2K7IA

Solution nmr structure of protein atu0232 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att3. ontario center for structural proteomics target atc0223.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
b'MYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0339 protein Atu0232
publication title Solution structure of protein ATU0232 from Agrobacterium Tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07411 DUF1508 Domain of unknown function (DUF1508)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.160 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain YegP-like 2k7iA01
3BIDA 2K7IA
chains in the Genus database with same CATH superfamily
1UILA 4NZVA 3EQ1A 2EPZA 4MLVA 5A6JA 4R2PA 2JY9A 3THNA 4ZYHA 4OX9E 1YYOA 4OOGC 4NXNE 2KHXA 4DV2E 4WPYA 3LMLA 4ZYDA 4F9AB 1JK2A 2EZ6A 1HNZE 1DI2A 2YZTA 2M1SA 4R03A 1B69A 4LF5E 2YTIA 5A6BD 4F9CB 1DQ3A 4WSGA 2EPOA 5LLQA 2V88A 4LF9E 4O24A 2EOZA 3AUZA 1YUJA 3VYXA 2GPIA 3J7Yp 2JXPA 1N33E 2EN3A 1PJQA 3DJWA 2L8TA 4KWYA 5A6BA 2B3TB 2EM8A 2EPPA 1YFHA 4LF6E 3ADJA 1I94E 1WXRA 4HTGA 3KZZA 4P78A 2JP9A 2VQEE 4JYAE 4GKJE 4WSPA 1XNRE 2L3JA 2YT4A 3C4TA 1UN6B 2GHFA 2ENHA 1LLMC 4M2ZA 2UXDE 2EMCA 2EOOA 5LMNE 5T6JA 4L5NC 1L4SA 2YTDA 2HJJA 3C4BA 2GLIA 1KYQA 2L2NA 1A1GA 2CPNA 4O5GA 1X5WA 1PJSA 2LUPB 4X65E 5BR8E 4Q35B 2DMYA 4JI3E 2EPLX 2NUGA 2WZOA 4HEIA 4K0KE 2YSOA 2BBGA 1G2FC 2V87A 2R1FA 1STUA 1JK1A 3HXLA 2UXBE 2CSHA 2VE7C 2WBUA 3L00A 1YSAC 2RSMA 4R2EA 4BCAA 2JVAA 4ZYEA 1ZBQA 2EOEA 3MSWA 2EPMX 2EM6A 2EJ4A 4DUZE 2K7IA 2EOQA 2G7HA 4B3TE 4B3ME 1EKZA 1ZAAC 4YY3E 2FV4B 1IBME 2F8BA 2EM3A 3H09A 1A1JA 5KL5A 3ADGA 5DNYA 4FK5C 2YTEA 2EMWA 3T1YE 2I13A 3JTZA 4O4KA 4DV4E 2EMYA 3ZOQB 1X6FA 4BC7A 5KL7A 2VRDA 2ODRD 5AC5A 4DV3E 2MDRA 2ODRC 4WFTA 2V83A 4LFBE 2ZM6E 3F6GA 1HNXE 2EQ1A 5A6KA 4LFAE 5A2QC 3EPKA 2K4VA 3THOB 2EN1A 2KONA 2JPAA 4B3SE 2M9AA 1BB8A 1T39A 2N3GA 4IJDA 3BF2A 2YTNA 2LMZA 2YWQA 2EOXA 1A1KA 2DRPA 4N4RB 2CT1A 2RS7A 2EN8A 2EPCA 1X49A 4KZSA 2EMGA 5AE2A 4DR1E 2JOBA 2EM9A 1N36E 2MC5A 4DUYE 5A6AA 1T4LB 1YPNA 2EOMA 2EOHA 2EPXA 2EPAA 2FGGA 4DV5E 2YTGA 2ELZA 2EMKA 4X62E 1ZBTA 2EM0A 4NXME 1KJKA 2D9HA 2L6MA 4KHPE 2EMHA 2EN7A 2M4IA 4JI2E 2EMBA 3BGHA 2DGCA 3HTXA 4R2DA 2EMLA 3ECRA 5ADZA 2E72A 5LMUE 4JI4E 4R2AA 3DF6A 2YRKA 2YU8A 2DLQA 1SR9A 1WJPA 1EH7A 1IBKE 2YTQA 4RHBB 1TN9A 4GKKE 4DR7E 1PDAA 2EMAA 3K6QA 3IWDA 1AAYA 1XMOE 2EM2A 3IWBA 2HGHA 2YTPA 1UHZA 2NA2A 2M7QA 4DR3E 2MDGA 4JI5E 1MGTA 1A1HA 2J7JA 5A69A 2B7VA 3F6HA 3C6KA 4B3RE 1Z1BA 1J26A 1RQ0A 3J81C 4AQYE 5CFFE 2NUFA 1TF3A 4GEQB 4JI8E 2EWLA 2ADRA 1TF6A 2EOJA 2LT7A 1MEYC 3OMLA 4DV1E 2HC5A 1AH5A 2LVHA 1WRJA 1IQOA 5LL6R 2EOIA 2V89A 4BHCA 1EH8A 4DV0E 1XNQE 1IQSA 2JWOA 2NABA 4F6NA 4R8OA 4LF4E 2YU5A 2B7TA 4BHBA 4BMJA 4LF8E 2L2MA 2EP3A 4X8WA 4BS9A 5KL6A 1X48A 4BC9A 1N32E 2L3CA 2WBSA 5AE3A 4F6MA 2EL4A 2LO3A 5KL3A 2EE8A 1RMDA 1NCSA 3VK6A 1EH6A 4LU9A 2EORA 2EN6A 2V8QB 1ZR9A 4M0VA 1YYKA 1WHQA 2LE2A 5KL4A 2JR1A 3TQMA 5IXMB 2V86A 4X66E 2EM5A 2Q8UA 4P7DA 2LCEA 4MLQA 2L33A 4JI7E 1IBLE 2CTDA 1A1FA 3J7AG 2N3HA 1YUIA 2RS6A 3HPZA 4X64E 4IS1C 2JOXA 1ZU1A 4LTYA 1T4NA 4F54A 4M9VC 2UUAE 2EOYA 2EQ0A 2EPKX 1RC7A 4TUIA 4O43A 2IHR1 2DSYA 2EM4A 5KL2A 4JI1E 1PJTA 1P47A 1BBGA 3RMPA 2EN2A 1J5EE 2ELYA 1G2DC 3FIGA 2LTRA 4WXCA 2WCC3 2YRHA 4WXDA 3M99B 1XMQE 2UUCE 1SFEA 2DLKA 2YTFA 1T38A 3MHSC 3P1XA 3QG5C 3EPHA 2L2KB 2VF1A 4JI0E 4GZNC 4JI6E 2RTXA 1DGCA 2YTOA 4WX9A 1YYWA 2VQFE 1X3CA 4WYQB 3OTOE 1YZ9A 2I9IA 1QU6A 2EN4A 4F2JC 2ENAA 1FJGE 2NUEA 4DR4E 2LV2A 4R2RA 2FTXB 2R76A 1HR0E 2LBSB 1A1LA 4DR6E 4DKKA 4R2CA 2UUBE 2EM7A 4RH8A 2LUQA 1A1IA 5AC4A 2JYAA 4I8OA 4YHHE 1X6EA 2BB8A 3KZYA 2WBTA 4JV5E 2PRTA 2YSPA 2EMXA 4F9BB 5TSEA 2EQ3A 1HNWE 2UU9E 1WHNA 1IMUA 3UK3C 4L8NA 1PKPA 2EOFA 2LTSA 4M30A 1QNTA 3J80C 1UBDC 1FKAE 4TUGA 2MKDA 2RPCA 5FLXC 5AE1A 2LJHA 5IWAE 4R2QA 3LLHA 3MHHC 3HQ1A 1N3GA 2V85A 4DR5E 3BBGA 2EMIA 2L92A 4R2SA 4J8ZA 2EPRA 1GTKA 4DV7E 2E1MA 3EPLA 3C6MA 2DB2A 1N34E 2ENCA 2YTJA 1X47A 2B9DA 2EMFA 2EPUA 2DIXA 3VYYA 2EL5A 1BBOA 2MC6A 3IWCA 4ZYGA 2KOUA 4LF7E 4LFCE 3KWRA 5AASA 4NHRA 4Q28A 2F4VE 3ADIA 2UXCE 3AV0A 5F3WA 2EPNA 5IT9C 2LJUA 1GZ6A 1X6HA 3BIDA 2E5LE 2LRSA 3T1HE 3JU0A 2A25A 2H36X 1O0WA 2EOSA 4DV6E 2YRMA 2HHHE 3VHTB 1NEIA 2RSIA 4DR2E 3ADLA 2DMIA 2RQLA 4BBYA 1F2IG 2N8XA 2EL6A 2MKNA 1T4OA 3JAMC 4X9JA 2EMZA 1GQEA 2YPNA 5IV8B 3HPSA 4DMIA 3EPJA
chains in the Genus database with same CATH topology
3BIDA 2K7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BID A;  2K7I A; 
#chains in the Genus database with same CATH topology
 1UIL A;  4NZV A;  3EQ1 A;  2EPZ A;  4MLV A;  5A6J A;  4R2P A;  2JY9 A;  3THN A;  4ZYH A;  4OX9 E;  1YYO A;  4OOG C;  4NXN E;  2KHX A;  4DV2 E;  4WPY A;  3LML A;  4ZYD A;  4F9A B;  1JK2 A;  2EZ6 A;  1HNZ E;  1DI2 A;  2YZT A;  2M1S A;  4R03 A;  1B69 A;  4LF5 E;  2YTI A;  5A6B D;  4F9C B;  1DQ3 A;  4WSG A;  2EPO A;  5LLQ A;  2V88 A;  4LF9 E;  4O24 A;  2EOZ A;  3AUZ A;  1YUJ A;  3VYX A;  2GPI A;  3J7Y p;  2JXP A;  1N33 E;  2EN3 A;  1PJQ A;  3DJW A;  2L8T A;  4KWY A;  5A6B A;  2B3T B;  2EM8 A;  2EPP A;  1YFH A;  4LF6 E;  3ADJ A;  1I94 E;  1WXR A;  4HTG A;  3KZZ A;  4P78 A;  2JP9 A;  2VQE E;  4JYA E;  4GKJ E;  4WSP A;  1XNR E;  2L3J A;  2YT4 A;  3C4T A;  1UN6 B;  2GHF A;  2ENH A;  1LLM C;  4M2Z A;  2UXD E;  2EMC A;  2EOO A;  5LMN E;  5T6J A;  4L5N C;  1L4S A;  2YTD A;  2HJJ A;  3C4B A;  2GLI A;  1KYQ A;  2L2N A;  1A1G A;  2CPN A;  4O5G A;  1X5W A;  1PJS A;  2LUP B;  4X65 E;  5BR8 E;  4Q35 B;  2DMY A;  4JI3 E;  2EPL X;  2NUG A;  2WZO A;  4HEI A;  4K0K E;  2YSO A;  2BBG A;  1G2F C;  2V87 A;  2R1F A;  1STU A;  1JK1 A;  3HXL A;  2UXB E;  2CSH A;  2VE7 C;  2WBU A;  3L00 A;  1YSA C;  2RSM A;  4R2E A;  4BCA A;  2JVA A;  4ZYE A;  1ZBQ A;  2EOE A;  3MSW A;  2EPM X;  2EM6 A;  2EJ4 A;  4DUZ E;  2K7I A;  2EOQ A;  2G7H A;  4B3T E;  4B3M E;  1EKZ A;  1ZAA C;  4YY3 E;  2FV4 B;  1IBM E;  2F8B A;  2EM3 A;  3H09 A;  1A1J A;  5KL5 A;  3ADG A;  5DNY A;  4FK5 C;  2YTE A;  2EMW A;  3T1Y E;  2I13 A;  3JTZ A;  4O4K A;  4DV4 E;  2EMY A;  3ZOQ B;  1X6F A;  4BC7 A;  5KL7 A;  2VRD A;  2ODR D;  5AC5 A;  4DV3 E;  2MDR A;  2ODR C;  4WFT A;  2V83 A;  4LFB E;  2ZM6 E;  3F6G A;  1HNX E;  2EQ1 A;  5A6K A;  4LFA E;  5A2Q C;  3EPK A;  2K4V A;  3THO B;  2EN1 A;  2KON A;  2JPA A;  4B3S E;  2M9A A;  1BB8 A;  1T39 A;  2N3G A;  4IJD A;  3BF2 A;  2YTN A;  2LMZ A;  2YWQ A;  2EOX A;  1A1K A;  2DRP A;  4N4R B;  2CT1 A;  2RS7 A;  2EN8 A;  2EPC A;  1X49 A;  4KZS A;  2EMG A;  5AE2 A;  4DR1 E;  2JOB A;  2EM9 A;  1N36 E;  2MC5 A;  4DUY E;  5A6A A;  1T4L B;  1YPN A;  2EOM A;  2EOH A;  2EPX A;  2EPA A;  2FGG A;  4DV5 E;  2YTG A;  2ELZ A;  2EMK A;  4X62 E;  1ZBT A;  2EM0 A;  4NXM E;  1KJK A;  2D9H A;  2L6M A;  4KHP E;  2EMH A;  2EN7 A;  2M4I A;  4JI2 E;  2EMB A;  3BGH A;  2DGC A;  3HTX A;  4R2D A;  2EML A;  3ECR A;  5ADZ A;  2E72 A;  5LMU E;  4JI4 E;  4R2A A;  3DF6 A;  2YRK A;  2YU8 A;  2DLQ A;  1SR9 A;  1WJP A;  1EH7 A;  1IBK E;  2YTQ A;  4RHB B;  1TN9 A;  4GKK E;  4DR7 E;  1PDA A;  2EMA A;  3K6Q A;  3IWD A;  1AAY A;  1XMO E;  2EM2 A;  3IWB A;  2HGH A;  2YTP A;  1UHZ A;  2NA2 A;  2M7Q A;  4DR3 E;  2MDG A;  4JI5 E;  1MGT A;  1A1H A;  2J7J A;  5A69 A;  2B7V A;  3F6H A;  3C6K A;  4B3R E;  1Z1B A;  1J26 A;  1RQ0 A;  3J81 C;  4AQY E;  5CFF E;  2NUF A;  1TF3 A;  4GEQ B;  4JI8 E;  2EWL A;  2ADR A;  1TF6 A;  2EOJ A;  2LT7 A;  1MEY C;  3OML A;  4DV1 E;  2HC5 A;  1AH5 A;  2LVH A;  1WRJ A;  1IQO A;  5LL6 R;  2EOI A;  2V89 A;  4BHC A;  1EH8 A;  4DV0 E;  1XNQ E;  1IQS A;  2JWO A;  2NAB A;  4F6N A;  4R8O A;  4LF4 E;  2YU5 A;  2B7T A;  4BHB A;  4BMJ A;  4LF8 E;  2L2M A;  2EP3 A;  4X8W A;  4BS9 A;  5KL6 A;  1X48 A;  4BC9 A;  1N32 E;  2L3C A;  2WBS A;  5AE3 A;  4F6M A;  2EL4 A;  2LO3 A;  5KL3 A;  2EE8 A;  1RMD A;  1NCS A;  3VK6 A;  1EH6 A;  4LU9 A;  2EOR A;  2EN6 A;  2V8Q B;  1ZR9 A;  4M0V A;  1YYK A;  1WHQ A;  2LE2 A;  5KL4 A;  2JR1 A;  3TQM A;  5IXM B;  2V86 A;  4X66 E;  2EM5 A;  2Q8U A;  4P7D A;  2LCE A;  4MLQ A;  2L33 A;  4JI7 E;  1IBL E;  2CTD A;  1A1F A;  3J7A G;  2N3H A;  1YUI A;  2RS6 A;  3HPZ A;  4X64 E;  4IS1 C;  2JOX A;  1ZU1 A;  4LTY A;  1T4N A;  4F54 A;  4M9V C;  2UUA E;  2EOY A;  2EQ0 A;  2EPK X;  1RC7 A;  4TUI A;  4O43 A;  2IHR 1;  2DSY A;  2EM4 A;  5KL2 A;  4JI1 E;  1PJT A;  1P47 A;  1BBG A;  3RMP A;  2EN2 A;  1J5E E;  2ELY A;  1G2D C;  3FIG A;  2LTR A;  4WXC A;  2WCC 3;  2YRH A;  4WXD A;  3M99 B;  1XMQ E;  2UUC E;  1SFE A;  2DLK A;  2YTF A;  1T38 A;  3MHS C;  3P1X A;  3QG5 C;  3EPH A;  2L2K B;  2VF1 A;  4JI0 E;  4GZN C;  4JI6 E;  2RTX A;  1DGC A;  2YTO A;  4WX9 A;  1YYW A;  2VQF E;  1X3C A;  4WYQ B;  3OTO E;  1YZ9 A;  2I9I A;  1QU6 A;  2EN4 A;  4F2J C;  2ENA A;  1FJG E;  2NUE A;  4DR4 E;  2LV2 A;  4R2R A;  2FTX B;  2R76 A;  1HR0 E;  2LBS B;  1A1L A;  4DR6 E;  4DKK A;  4R2C A;  2UUB E;  2EM7 A;  4RH8 A;  2LUQ A;  1A1I A;  5AC4 A;  2JYA A;  4I8O A;  4YHH E;  1X6E A;  2BB8 A;  3KZY A;  2WBT A;  4JV5 E;  2PRT A;  2YSP A;  2EMX A;  4F9B B;  5TSE A;  2EQ3 A;  1HNW E;  2UU9 E;  1WHN A;  1IMU A;  3UK3 C;  4L8N A;  1PKP A;  2EOF A;  2LTS A;  4M30 A;  1QNT A;  3J80 C;  1UBD C;  1FKA E;  4TUG A;  2MKD A;  2RPC A;  5FLX C;  5AE1 A;  2LJH A;  5IWA E;  4R2Q A;  3LLH A;  3MHH C;  3HQ1 A;  1N3G A;  2V85 A;  4DR5 E;  3BBG A;  2EMI A;  2L92 A;  4R2S A;  4J8Z A;  2EPR A;  1GTK A;  4DV7 E;  2E1M A;  3EPL A;  3C6M A;  2DB2 A;  1N34 E;  2ENC A;  2YTJ A;  1X47 A;  2B9D A;  2EMF A;  2EPU A;  2DIX A;  3VYY A;  2EL5 A;  1BBO A;  2MC6 A;  3IWC A;  4ZYG A;  2KOU A;  4LF7 E;  4LFC E;  3KWR A;  5AAS A;  4NHR A;  4Q28 A;  2F4V E;  3ADI A;  2UXC E;  3AV0 A;  5F3W A;  2EPN A;  5IT9 C;  2LJU A;  1GZ6 A;  1X6H A;  3BID A;  2E5L E;  2LRS A;  3T1H E;  3JU0 A;  2A25 A;  2H36 X;  1O0W A;  2EOS A;  4DV6 E;  2YRM A;  2HHH E;  3VHT B;  1NEI A;  2RSI A;  4DR2 E;  3ADL A;  2DMI A;  2RQL A;  4BBY A;  1F2I G;  2N8X A;  2EL6 A;  2MKN A;  1T4O A;  3JAM C;  4X9J A;  2EMZ A;  1GQE A;  2YPN A;  5IV8 B;  3HPS A;  4DMI A;  3EPJ A; 
#chains in the Genus database with same CATH homology
 3BID A;  2K7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...