2K7IA

Solution nmr structure of protein atu0232 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att3. ontario center for structural proteomics target atc0223.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
MYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0339 protein Atu0232
publication title Solution structure of protein ATU0232 from Agrobacterium Tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07411 DUF1508 Domain of unknown function (DUF1508)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.160 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain YegP-like 2k7iA01
3BIDA 2K7IA
chains in the Genus database with same CATH superfamily
3HQ1A 2UUAE 5LL6R 2N3HA 1TN9A 5A6BD 4B3SE 4O5GA 3THNA 1YUIA 3ADGA 1AAYA 2B7VA 1T38A 1KJKA 3THOB 2YTPA 2EM8A 2LUQA 2JPAA 4DR5E 2HGHA 2BB8A 2LV2A 2CTDA 4BHBA 3H09A 2M1SA 2ELZA 2LVHA 5AE2A 4DV7E 4DV2E 4NZVA 4O24A 1GQEA 3M99B 2DMYA 2EN1A 3OTOE 1QNTA 4KZSA 2IHR1 1BBOA 1ZBTA 3T1YE 2EOYA 1TF3A 3DF6A 2WZOA 5BR8E 4Q28A 1YSAC 4WSGA 4DR3E 2RS7A 3FIGA 2UXDE 2EOJA 1X3CA 4OOGC 2VQFE 2E5LE 5AE3A 1I94E 2FGGA 4LF7E 1X6HA 4O43A 1WXRA 4RH8A 1X48A 1XNRE 4R2EA 3VYYA 1A1LA 2V83A 4MLQA 4IS1C 2YRKA 4P78A 2JWOA 2YSPA 5FLXC 1UN6B 2EZ6A 2EMHA 3JTZA 2H36X 4LF4E 2EOSA 2EPZA 3IWDA 2RQLA 1SFEA 4DV4E 2YWQA 1B69A 2V88A 3IWBA 4LF8E 2L3JA 1XNQE 3J81C 2EPKX 3JAMC 2NUGA 2EM2A 2CT1A 4NHRA 2EMWA 1JK2A 2EOQA 4M2ZA 4DR6E 1EH8A 5KL4A 2VF1A 4DKKA 4F6NA 1UBDC 2LT7A 2EM5A 3DJWA 3EPJA 2EORA 2LCEA 2L3CA 1T4NA 2DRPA 1HNWE 4LFAE 2EMCA 2M9AA 4JI7E 3T1HE 2RSMA 4DMIA 3ZOQB 5IWAE 2FV4B 4Q35B 1GTKA 1X6FA 4BC7A 5A6JA 2LE2A 1NCSA 1L4SA 3KWRA 4JI2E 4DR4E 3UK3C 1XMOE 5IT9C 2EOXA 1YPNA 4JI5E 1YYKA 1YUJA 2LJHA 2EL6A 2HHHE 2DLQA 2EOIA 4IJDA 2EPCA 2F8BA 1NEIA 2EMXA 3BIDA 2EMGA 1IQOA 1IQSA 2UXCE 2EN2A 1P47A 3HPZA 1IMUA 2B7TA 2EMIA 2VRDA 2EN6A 2PRTA 4GZNC 1N33E 1FJGE 3BBGA 2EMYA 4WX9A 2JP9A 2EOOA 1XMQE 1G2DC 1ZAAC 2K4VA 2YTGA 1N36E 4F54A 4BHCA 1BB8A 4DV1E 1WJPA 3HPSA 4WYQB 2L2MA 4HEIA 4WXDA 4ZYGA 2YZTA 3MHHC 3BGHA 2NUEA 4LTYA 4DR1E 1YYOA 2HJJA 2LTSA 1RC7A 2GPIA 1X6EA 3C6KA 4M30A 4DV0E 4X9JA 4F2JC 4RHBB 1EKZA 2N3GA 5LMUE 4DUZE 4JI0E 5A6AA 3ADLA 4BMJA 4F9CB 2ODRD 2L2KB 2LBSB 1YFHA 1N3GA 3C6MA 4AQYE 2E72A 2YTNA 1N34E 2Q8UA 4WFTA 2ELYA 4I8OA 2DB2A 2CSHA 4LFCE 4OX9E 4KWYA 3KZYA 3HTXA 2EPRA 2LTRA 2R1FA 2ENCA 2K7IA 3J7AG 2WBTA 4R2PA 2UUBE 2EOZA 1GZ6A 2JVAA 4L5NC 1N32E 2R76A 1JK1A 4BS9A 2UU9E 5AE1A 2YRHA 4BBYA 3MHSC 5T6JA 4F9BB 2EN8A 2V87A 2VE7C 2D9HA 2LMZA 2EOFA 5KL3A 3VYXA 4DR7E 2YTQA 3C4TA 1RMDA 4R8OA 3ADIA 2EP3A 3HXLA 3QG5C 1PJSA 5KL6A 2MKDA 2A25A 2L92A 1Z1BA 1ZU1A 4R2AA 2EPUA 4R2CA 4ZYHA 4HTGA 2EPMX 2NA2A 1X47A 2E1MA 3IWCA 3ADJA 4JI8E 4J8ZA 2EQ0A 2YRMA 4WXCA 4DV5E 1A1GA 4K0KE 4F9AB 2EN4A 3P1XA 4NXME 2V8QB 2I9IA 5AASA 3ECRA 2V89A 2G7HA 1ZBQA 2J7JA 1PJQA 4L8NA 2L6MA 1MEYC 2EM7A 3OMLA 5ADZA 2B3TB 4LF6E 4ZYEA 2LUPB 5LMNE 2MC5A 2YU8A 5A2QC 1T4LB 2KHXA 2JYAA 2JOBA 2KOUA 4R03A 2EPAA 4LFBE 5IXMB 1UILA 4M9VC 2WBUA 4LF5E 5TSEA 1TF6A 2F4VE 1EH6A 1J5EE 2B9DA 4NXNE 4FK5C 2RSIA 2EL4A 2EQ3A 4YHHE 2HC5A 4KHPE 2UXBE 4X62E 2LJUA 2WBSA 4R2SA 1F2IG 3K6QA 2EOEA 2EMBA 2EQ1A 2RTXA 4GEQB 4X64E 2JR1A 5F3WA 5KL5A 1O0WA 2DLKA 2DSYA 1PKPA 1T4OA 2EM3A 2YTIA 3AV0A 1A1JA 3LLHA 2EL5A 2EM0A 4TUIA 2NUFA 5AC4A 2EPLX 4P7DA 2MDRA 5A69A 2RS6A 2M7QA 3EPKA 2EMFA 3KZZA 5DNYA 2EOHA 3EQ1A 3J7Yp 1HNZE 1X49A 2EOMA 4X65E 1X5WA 2EWLA 3C4BA 5IV8B 4B3ME 2FTXB 1FKAE 2EMZA 2RPCA 4MLVA 4JYAE 4B3TE 2L8TA 2DMIA 2ODRC 2EM4A 2V85A 2JXPA 1MGTA 2EPOA 2I13A 4ZYDA 2EPXA 2BBGA 4JI3E 4TUGA 3J80C 4DR2E 2MC6A 1WRJA 4BCAA 1IBLE 4JI1E 3F6GA 4X8WA 4DV6E 1BBGA 2EJ4A 1HR0E 2YTFA 1A1KA 3EPHA 4WPYA 2EE8A 2EM6A 1AH5A 2GHFA 2YSOA 2YPNA 2YTJA 5CFFE 1G2FC 1SR9A 4R2DA 1WHNA 4GKKE 1A1FA 2V86A 2KONA 2EN7A 4JI6E 4LU9A 3MSWA 1PDAA 1YZ9A 1J26A 2JY9A 5KL7A 1QU6A 2YTDA 1EH7A 1RQ0A 5KL2A 4F6MA 3AUZA 2EN3A 1A1HA 5LLQA 2JOXA 4M0VA 2M4IA 3F6HA 4X66E 2MKNA 2N8XA 1WHQA 1YYWA 2GLIA 2YTEA 2ZM6E 2YT4A 5A6BA 4N4RB 4DUYE 4R2RA 4GKJE 3JU0A 2YU5A 1STUA 4LF9E 2EPNA 4YY3E 2L2NA 4B3RE 1LLMC 1T39A 2ADRA 2NABA 4DV3E 1UHZA 2YTOA 4JV5E 1HNXE 3VHTB 2EM9A 2CPNA 2WCC3 1IBME 1DGCA 5AC5A 2MDGA 1DQ3A 2VQEE 2DGCA 3L00A 1ZR9A 1KYQA 2LRSA 4JI4E 2DIXA 2EMLA 3VK6A 2EMKA 3EPLA 3BF2A 2L33A 1DI2A 1PJTA 2ENHA 4WSPA 1IBKE 2UUCE 2EMAA 1A1IA 5A6KA 3TQMA 2ENAA 4BC9A 2EPPA 3RMPA 2LO3A 4R2QA 4O4KA 3LMLA
chains in the Genus database with same CATH topology
3BIDA 2K7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BID A;  2K7I A; 
#chains in the Genus database with same CATH topology
 3HQ1 A;  2UUA E;  5LL6 R;  2N3H A;  1TN9 A;  5A6B D;  4B3S E;  4O5G A;  3THN A;  1YUI A;  3ADG A;  1AAY A;  2B7V A;  1T38 A;  1KJK A;  3THO B;  2YTP A;  2EM8 A;  2LUQ A;  2JPA A;  4DR5 E;  2HGH A;  2BB8 A;  2LV2 A;  2CTD A;  4BHB A;  3H09 A;  2M1S A;  2ELZ A;  2LVH A;  5AE2 A;  4DV7 E;  4DV2 E;  4NZV A;  4O24 A;  1GQE A;  3M99 B;  2DMY A;  2EN1 A;  3OTO E;  1QNT A;  4KZS A;  2IHR 1;  1BBO A;  1ZBT A;  3T1Y E;  2EOY A;  1TF3 A;  3DF6 A;  2WZO A;  5BR8 E;  4Q28 A;  1YSA C;  4WSG A;  4DR3 E;  2RS7 A;  3FIG A;  2UXD E;  2EOJ A;  1X3C A;  4OOG C;  2VQF E;  2E5L E;  5AE3 A;  1I94 E;  2FGG A;  4LF7 E;  1X6H A;  4O43 A;  1WXR A;  4RH8 A;  1X48 A;  1XNR E;  4R2E A;  3VYY A;  1A1L A;  2V83 A;  4MLQ A;  4IS1 C;  2YRK A;  4P78 A;  2JWO A;  2YSP A;  5FLX C;  1UN6 B;  2EZ6 A;  2EMH A;  3JTZ A;  2H36 X;  4LF4 E;  2EOS A;  2EPZ A;  3IWD A;  2RQL A;  1SFE A;  4DV4 E;  2YWQ A;  1B69 A;  2V88 A;  3IWB A;  4LF8 E;  2L3J A;  1XNQ E;  3J81 C;  2EPK X;  3JAM C;  2NUG A;  2EM2 A;  2CT1 A;  4NHR A;  2EMW A;  1JK2 A;  2EOQ A;  4M2Z A;  4DR6 E;  1EH8 A;  5KL4 A;  2VF1 A;  4DKK A;  4F6N A;  1UBD C;  2LT7 A;  2EM5 A;  3DJW A;  3EPJ A;  2EOR A;  2LCE A;  2L3C A;  1T4N A;  2DRP A;  1HNW E;  4LFA E;  2EMC A;  2M9A A;  4JI7 E;  3T1H E;  2RSM A;  4DMI A;  3ZOQ B;  5IWA E;  2FV4 B;  4Q35 B;  1GTK A;  1X6F A;  4BC7 A;  5A6J A;  2LE2 A;  1NCS A;  1L4S A;  3KWR A;  4JI2 E;  4DR4 E;  3UK3 C;  1XMO E;  5IT9 C;  2EOX A;  1YPN A;  4JI5 E;  1YYK A;  1YUJ A;  2LJH A;  2EL6 A;  2HHH E;  2DLQ A;  2EOI A;  4IJD A;  2EPC A;  2F8B A;  1NEI A;  2EMX A;  3BID A;  2EMG A;  1IQO A;  1IQS A;  2UXC E;  2EN2 A;  1P47 A;  3HPZ A;  1IMU A;  2B7T A;  2EMI A;  2VRD A;  2EN6 A;  2PRT A;  4GZN C;  1N33 E;  1FJG E;  3BBG A;  2EMY A;  4WX9 A;  2JP9 A;  2EOO A;  1XMQ E;  1G2D C;  1ZAA C;  2K4V A;  2YTG A;  1N36 E;  4F54 A;  4BHC A;  1BB8 A;  4DV1 E;  1WJP A;  3HPS A;  4WYQ B;  2L2M A;  4HEI A;  4WXD A;  4ZYG A;  2YZT A;  3MHH C;  3BGH A;  2NUE A;  4LTY A;  4DR1 E;  1YYO A;  2HJJ A;  2LTS A;  1RC7 A;  2GPI A;  1X6E A;  3C6K A;  4M30 A;  4DV0 E;  4X9J A;  4F2J C;  4RHB B;  1EKZ A;  2N3G A;  5LMU E;  4DUZ E;  4JI0 E;  5A6A A;  3ADL A;  4BMJ A;  4F9C B;  2ODR D;  2L2K B;  2LBS B;  1YFH A;  1N3G A;  3C6M A;  4AQY E;  2E72 A;  2YTN A;  1N34 E;  2Q8U A;  4WFT A;  2ELY A;  4I8O A;  2DB2 A;  2CSH A;  4LFC E;  4OX9 E;  4KWY A;  3KZY A;  3HTX A;  2EPR A;  2LTR A;  2R1F A;  2ENC A;  2K7I A;  3J7A G;  2WBT A;  4R2P A;  2UUB E;  2EOZ A;  1GZ6 A;  2JVA A;  4L5N C;  1N32 E;  2R76 A;  1JK1 A;  4BS9 A;  2UU9 E;  5AE1 A;  2YRH A;  4BBY A;  3MHS C;  5T6J A;  4F9B B;  2EN8 A;  2V87 A;  2VE7 C;  2D9H A;  2LMZ A;  2EOF A;  5KL3 A;  3VYX A;  4DR7 E;  2YTQ A;  3C4T A;  1RMD A;  4R8O A;  3ADI A;  2EP3 A;  3HXL A;  3QG5 C;  1PJS A;  5KL6 A;  2MKD A;  2A25 A;  2L92 A;  1Z1B A;  1ZU1 A;  4R2A A;  2EPU A;  4R2C A;  4ZYH A;  4HTG A;  2EPM X;  2NA2 A;  1X47 A;  2E1M A;  3IWC A;  3ADJ A;  4JI8 E;  4J8Z A;  2EQ0 A;  2YRM A;  4WXC A;  4DV5 E;  1A1G A;  4K0K E;  4F9A B;  2EN4 A;  3P1X A;  4NXM E;  2V8Q B;  2I9I A;  5AAS A;  3ECR A;  2V89 A;  2G7H A;  1ZBQ A;  2J7J A;  1PJQ A;  4L8N A;  2L6M A;  1MEY C;  2EM7 A;  3OML A;  5ADZ A;  2B3T B;  4LF6 E;  4ZYE A;  2LUP B;  5LMN E;  2MC5 A;  2YU8 A;  5A2Q C;  1T4L B;  2KHX A;  2JYA A;  2JOB A;  2KOU A;  4R03 A;  2EPA A;  4LFB E;  5IXM B;  1UIL A;  4M9V C;  2WBU A;  4LF5 E;  5TSE A;  1TF6 A;  2F4V E;  1EH6 A;  1J5E E;  2B9D A;  4NXN E;  4FK5 C;  2RSI A;  2EL4 A;  2EQ3 A;  4YHH E;  2HC5 A;  4KHP E;  2UXB E;  4X62 E;  2LJU A;  2WBS A;  4R2S A;  1F2I G;  3K6Q A;  2EOE A;  2EMB A;  2EQ1 A;  2RTX A;  4GEQ B;  4X64 E;  2JR1 A;  5F3W A;  5KL5 A;  1O0W A;  2DLK A;  2DSY A;  1PKP A;  1T4O A;  2EM3 A;  2YTI A;  3AV0 A;  1A1J A;  3LLH A;  2EL5 A;  2EM0 A;  4TUI A;  2NUF A;  5AC4 A;  2EPL X;  4P7D A;  2MDR A;  5A69 A;  2RS6 A;  2M7Q A;  3EPK A;  2EMF A;  3KZZ A;  5DNY A;  2EOH A;  3EQ1 A;  3J7Y p;  1HNZ E;  1X49 A;  2EOM A;  4X65 E;  1X5W A;  2EWL A;  3C4B A;  5IV8 B;  4B3M E;  2FTX B;  1FKA E;  2EMZ A;  2RPC A;  4MLV A;  4JYA E;  4B3T E;  2L8T A;  2DMI A;  2ODR C;  2EM4 A;  2V85 A;  2JXP A;  1MGT A;  2EPO A;  2I13 A;  4ZYD A;  2EPX A;  2BBG A;  4JI3 E;  4TUG A;  3J80 C;  4DR2 E;  2MC6 A;  1WRJ A;  4BCA A;  1IBL E;  4JI1 E;  3F6G A;  4X8W A;  4DV6 E;  1BBG A;  2EJ4 A;  1HR0 E;  2YTF A;  1A1K A;  3EPH A;  4WPY A;  2EE8 A;  2EM6 A;  1AH5 A;  2GHF A;  2YSO A;  2YPN A;  2YTJ A;  5CFF E;  1G2F C;  1SR9 A;  4R2D A;  1WHN A;  4GKK E;  1A1F A;  2V86 A;  2KON A;  2EN7 A;  4JI6 E;  4LU9 A;  3MSW A;  1PDA A;  1YZ9 A;  1J26 A;  2JY9 A;  5KL7 A;  1QU6 A;  2YTD A;  1EH7 A;  1RQ0 A;  5KL2 A;  4F6M A;  3AUZ A;  2EN3 A;  1A1H A;  5LLQ A;  2JOX A;  4M0V A;  2M4I A;  3F6H A;  4X66 E;  2MKN A;  2N8X A;  1WHQ A;  1YYW A;  2GLI A;  2YTE A;  2ZM6 E;  2YT4 A;  5A6B A;  4N4R B;  4DUY E;  4R2R A;  4GKJ E;  3JU0 A;  2YU5 A;  1STU A;  4LF9 E;  2EPN A;  4YY3 E;  2L2N A;  4B3R E;  1LLM C;  1T39 A;  2ADR A;  2NAB A;  4DV3 E;  1UHZ A;  2YTO A;  4JV5 E;  1HNX E;  3VHT B;  2EM9 A;  2CPN A;  2WCC 3;  1IBM E;  1DGC A;  5AC5 A;  2MDG A;  1DQ3 A;  2VQE E;  2DGC A;  3L00 A;  1ZR9 A;  1KYQ A;  2LRS A;  4JI4 E;  2DIX A;  2EML A;  3VK6 A;  2EMK A;  3EPL A;  3BF2 A;  2L33 A;  1DI2 A;  1PJT A;  2ENH A;  4WSP A;  1IBK E;  2UUC E;  2EMA A;  1A1I A;  5A6K A;  3TQM A;  2ENA A;  4BC9 A;  2EPP A;  3RMP A;  2LO3 A;  4R2Q A;  4O4K A;  3LML A; 
#chains in the Genus database with same CATH homology
 3BID A;  2K7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...