKZ A;  1XNR E;  1X49 A;  3HTX A;  4M2Z A;  4JYA E;  1O0W A;  3T1H E;  2VF1 A;  2LBS B;  4X62 E;  4LFB E;  5A2Q C;  2L33 A;  4LTY A;  1FKA E;  2FTX B;  4DUZ E;  2DSY A;  4DV6 E;  2L6M A;  2B7T A;  4WPY A;  1UHZ A;  4R8O A;  4F9A B;  3IWD A;  4DV1 E;  1GZ6 A;  2E1M A;  2V89 A;  3JU0 A;  3HQ1 A;  3DJW A;  3T1Y E;  2G7H A;  3H09 A;  1N33 E;  1T4N A;  5DNY A;  4JI3 E;  2V88 A;  2F4V E;  4X66 E;  2NUF A;  4I8O A;  1DQ3 A;  2LUQ A;  4B3T E;  5CFF E;  4LF5 E;  2M1S A;  2E5L E;  2UU9 E;  1J26 A;  5IWA E;  2JWO A;  2ODR D;  3AUZ A;  3ZOQ B;  5AE1 A;  2B9D A;  2V87 A;  2ZM6 E;  1STU A;  2CPN A;  4WYQ B;  2B3T B;  2UUB E;  3OML A;  4DMI A;  3VK6 A;  5LMN E;  3LLH A;  2VQE E;  1RQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...