2K7IA

Solution nmr structure of protein atu0232 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att3. ontario center for structural proteomics target atc0223.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
MYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0339 protein Atu0232
publication title Solution structure of protein ATU0232 from Agrobacterium Tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07411 DUF1508 Domain of unknown function (DUF1508)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.160 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain YegP-like 2k7iA01
3BIDA 2K7IA
chains in the Genus database with same CATH superfamily
2EOJA 5KL7A 2LTRA 5AE2A 2LBSB 4DV5E 4OX9E 2B3TB 2EMLA 4LF8E 3MHSC 1GQEA 1EH6A 2DMYA 2DSYA 4R2QA 4JI8E 3LMLA 1QNTA 4DV3E 2DGCA 1N34E 4ZYDA 5LL6R 2JVAA 4JI5E 2EMWA 4BCAA 2JWOA 1ZBQA 1GZ6A 3FIGA 4DR3E 3THNA 2JPAA 2NUEA 5A6BD 4LF9E 1XNQE 1A1KA 3TQMA 2YTJA 4R03A 4R2DA 2MKDA 2EPAA 2LMZA 2EL6A 4X64E 4YY3E 4WYQB 3BBGA 2ELYA 1T38A 1YFHA 1Z1BA 3RMPA 1MEYC 1KJKA 1IBKE 3EPLA 2V83A 3KZZA 4DV1E 2MDRA 2EPZA 1JK1A 2DIXA 2EM6A 3L00A 2RSIA 5LMUE 2YWQA 2DLKA 1EH7A 3ADGA 1N3GA 2YRMA 1F2IG 5CFFE 4JI0E 4R2EA 4JI3E 4F54A 4F9BB 2EPLX 4BC9A 2FV4B 2ENCA 3THOB 2ADRA 2RQLA 3JTZA 3LLHA 4B3SE 2V88A 4O4KA 2MC6A 2R1FA 3OMLA 4HTGA 4KWYA 4DV6E 2D9HA 1UN6B 1IMUA 2V89A 2CSHA 4TUGA 1RQ0A 1T4NA 4GZNC 1T4OA 4AQYE 4I8OA 2V8QB 2EN4A 1A1JA 2EQ1A 5AE3A 3M99B 2R76A 4LF7E 2EOHA 2L6MA 4LFCE 1MGTA 1PJSA 3C6MA 2JXPA 4DR1E 2KOUA 1XMOE 1AAYA 2Q8UA 4M2ZA 2NABA 5A6KA 3ADLA 4B3ME 3KZYA 2EOOA 4X62E 1PJQA 1YZ9A 1HNZE 1X6HA 4OOGC 2YTOA 4O43A 4X66E 2LT7A 1WXRA 2ENHA 4R2RA 3VYXA 2VQEE 2JY9A 2EN2A 2LRSA 3IWBA 4JYAE 2RPCA 4Q28A 2G7HA 2L2MA 2V87A 5AE1A 2H36X 2DB2A 2ODRC 2UXBE 2WBUA 2J7JA 2YPNA 3EPKA 3DJWA 5KL2A 2L8TA 3P1XA 1LLMC 2VQFE 2YTIA 2N3HA 3K6QA 3J7AG 2EPPA 2DMIA 2EMHA 2NA2A 5BR8E 1J26A 1WHNA 4WFTA 4M9VC 2EOZA 2L92A 1O0WA 1XMQE 2LUPB 5LMNE 4NXNE 1L4SA 1WHQA 1I94E 2EQ3A 2FGGA 4ZYGA 4ZYHA 4WSGA 2F8BA 3F6HA 2DRPA 4IJDA 2UUCE 2WBTA 3H09A 1IQOA 2EM9A 2ELZA 4GKKE 1BBGA 2HC5A 1DQ3A 3ZOQB 4DUZE 5A6AA 2EJ4A 5AASA 2EQ0A 1QU6A 3T1YE 5F3WA 2EM3A 4F9AB 5ADZA 2UUAE 4DV4E 2EM5A 2M4IA 2EPMX 4NZVA 4DR5E 4R2PA 1T4LB 4X65E 1X48A 2RSMA 5TSEA 1KYQA 5AC4A 4DV2E 2EMBA 4F6NA 2EORA 4LFBE 2V85A 4DUYE 2UU9E 2LV2A 2A25A 2EN8A 1X5WA 1J5EE 4X8WA 3EPHA 2YT4A 2EM7A 2YSOA 1A1IA 3J80C 1N36E 5KL4A 2LVHA 3ADJA 1A1LA 2JP9A 4L8NA 4BS9A 2F4VE 1IQSA 2JOBA 2M9AA 4JI4E 3ADIA 2EOQA 5IXMB 2EMAA 1PKPA 2EMXA 4BBYA 4DV0E 2UXCE 5A6JA 4JI1E 2KONA 3J7Yp 2JR1A 5A2QC 2EOYA 2YTNA 2I13A 3AUZA 2YTEA 1X6EA 4P7DA 2EMZA 2EPXA 2EMIA 2EPNA 2ENAA 2BBGA 3HQ1A 2EZ6A 4P78A 4TUIA 2YTQA 4NXME 2LJUA 2EN6A 3HPZA 2EOXA 4JI7E 4R2AA 1NEIA 2EMCA 2KHXA 1A1FA 2HJJA 2YU5A 2E5LE 2EOIA 4LFAE 3HPSA 2DLQA 4M0VA 1G2DC 4R8OA 2EOSA 2MKNA 4K0KE 2EP3A 4BMJA 4B3TE 3C4TA 1ZBTA 1SFEA 3VYYA 4JI6E 2LJHA 4F2JC 2L2KB 2GLIA 4DR4E 2EM8A 2EPRA 2NUGA 1RC7A 2V86A 4WXDA 2EL4A 1FJGE 3IWDA 2L3JA 1TN9A 2M1SA 2EPOA 1YUJA 4X9JA 1EH8A 1B69A 4BHCA 2EPUA 2IHR1 2L3CA 3UK3C 2FTXB 2EWLA 5A69A 2PRTA 1WJPA 1YYWA 3HTXA 2EMKA 3QG5C 4BC7A 1JK2A 2E1MA 2LCEA 2EOMA 4YHHE 4HEIA 3OTOE 2EMYA 1YPNA 2YTPA 1DI2A 3C6KA 2WZOA 3IWCA 1HNXE 2YTFA 2EN1A 2HHHE 4WSPA 3F6GA 5AC5A 1XNRE 4FK5C 1X49A 2LE2A 4J8ZA 2LUQA 1HNWE 5FLXC 2RS7A 2WCC3 4LF5E 3J81C 2EMGA 2WBSA 5LLQA 4F6MA 4LF4E 2EPCA 4MLVA 1ZU1A 2B9DA 4F9CB 1YUIA 3AV0A 2LTSA 4RHBB 3EQ1A 4L5NC 3KWRA 2CPNA 1P47A 3BGHA 1FKAE 2YTDA 1UILA 3BF2A 4BHBA 4WPYA 1ZR9A 2M7QA 1DGCA 1STUA 3JU0A 5KL5A 4O24A 3T1HE 2YTGA 3DF6A 1IBLE 2UXDE 4Q35B 4R2SA 1YSAC 1UBDC 2UUBE 3VK6A 5KL3A 4GKJE 2EE8A 1SR9A 1EKZA 2LO3A 2L2NA 1GTKA 3MSWA 4GEQB 1NCSA 2GPIA 4O5GA 1TF6A 2NUFA 5DNYA 4KZSA 2EOEA 1N33E 5A6BA 3ECRA 2YRKA 1PDAA 1X6FA 1A1HA 4DR6E 2YZTA 3JAMC 2L33A 5IWAE 4LF6E 2JOXA 4NHRA 4DR7E 2CT1A 3EPJA 3BIDA 2B7VA 4N4RB 1G2FC 2EMFA 1UHZA 4JI2E 4DMIA 1IBME 1BB8A 1TF3A 1YYKA 4B3RE 4WX9A 1HR0E 4DKKA 2N3GA 1A1GA 1WRJA 2MDGA 2RS6A 2YSPA 5KL6A 4RH8A 2BB8A 2ZM6E 2EL5A 4KHPE 3C4BA 2EM4A 2VE7C 1N32E 4IS1C 4LTYA 4M30A 4R2CA 5T6JA 4ZYEA 2EM0A 4LU9A 5IT9C 1RMDA 2K7IA 2E72A 1T39A 3VHTB 5IV8B 2HGHA 2N8XA 2RTXA 2B7TA 2EOFA 2YRHA 4DR2E 2K4VA 3HXLA 2I9IA 1BBOA 3MHHC 4MLQA 4DV7E 2CTDA 2VRDA 2EPKX 1X3CA 2YU8A 2ODRD 1PJTA 1ZAAC 1YYOA 1X47A 4JV5E 2JYAA 1AH5A 2MC5A 2VF1A 2EN3A 2EN7A 2EM2A 4WXCA 2GHFA
chains in the Genus database with same CATH topology
3BIDA 2K7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BID A;  2K7I A; 
#chains in the Genus database with same CATH topology
 2EOJ A;  5KL7 A;  2LTR A;  5AE2 A;  2LBS B;  4DV5 E;  4OX9 E;  2B3T B;  2EML A;  4LF8 E;  3MHS C;  1GQE A;  1EH6 A;  2DMY A;  2DSY A;  4R2Q A;  4JI8 E;  3LML A;  1QNT A;  4DV3 E;  2DGC A;  1N34 E;  4ZYD A;  5LL6 R;  2JVA A;  4JI5 E;  2EMW A;  4BCA A;  2JWO A;  1ZBQ A;  1GZ6 A;  3FIG A;  4DR3 E;  3THN A;  2JPA A;  2NUE A;  5A6B D;  4LF9 E;  1XNQ E;  1A1K A;  3TQM A;  2YTJ A;  4R03 A;  4R2D A;  2MKD A;  2EPA A;  2LMZ A;  2EL6 A;  4X64 E;  4YY3 E;  4WYQ B;  3BBG A;  2ELY A;  1T38 A;  1YFH A;  1Z1B A;  3RMP A;  1MEY C;  1KJK A;  1IBK E;  3EPL A;  2V83 A;  3KZZ A;  4DV1 E;  2MDR A;  2EPZ A;  1JK1 A;  2DIX A;  2EM6 A;  3L00 A;  2RSI A;  5LMU E;  2YWQ A;  2DLK A;  1EH7 A;  3ADG A;  1N3G A;  2YRM A;  1F2I G;  5CFF E;  4JI0 E;  4R2E A;  4JI3 E;  4F54 A;  4F9B B;  2EPL X;  4BC9 A;  2FV4 B;  2ENC A;  3THO B;  2ADR A;  2RQL A;  3JTZ A;  3LLH A;  4B3S E;  2V88 A;  4O4K A;  2MC6 A;  2R1F A;  3OML A;  4HTG A;  4KWY A;  4DV6 E;  2D9H A;  1UN6 B;  1IMU A;  2V89 A;  2CSH A;  4TUG A;  1RQ0 A;  1T4N A;  4GZN C;  1T4O A;  4AQY E;  4I8O A;  2V8Q B;  2EN4 A;  1A1J A;  2EQ1 A;  5AE3 A;  3M99 B;  2R76 A;  4LF7 E;  2EOH A;  2L6M A;  4LFC E;  1MGT A;  1PJS A;  3C6M A;  2JXP A;  4DR1 E;  2KOU A;  1XMO E;  1AAY A;  2Q8U A;  4M2Z A;  2NAB A;  5A6K A;  3ADL A;  4B3M E;  3KZY A;  2EOO A;  4X62 E;  1PJQ A;  1YZ9 A;  1HNZ E;  1X6H A;  4OOG C;  2YTO A;  4O43 A;  4X66 E;  2LT7 A;  1WXR A;  2ENH A;  4R2R A;  3VYX A;  2VQE E;  2JY9 A;  2EN2 A;  2LRS A;  3IWB A;  4JYA E;  2RPC A;  4Q28 A;  2G7H A;  2L2M A;  2V87 A;  5AE1 A;  2H36 X;  2DB2 A;  2ODR C;  2UXB E;  2WBU A;  2J7J A;  2YPN A;  3EPK A;  3DJW A;  5KL2 A;  2L8T A;  3P1X A;  1LLM C;  2VQF E;  2YTI A;  2N3H A;  3K6Q A;  3J7A G;  2EPP A;  2DMI A;  2EMH A;  2NA2 A;  5BR8 E;  1J26 A;  1WHN A;  4WFT A;  4M9V C;  2EOZ A;  2L92 A;  1O0W A;  1XMQ E;  2LUP B;  5LMN E;  4NXN E;  1L4S A;  1WHQ A;  1I94 E;  2EQ3 A;  2FGG A;  4ZYG A;  4ZYH A;  4WSG A;  2F8B A;  3F6H A;  2DRP A;  4IJD A;  2UUC E;  2WBT A;  3H09 A;  1IQO A;  2EM9 A;  2ELZ A;  4GKK E;  1BBG A;  2HC5 A;  1DQ3 A;  3ZOQ B;  4DUZ E;  5A6A A;  2EJ4 A;  5AAS A;  2EQ0 A;  1QU6 A;  3T1Y E;  5F3W A;  2EM3 A;  4F9A B;  5ADZ A;  2UUA E;  4DV4 E;  2EM5 A;  2M4I A;  2EPM X;  4NZV A;  4DR5 E;  4R2P A;  1T4L B;  4X65 E;  1X48 A;  2RSM A;  5TSE A;  1KYQ A;  5AC4 A;  4DV2 E;  2EMB A;  4F6N A;  2EOR A;  4LFB E;  2V85 A;  4DUY E;  2UU9 E;  2LV2 A;  2A25 A;  2EN8 A;  1X5W A;  1J5E E;  4X8W A;  3EPH A;  2YT4 A;  2EM7 A;  2YSO A;  1A1I A;  3J80 C;  1N36 E;  5KL4 A;  2LVH A;  3ADJ A;  1A1L A;  2JP9 A;  4L8N A;  4BS9 A;  2F4V E;  1IQS A;  2JOB A;  2M9A A;  4JI4 E;  3ADI A;  2EOQ A;  5IXM B;  2EMA A;  1PKP A;  2EMX A;  4BBY A;  4DV0 E;  2UXC E;  5A6J A;  4JI1 E;  2KON A;  3J7Y p;  2JR1 A;  5A2Q C;  2EOY A;  2YTN A;  2I13 A;  3AUZ A;  2YTE A;  1X6E A;  4P7D A;  2EMZ A;  2EPX A;  2EMI A;  2EPN A;  2ENA A;  2BBG A;  3HQ1 A;  2EZ6 A;  4P78 A;  4TUI A;  2YTQ A;  4NXM E;  2LJU A;  2EN6 A;  3HPZ A;  2EOX A;  4JI7 E;  4R2A A;  1NEI A;  2EMC A;  2KHX A;  1A1F A;  2HJJ A;  2YU5 A;  2E5L E;  2EOI A;  4LFA E;  3HPS A;  2DLQ A;  4M0V A;  1G2D C;  4R8O A;  2EOS A;  2MKN A;  4K0K E;  2EP3 A;  4BMJ A;  4B3T E;  3C4T A;  1ZBT A;  1SFE A;  3VYY A;  4JI6 E;  2LJH A;  4F2J C;  2L2K B;  2GLI A;  4DR4 E;  2EM8 A;  2EPR A;  2NUG A;  1RC7 A;  2V86 A;  4WXD A;  2EL4 A;  1FJG E;  3IWD A;  2L3J A;  1TN9 A;  2M1S A;  2EPO A;  1YUJ A;  4X9J A;  1EH8 A;  1B69 A;  4BHC A;  2EPU A;  2IHR 1;  2L3C A;  3UK3 C;  2FTX B;  2EWL A;  5A69 A;  2PRT A;  1WJP A;  1YYW A;  3HTX A;  2EMK A;  3QG5 C;  4BC7 A;  1JK2 A;  2E1M A;  2LCE A;  2EOM A;  4YHH E;  4HEI A;  3OTO E;  2EMY A;  1YPN A;  2YTP A;  1DI2 A;  3C6K A;  2WZO A;  3IWC A;  1HNX E;  2YTF A;  2EN1 A;  2HHH E;  4WSP A;  3F6G A;  5AC5 A;  1XNR E;  4FK5 C;  1X49 A;  2LE2 A;  4J8Z A;  2LUQ A;  1HNW E;  5FLX C;  2RS7 A;  2WCC 3;  4LF5 E;  3J81 C;  2EMG A;  2WBS A;  5LLQ A;  4F6M A;  4LF4 E;  2EPC A;  4MLV A;  1ZU1 A;  2B9D A;  4F9C B;  1YUI A;  3AV0 A;  2LTS A;  4RHB B;  3EQ1 A;  4L5N C;  3KWR A;  2CPN A;  1P47 A;  3BGH A;  1FKA E;  2YTD A;  1UIL A;  3BF2 A;  4BHB A;  4WPY A;  1ZR9 A;  2M7Q A;  1DGC A;  1STU A;  3JU0 A;  5KL5 A;  4O24 A;  3T1H E;  2YTG A;  3DF6 A;  1IBL E;  2UXD E;  4Q35 B;  4R2S A;  1YSA C;  1UBD C;  2UUB E;  3VK6 A;  5KL3 A;  4GKJ E;  2EE8 A;  1SR9 A;  1EKZ A;  2LO3 A;  2L2N A;  1GTK A;  3MSW A;  4GEQ B;  1NCS A;  2GPI A;  4O5G A;  1TF6 A;  2NUF A;  5DNY A;  4KZS A;  2EOE A;  1N33 E;  5A6B A;  3ECR A;  2YRK A;  1PDA A;  1X6F A;  1A1H A;  4DR6 E;  2YZT A;  3JAM C;  2L33 A;  5IWA E;  4LF6 E;  2JOX A;  4NHR A;  4DR7 E;  2CT1 A;  3EPJ A;  3BID A;  2B7V A;  4N4R B;  1G2F C;  2EMF A;  1UHZ A;  4JI2 E;  4DMI A;  1IBM E;  1BB8 A;  1TF3 A;  1YYK A;  4B3R E;  4WX9 A;  1HR0 E;  4DKK A;  2N3G A;  1A1G A;  1WRJ A;  2MDG A;  2RS6 A;  2YSP A;  5KL6 A;  4RH8 A;  2BB8 A;  2ZM6 E;  2EL5 A;  4KHP E;  3C4B A;  2EM4 A;  2VE7 C;  1N32 E;  4IS1 C;  4LTY A;  4M30 A;  4R2C A;  5T6J A;  4ZYE A;  2EM0 A;  4LU9 A;  5IT9 C;  1RMD A;  2K7I A;  2E72 A;  1T39 A;  3VHT B;  5IV8 B;  2HGH A;  2N8X A;  2RTX A;  2B7T A;  2EOF A;  2YRH A;  4DR2 E;  2K4V A;  3HXL A;  2I9I A;  1BBO A;  3MHH C;  4MLQ A;  4DV7 E;  2CTD A;  2VRD A;  2EPK X;  1X3C A;  2YU8 A;  2ODR D;  1PJT A;  1ZAA C;  1YYO A;  1X47 A;  4JV5 E;  2JYA A;  1AH5 A;  2MC5 A;  2VF1 A;  2EN3 A;  2EN7 A;  2EM2 A;  4WXC A;  2GHF A; 
#chains in the Genus database with same CATH homology
 3BID A;  2K7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...