2L92A

Solution structure of the c-terminal domain of h-ns like protein bv3f
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
44
structure length
44
Chain Sequence
MSTVPKYRDPATGKTWSGRGRQPAWLGNDPAAFLIQPDLPAILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Histone family protein nucleoid-structuring protein H-NS
publication title Structural basis for recognition of AT-rich DNA by unrelated xenogeneic silencing proteins
pubmed doi rcsb
source organism Burkholderia vietnamiensis
total genus 3
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2011-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.420 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l92A01
2L92A
chains in the Genus database with same CATH superfamily
4GEQB 4J8ZA 2MKNA 4R8OA 2DIXA 2UU9E 4AQYE 1DQ3A 2EOIA 2ZM6E 4DV3E 5AASA 1UHZA 2LJUA 4M9VC 3BGHA 1A1GA 2UUAE 2YTFA 2YTDA 4BC9A 1X5WA 2EOEA 4TUIA 2MDRA 2CSHA 2JVAA 4JI1E 4WPYA 5LL6R 2F4VE 1SFEA 2ENAA 2V88A 1T4LB 2EM5A 2LO3A 4K0KE 3KZZA 4BHBA 1FKAE 2E5LE 4R2PA 2EL5A 4X64E 2L92A 1F2IG 2DLKA 1O0WA 1N3GA 5IWAE 5IT9C 2V8QB 1EH7A 4LU9A 1G2FC 3T1YE 1ZBTA 2EL4A 3VK6A 1PJQA 3J7AG 1B69A 3THOB 1ZBQA 4JI8E 3EQ1A 2UUCE 4LF5E 2VQEE 2LJHA 1J26A 2D9HA 1YFHA 2KHXA 2PRTA 1RMDA 4R2SA 1MEYC 2RSIA 2RPCA 2N3HA 3EPJA 2ELZA 2YTPA 1N36E 1X6EA 4ZYDA 4DMIA 1N34E 3FIGA 1Z1BA 2CTDA 1A1JA 4DR5E 4P78A 2JOXA 1ZU1A 1TF6A 1QNTA 1AH5A 3J7Yp 2MC5A 2YTEA 4NXNE 2EMXA 2FV4B 2EMAA 3ADJA 3UK3C 3KWRA 2RTXA 3ADLA 3C6MA 2BB8A 2E1MA 1MGTA 2LRSA 4NHRA 4F54A 4NZVA 2B3TB 1X47A 2EOZA 2LTRA 1NCSA 1BBOA 4LF9E 4X8WA 2NA2A 4LFCE 5LLQA 2EM6A 2R1FA 2ODRC 2L8TA 3HXLA 2FGGA 4LF7E 1WJPA 3ECRA 3DF6A 4X66E 2LUPB 4OX9E 4F2JC 4JI0E 2UXDE 1A1LA 3ZOQB 1L4SA 2YRKA 3MSWA 4DV6E 4LFAE 3BBGA 1LLMC 2L2NA 2YTNA 2YU5A 4KZSA 2JWOA 4OOGC 5KL6A 3HTXA 1PDAA 2YSPA 4Q28A 2EP3A 4B3RE 4B3ME 1IBLE 2EOYA 1G2DC 4KHPE 2V89A 2RSMA 2WCC3 2EPRA 1WHNA 2KONA 1I94E 2ENHA 2F8BA 4R2RA 2EPUA 2J7JA 2RQLA 5FLXC 4JI7E 4ZYHA 4DUZE 1JK1A 2HHHE 1IMUA 1TF3A 2RS7A 2EPNA 3AUZA 3AV0A 1X6HA 3JU0A 1SR9A 2RS6A 4R03A 2FTXB 1RC7A 2L3CA 1PJTA 2YWQA 1KJKA 2EOFA 2EPLX 2YTGA 4DR7E 2MDGA 1UILA 2EM0A 2UXBE 2M1SA 3VHTB 2E72A 4L5NC 2ENCA 1FJGE 1YZ9A 3MHHC 2EL6A 4DV7E 4X9JA 1HNXE 1YPNA 3L00A 2EOOA 2EMFA 2YSOA 2Q8UA 2DRPA 4IS1C 2WZOA 5A6JA 2B7TA 4WXCA 2H36X 4F9AB 3ADGA 4DR3E 2YU8A 2NABA 2YTOA 4RH8A 4WFTA 1WRJA 1EH8A 5A6KA 2EM4A 3EPKA 3QG5C 1T39A 4F9BB 3THNA 2K4VA 4DUYE 2V83A 3EPLA 1N33E 3P1XA 2EMGA 2N8XA 1UN6B 1JK2A 4Q35B 2GLIA 4NXME 4JI4E 1IBME 1PJSA 2JR1A 2EOQA 4R2CA 4M2ZA 2DMIA 2YTIA 1DGCA 5ADZA 2L3JA 2WBSA 2L33A 4JI6E 3ADIA 4DV1E 3RMPA 1HR0E 2EPMX 2ODRD 1TN9A 2CPNA 3C4TA 4R2DA 4B3SE 5AE3A 3IWCA 1BB8A 2M9AA 4GKJE 2YZTA 4DV4E 2EM3A 2EOJA 2V86A 3JTZA 4BBYA 4WX9A 4JI2E 1BBGA 4DKKA 4JV5E 1T4NA 4WXDA 4YY3E 2YPNA 3JAMC 2EMWA 3F6GA 2V87A 4L8NA 2KOUA 2YTQA 4LF8E 4R2QA 2EPCA 3OTOE 2EMHA 2EPOA 5IXMB 4N4RB 2NUFA 2N3GA 2EQ0A 2EMZA 2K7IA 2EN2A 3IWBA 4BC7A 2HGHA 3C4BA 2NUGA 4DR6E 2ADRA 1IQOA 3TQMA 1XNQE 4I8OA 5F3WA 2IHR1 2EN1A 3MHSC 1GTKA 2DMYA 3KZYA 4X65E 1XNRE 4WSPA 2YT4A 4BCAA 1WHQA 4M30A 2UUBE 3HPZA 2VE7C 1A1HA 4HEIA 3OMLA 2B9DA 5KL7A 2GPIA 4LF4E 1A1FA 2EM9A 2JP9A 4BHCA 2LMZA 4HTGA 1IBKE 1HNWE 2EN7A 1GZ6A 2YRMA 3BIDA 2EMCA 2HC5A 4DR1E 2EOXA 3T1HE 2EPPA 5AC5A 5DNYA 3J80C 2EJ4A 2EMYA 2EOHA 1ZAAC 2BBGA 1XMQE 3EPHA 1QU6A 5KL4A 1UBDC 3IWDA 3LLHA 2YTJA 4F9CB 4TUGA 1A1IA 5KL5A 1GQEA 2L2KB 4JYAE 1ZR9A 2CT1A 5AE1A 5LMNE 2EWLA 4JI5E 1YYKA 2MKDA 3M99B 5BR8E 1YUIA 1EKZA 2LCEA 3HPSA 2EOSA 2M7QA 2EPAA 2LUQA 2V85A 1HNZE 2DLQA 4GZNC 2EMIA 2M4IA 2UXCE 4F6MA 2DB2A 2JY9A 4BS9A 5CFFE 2EMLA 2EQ3A 2EN3A 2JYAA 2VF1A 2ELYA 1X49A 4ZYEA 2I13A 1IQSA 4DV0E 4O5GA 4R2AA 1J5EE 2L2MA 4O24A 4P7DA 1WXRA 2EM8A 2EN4A 4WSGA 2G7HA 4B3TE 5A2QC 3VYXA 2GHFA 1XMOE 4O4KA 4WYQB 2EM7A 4M0VA 2EMBA 1T4OA 5A6BD 2VQFE 4YHHE 2EE8A 5T6JA 2EPXA 2LT7A 4O43A 5KL3A 4GKKE 4X62E 2EN6A 3HQ1A 5IV8B 4DV2E 4DR2E 1EH6A 4LFBE 3J81C 4BMJA 4MLVA 2WBTA 2EMKA 2DSYA 2LVHA 4ZYGA 2YRHA 2B7VA 1A1KA 2LBSB 2A25A 2JOBA 1YSAC 3VYYA 2EOMA 2EM2A 4R2EA 2HJJA 2EQ1A 1X3CA 2JXPA 3C6KA 4DR4E 4KWYA 3DJWA 2LTSA 1RQ0A 1KYQA 2EORA 3F6HA 2LV2A 5AC4A 4F6NA 1X48A 3K6QA 2I9IA 2LE2A 1N32E 2VRDA 4LTYA 4RHBB 4FK5C 4LF6E 1YYWA 2NUEA 2EPKX 5A69A 3LMLA 1STUA 2EZ6A 2EPZA 3BF2A 4DV5E 1NEIA 2R76A 2DGCA 5TSEA 1AAYA 5A6BA 5A6AA 2JPAA 1PKPA 4JI3E 1X6FA 2L6MA 1YUJA 1P47A 4IJDA 1YYOA 2EN8A 4MLQA 5KL2A 1DI2A 1T38A 5AE2A 2WBUA 2MC6A 5LMUE 3H09A
chains in the Genus database with same CATH topology
4LF7E 2UXCE 4GEQB 1HR0E 3DF6A 4J8ZA 4X66E 2LUPB 4OX9E 4R8OA 2DB2A 2JY9A 2DIXA 2ODRD 2UU9E 4BS9A 5CFFE 2CPNA 3ZOQB 4AQYE 4JI0E 1DQ3A 3C4TA 2UXDE 4B3SE 5AE3A 3IWCA 2VF1A 2ZM6E 3MSWA 5AASA 4DV3E 4DV6E 4LFAE 4GKJE 1UHZA 1X49A 2YZTA 2L2NA 4KZSA 4DV0E 2JWOA 4DV4E 2UUAE 4OOGC 3JTZA 2V86A 2L2MA 4BBYA 4P7DA 1J5EE 4JI2E 4Q28A 4BC9A 3HTXA 1WXRA 4DKKA 4LF5E 4JV5E 1T4NA 4YY3E 4B3RE 4TUIA 4B3ME 2MDRA 1IBLE 4KHPE 2JVAA 4JI1E 3JAMC 2V89A 2G7HA 2RSMA 2V87A 3F6GA 4L8NA 5A2QC 4B3TE 3VYXA 4WPYA 2KOUA 5LL6R 1WHNA 2KONA 4WYQB 1XMOE 1I94E 4LF8E 2F8BA 4M0VA 2F4VE 2V88A 1T4LB 1T4OA 3OTOE 4K0KE 2VQFE 4YHHE 5T6JA 5FLXC 4JI7E 1FKAE 2N3GA 4DUZE 2E5LE 2HHHE 2NUFA 4X64E 1J26A 4GKKE 2RS7A 2L92A 3HQ1A 4X62E 3AUZA 3AV0A 3IWBA 3JU0A 1SR9A 2RS6A 4R03A 4BC7A 4DV2E 1O0WA 4DR2E 2FTXB 3C4BA 2NUGA 1RC7A 4DR6E 5IWAE 2L3CA 5IT9C 2V8QB 1XNQE 4I8OA 4LU9A 3J81C 5F3WA 4LFBE 2IHR1 4BMJA 3T1YE 2DMYA 4DR7E 1ZBTA 4X65E 1UILA 1XNRE 4WSPA 3VK6A 2M1SA 2UXBE 2YT4A 3J7AG 4L5NC 4BCAA 1WHQA 1ZBQA 2DSYA 4M30A 4JI8E 2VQEE 2LJHA 2UUCE 2UUBE 3HPZA 1FJGE 2VE7C 4DV7E 1YZ9A 2B7VA 2LBSB 2KHXA 1HNXE 2JOBA 3OMLA 3VYYA 2B9DA 4LF4E 4DR4E 2LMZA 1IBKE 1HNWE 2WZOA 2B7TA 1GZ6A 4DR1E 2H36X 3DJWA 2LTSA 3T1HE 1RQ0A 2N3HA 5DNYA 3F6HA 3J80C 1X48A 1N36E 3K6QA 4F9AB 3ADGA 1XMQE 2LE2A 4DMIA 4DR3E 3FIGA 1N34E 1N32E 4DR5E 4P78A 4LTYA 2JOXA 2L8TA 4LF6E 1QU6A 1YYWA 4WFTA 3IWDA 3LLHA 4F9CB 4TUGA 2NUEA 3J7Yp 1GQEA 2MC5A 2L2KB 4NXNE 2FV4B 3LMLA 4JYAE 1STUA 3ADJA 4F9BB 3KWRA 2RTXA 2EZ6A 3ADLA 2E1MA 5AE1A 2LRSA 4F54A 5LMNE 2EWLA 4DV5E 2K4VA 4JI5E 4DUYE 2V83A 1YYKA 1N33E 3P1XA 5BR8E 4NXME 2B3TB 1IBME 4JI4E 1X47A 1EKZA 1PKPA 2JR1A 3HPSA 4JI3E 2L6MA 2M7QA 2LTRA 2LUQA 4M2ZA 4LF9E 2V85A 1YYOA 4X8WA 1HNZE 2NA2A 5ADZA 2L3JA 1DI2A 2L33A 5AE2A 4LFCE 2MC6A 4JI6E 4DV1E 2M4IA 5LMUE 2ODRC 3ADIA 3RMPA 3H09A 3HXLA 2FGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L92 A; 
#chains in the Genus database with same CATH topology
 4GEQ B;  4J8Z A;  2MKN A;  4R8O A;  2DIX A;  2UU9 E;  4AQY E;  1DQ3 A;  2EOI A;  2ZM6 E;  4DV3 E;  5AAS A;  1UHZ A;  2LJU A;  4M9V C;  3BGH A;  1A1G A;  2UUA E;  2YTF A;  2YTD A;  4BC9 A;  1X5W A;  2EOE A;  4TUI A;  2MDR A;  2CSH A;  2JVA A;  4JI1 E;  4WPY A;  5LL6 R;  2F4V E;  1SFE A;  2ENA A;  2V88 A;  1T4L B;  2EM5 A;  2LO3 A;  4K0K E;  3KZZ A;  4BHB A;  1FKA E;  2E5L E;  4R2P A;  2EL5 A;  4X64 E;  2L92 A;  1F2I G;  2DLK A;  1O0W A;  1N3G A;  5IWA E;  5IT9 C;  2V8Q B;  1EH7 A;  4LU9 A;  1G2F C;  3T1Y E;  1ZBT A;  2EL4 A;  3VK6 A;  1PJQ A;  3J7A G;  1B69 A;  3THO B;  1ZBQ A;  4JI8 E;  3EQ1 A;  2UUC E;  4LF5 E;  2VQE E;  2LJH A;  1J26 A;  2D9H A;  1YFH A;  2KHX A;  2PRT A;  1RMD A;  4R2S A;  1MEY C;  2RSI A;  2RPC A;  2N3H A;  3EPJ A;  2ELZ A;  2YTP A;  1N36 E;  1X6E A;  4ZYD A;  4DMI A;  1N34 E;  3FIG A;  1Z1B A;  2CTD A;  1A1J A;  4DR5 E;  4P78 A;  2JOX A;  1ZU1 A;  1TF6 A;  1QNT A;  1AH5 A;  3J7Y p;  2MC5 A;  2YTE A;  4NXN E;  2EMX A;  2FV4 B;  2EMA A;  3ADJ A;  3UK3 C;  3KWR A;  2RTX A;  3ADL A;  3C6M A;  2BB8 A;  2E1M A;  1MGT A;  2LRS A;  4NHR A;  4F54 A;  4NZV A;  2B3T B;  1X47 A;  2EOZ A;  2LTR A;  1NCS A;  1BBO A;  4LF9 E;  4X8W A;  2NA2 A;  4LFC E;  5LLQ A;  2EM6 A;  2R1F A;  2ODR C;  2L8T A;  3HXL A;  2FGG A;  4LF7 E;  1WJP A;  3ECR A;  3DF6 A;  4X66 E;  2LUP B;  4OX9 E;  4F2J C;  4JI0 E;  2UXD E;  1A1L A;  3ZOQ B;  1L4S A;  2YRK A;  3MSW A;  4DV6 E;  4LFA E;  3BBG A;  1LLM C;  2L2N A;  2YTN A;  2YU5 A;  4KZS A;  2JWO A;  4OOG C;  5KL6 A;  3HTX A;  1PDA A;  2YSP A;  4Q28 A;  2EP3 A;  4B3R E;  4B3M E;  1IBL E;  2EOY A;  1G2D C;  4KHP E;  2V89 A;  2RSM A;  2WCC 3;  2EPR A;  1WHN A;  2KON A;  1I94 E;  2ENH A;  2F8B A;  4R2R A;  2EPU A;  2J7J A;  2RQL A;  5FLX C;  4JI7 E;  4ZYH A;  4DUZ E;  1JK1 A;  2HHH E;  1IMU A;  1TF3 A;  2RS7 A;  2EPN A;  3AUZ A;  3AV0 A;  1X6H A;  3JU0 A;  1SR9 A;  2RS6 A;  4R03 A;  2FTX B;  1RC7 A;  2L3C A;  1PJT A;  2YWQ A;  1KJK A;  2EOF A;  2EPL X;  2YTG A;  4DR7 E;  2MDG A;  1UIL A;  2EM0 A;  2UXB E;  2M1S A;  3VHT B;  2E72 A;  4L5N C;  2ENC A;  1FJG E;  1YZ9 A;  3MHH C;  2EL6 A;  4DV7 E;  4X9J A;  1HNX E;  1YPN A;  3L00 A;  2EOO A;  2EMF A;  2YSO A;  2Q8U A;  2DRP A;  4IS1 C;  2WZO A;  5A6J A;  2B7T A;  4WXC A;  2H36 X;  4F9A B;  3ADG A;  4DR3 E;  2YU8 A;  2NAB A;  2YTO A;  4RH8 A;  4WFT A;  1WRJ A;  1EH8 A;  5A6K A;  2EM4 A;  3EPK A;  3QG5 C;  1T39 A;  4F9B B;  3THN A;  2K4V A;  4DUY E;  2V83 A;  3EPL A;  1N33 E;  3P1X A;  2EMG A;  2N8X A;  1UN6 B;  1JK2 A;  4Q35 B;  2GLI A;  4NXM E;  4JI4 E;  1IBM E;  1PJS A;  2JR1 A;  2EOQ A;  4R2C A;  4M2Z A;  2DMI A;  2YTI A;  1DGC A;  5ADZ A;  2L3J A;  2WBS A;  2L33 A;  4JI6 E;  3ADI A;  4DV1 E;  3RMP A;  1HR0 E;  2EPM X;  2ODR D;  1TN9 A;  2CPN A;  3C4T A;  4R2D A;  4B3S E;  5AE3 A;  3IWC A;  1BB8 A;  2M9A A;  4GKJ E;  2YZT A;  4DV4 E;  2EM3 A;  2EOJ A;  2V86 A;  3JTZ A;  4BBY A;  4WX9 A;  4JI2 E;  1BBG A;  4DKK A;  4JV5 E;  1T4N A;  4WXD A;  4YY3 E;  2YPN A;  3JAM C;  2EMW A;  3F6G A;  2V87 A;  4L8N A;  2KOU A;  2YTQ A;  4LF8 E;  4R2Q A;  2EPC A;  3OTO E;  2EMH A;  2EPO A;  5IXM B;  4N4R B;  2NUF A;  2N3G A;  2EQ0 A;  2EMZ A;  2K7I A;  2EN2 A;  3IWB A;  4BC7 A;  2HGH A;  3C4B A;  2NUG A;  4DR6 E;  2ADR A;  1IQO A;  3TQM A;  1XNQ E;  4I8O A;  5F3W A;  2IHR 1;  2EN1 A;  3MHS C;  1GTK A;  2DMY A;  3KZY A;  4X65 E;  1XNR E;  4WSP A;  2YT4 A;  4BCA A;  1WHQ A;  4M30 A;  2UUB E;  3HPZ A;  2VE7 C;  1A1H A;  4HEI A;  3OML A;  2B9D A;  5KL7 A;  2GPI A;  4LF4 E;  1A1F A;  2EM9 A;  2JP9 A;  4BHC A;  2LMZ A;  4HTG A;  1IBK E;  1HNW E;  2EN7 A;  1GZ6 A;  2YRM A;  3BID A;  2EMC A;  2HC5 A;  4DR1 E;  2EOX A;  3T1H E;  2EPP A;  5AC5 A;  5DNY A;  3J80 C;  2EJ4 A;  2EMY A;  2EOH A;  1ZAA C;  2BBG A;  1XMQ E;  3EPH A;  1QU6 A;  5KL4 A;  1UBD C;  3IWD A;  3LLH A;  2YTJ A;  4F9C B;  4TUG A;  1A1I A;  5KL5 A;  1GQE A;  2L2K B;  4JYA E;  1ZR9 A;  2CT1 A;  5AE1 A;  5LMN E;  2EWL A;  4JI5 E;  1YYK A;  2MKD A;  3M99 B;  5BR8 E;  1YUI A;  1EKZ A;  2LCE A;  3HPS A;  2EOS A;  2M7Q A;  2EPA A;  2LUQ A;  2V85 A;  1HNZ E;  2DLQ A;  4GZN C;  2EMI A;  2M4I A;  2UXC E;  4F6M A;  2DB2 A;  2JY9 A;  4BS9 A;  5CFF E;  2EML A;  2EQ3 A;  2EN3 A;  2JYA A;  2VF1 A;  2ELY A;  1X49 A;  4ZYE A;  2I13 A;  1IQS A;  4DV0 E;  4O5G A;  4R2A A;  1J5E E;  2L2M A;  4O24 A;  4P7D A;  1WXR A;  2EM8 A;  2EN4 A;  4WSG A;  2G7H A;  4B3T E;  5A2Q C;  3VYX A;  2GHF A;  1XMO E;  4O4K A;  4WYQ B;  2EM7 A;  4M0V A;  2EMB A;  1T4O A;  5A6B D;  2VQF E;  4YHH E;  2EE8 A;  5T6J A;  2EPX A;  2LT7 A;  4O43 A;  5KL3 A;  4GKK E;  4X62 E;  2EN6 A;  3HQ1 A;  5IV8 B;  4DV2 E;  4DR2 E;  1EH6 A;  4LFB E;  3J81 C;  4BMJ A;  4MLV A;  2WBT A;  2EMK A;  2DSY A;  2LVH A;  4ZYG A;  2YRH A;  2B7V A;  1A1K A;  2LBS B;  2A25 A;  2JOB A;  1YSA C;  3VYY A;  2EOM A;  2EM2 A;  4R2E A;  2HJJ A;  2EQ1 A;  1X3C A;  2JXP A;  3C6K A;  4DR4 E;  4KWY A;  3DJW A;  2LTS A;  1RQ0 A;  1KYQ A;  2EOR A;  3F6H A;  2LV2 A;  5AC4 A;  4F6N A;  1X48 A;  3K6Q A;  2I9I A;  2LE2 A;  1N32 E;  2VRD A;  4LTY A;  4RHB B;  4FK5 C;  4LF6 E;  1YYW A;  2NUE A;  2EPK X;  5A69 A;  3LML A;  1STU A;  2EZ6 A;  2EPZ A;  3BF2 A;  4DV5 E;  1NEI A;  2R76 A;  2DGC A;  5TSE A;  1AAY A;  5A6B A;  5A6A A;  2JPA A;  1PKP A;  4JI3 E;  1X6F A;  2L6M A;  1YUJ A;  1P47 A;  4IJD A;  1YYO A;  2EN8 A;  4MLQ A;  5KL2 A;  1DI2 A;  1T38 A;  5AE2 A;  2WBU A;  2MC6 A;  5LMU E;  3H09 A; 
#chains in the Genus database with same CATH homology
 4LF7 E;  2UXC E;  4GEQ B;  1HR0 E;  3DF6 A;  4J8Z A;  4X66 E;  2LUP B;  4OX9 E;  4R8O A;  2DB2 A;  2JY9 A;  2DIX A;  2ODR D;  2UU9 E;  4BS9 A;  5CFF E;  2CPN A;  3ZOQ B;  4AQY E;  4JI0 E;  1DQ3 A;  3C4T A;  2UXD E;  4B3S E;  5AE3 A;  3IWC A;  2VF1 A;  2ZM6 E;  3MSW A;  5AAS A;  4DV3 E;  4DV6 E;  4LFA E;  4GKJ E;  1UHZ A;  1X49 A;  2YZT A;  2L2N A;  4KZS A;  4DV0 E;  2JWO A;  4DV4 E;  2UUA E;  4OOG C;  3JTZ A;  2V86 A;  2L2M A;  4BBY A;  4P7D A;  1J5E E;  4JI2 E;  4Q28 A;  4BC9 A;  3HTX A;  1WXR A;  4DKK A;  4LF5 E;  4JV5 E;  1T4N A;  4YY3 E;  4B3R E;  4TUI A;  4B3M E;  2MDR A;  1IBL E;  4KHP E;  2JVA A;  4JI1 E;  3JAM C;  2V89 A;  2G7H A;  2RSM A;  2V87 A;  3F6G A;  4L8N A;  5A2Q C;  4B3T E;  3VYX A;  4WPY A;  2KOU A;  5LL6 R;  1WHN A;  2KON A;  4WYQ B;  1XMO E;  1I94 E;  4LF8 E;  2F8B A;  4M0V A;  2F4V E;  2V88 A;  1T4L B;  1T4O A;  3OTO E;  4K0K E;  2VQF E;  4YHH E;  5T6J A;  5FLX C;  4JI7 E;  1FKA E;  2N3G A;  4DUZ E;  2E5L E;  2HHH E;  2NUF A;  4X64 E;  1J26 A;  4GKK E;  2RS7 A;  2L92 A;  3HQ1 A;  4X62 E;  3AUZ A;  3AV0 A;  3IWB A;  3JU0 A;  1SR9 A;  2RS6 A;  4R03 A;  4BC7 A;  4DV2 E;  1O0W A;  4DR2 E;  2FTX B;  3C4B A;  2NUG A;  1RC7 A;  4DR6 E;  5IWA E;  2L3C A;  5IT9 C;  2V8Q B;  1XNQ E;  4I8O A;  4LU9 A;  3J81 C;  5F3W A;  4LFB E;  2IHR 1;  4BMJ A;  3T1Y E;  2DMY A;  4DR7 E;  1ZBT A;  4X65 E;  1UIL A;  1XNR E;  4WSP A;  3VK6 A;  2M1S A;  2UXB E;  2YT4 A;  3J7A G;  4L5N C;  4BCA A;  1WHQ A;  1ZBQ A;  2DSY A;  4M30 A;  4JI8 E;  2VQE E;  2LJH A;  2UUC E;  2UUB E;  3HPZ A;  1FJG E;  2VE7 C;  4DV7 E;  1YZ9 A;  2B7V A;  2LBS B;  2KHX A;  1HNX E;  2JOB A;  3OML A;  3VYY A;  2B9D A;  4LF4 E;  4DR4 E;  2LMZ A;  1IBK E;  1HNW E;  2WZO A;  2B7T A;  1GZ6 A;  4DR1 E;  2H36 X;  3DJW A;  2LTS A;  3T1H E;  1RQ0 A;  2N3H A;  5DNY A;  3F6H A;  3J80 C;  1X48 A;  1N36 E;  3K6Q A;  4F9A B;  3ADG A;  1XMQ E;  2LE2 A;  4DMI A;  4DR3 E;  3FIG A;  1N34 E;  1N32 E;  4DR5 E;  4P78 A;  4LTY A;  2JOX A;  2L8T A;  4LF6 E;  1QU6 A;  1YYW A;  4WFT A;  3IWD A;  3LLH A;  4F9C B;  4TUG A;  2NUE A;  3J7Y p;  1GQE A;  2MC5 A;  2L2K B;  4NXN E;  2FV4 B;  3LML A;  4JYA E;  1STU A;  3ADJ A;  4F9B B;  3KWR A;  2RTX A;  2EZ6 A;  3ADL A;  2E1M A;  5AE1 A;  2LRS A;  4F54 A;  5LMN E;  2EWL A;  4DV5 E;  2K4V A;  4JI5 E;  4DUY E;  2V83 A;  1YYK A;  1N33 E;  3P1X A;  5BR8 E;  4NXM E;  2B3T B;  1IBM E;  4JI4 E;  1X47 A;  1EKZ A;  1PKP A;  2JR1 A;  3HPS A;  4JI3 E;  2L6M A;  2M7Q A;  2LTR A;  2LUQ A;  4M2Z A;  4LF9 E;  2V85 A;  1YYO A;  4X8W A;  1HNZ E;  2NA2 A;  5ADZ A;  2L3J A;  1DI2 A;  2L33 A;  5AE2 A;  4LFC E;  2MC6 A;  4JI6 E;  4DV1 E;  2M4I A;  5LMU E;  2ODR C;  3ADI A;  3RMP A;  3H09 A;  3HXL A;  2FGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...