2K7IA

Solution nmr structure of protein atu0232 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att3. ontario center for structural proteomics target atc0223.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
MYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVDLTTMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0339 protein Atu0232
publication title Solution structure of protein ATU0232 from Agrobacterium Tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07411 DUF1508 Domain of unknown function (DUF1508)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.160 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain YegP-like 2k7iA01
2K7IA 3BIDA
chains in the Genus database with same CATH superfamily
4DV4E 4JYAE 3VK6A 3F6GA 3AV0A 2JR1A 4LF7E 2B9DA 4DR4E 2YSPA 5KL2A 1WHNA 4X9JA 1N32E 2L2KB 4JI1E 2K7IA 5A6BD 5DNYA 2JPAA 4WSGA 2EPUA 5A6KA 3HXLA 4DV0E 2LUQA 2YRKA 4F9AB 4Q28A 1A1HA 2YU8A 4F6MA 2EMIA 3LMLA 5A6BA 4GZNC 4ZYHA 2JOBA 4J8ZA 2V87A 2EJ4A 1PJSA 2EM3A 2L8TA 2YWQA 4RH8A 1YFHA 4DR2E 3JAMC 4N4RB 2NA2A 5AE1A 3ADLA 2I9IA 2YTPA 5ADZA 2MC6A 2EMYA 4Q35B 2EOQA 4RHBB 4GKKE 2VF1A 4DR1E 4P7DA 2DGCA 2EMFA 4JI5E 2MKDA 4R2AA 1ZR9A 2EMCA 2V85A 1ZBQA 1KJKA 1A1FA 1SFEA 3KWRA 2EPKX 1EH6A 2ENCA 2RS7A 2ELZA 4X65E 1N34E 2EPOA 4WXDA 3C6KA 4F2JC 3VYXA 4WXCA 4DV2E 2YTOA 4L8NA 2FTXB 1DGCA 3MSWA 2EMWA 2LO3A 1DI2A 2UXDE 3OTOE 4DR3E 2VE7C 4B3SE 2EMHA 2L3JA 4JI2E 5AC5A 4HTGA 1T38A 2LTRA 4BS9A 5AE2A 2UXCE 3C4BA 1F2IG 1XMQE 1EKZA 2BB8A 1WJPA 4B3TE 2EE8A 4ZYDA 2LBSB 2Q8UA 5KL5A 4R2SA 4DR5E 4JI7E 2B7TA 5IV8B 2V88A 2J7JA 4LU9A 2EOOA 2F8BA 3KZYA 4LFCE 2CSHA 3HQ1A 2EOSA 2CT1A 5TSEA 5LL6R 3THNA 1PDAA 4DUYE 2D9HA 2JVAA 1TF6A 2EP3A 1EH7A 1XNQE 1HR0E 2ZM6E 2EM5A 2EMZA 2E72A 2EZ6A 4WSPA 2MDGA 1XMOE 5LLQA 2EN4A 1BBOA 1KYQA 2DB2A 3M99B 1LLMC 2YSOA 4HEIA 5AC4A 4F9BB 2M4IA 4LF9E 1A1IA 2YRHA 1I94E 1WRJA 4O5GA 2EQ1A 5FLXC 4WYQB 1YYWA 3C4TA 2WCC3 1PJQA 1RMDA 3DF6A 2ODRD 2N3HA 3T1YE 2MDRA 2RSIA 3H09A 4R2EA 1T4OA 2DRPA 2JOXA 4LFBE 2B3TB 2EPCA 1N33E 1UILA 1N36E 2RSMA 4DV6E 2EOIA 4NXNE 2ELYA 2LT7A 2YU5A 3VYYA 4LFAE 1WHQA 4WX9A 4AQYE 2JP9A 1X47A 2PRTA 5KL7A 2RS6A 2EM0A 5T6JA 2VQFE 5A6AA 1L4SA 2EPNA 3BF2A 1A1JA 4BMJA 2EPPA 1FJGE 4IS1C 2YRMA 2EOEA 2UUBE 5LMUE 2WZOA 3MHSC 3BBGA 1T4LB 4B3ME 1J26A 2EOXA 4DV5E 2EQ0A 2EM7A 4LF4E 1NCSA 3J80C 1G2DC 4YHHE 2JXPA 3KZZA 2GHFA 2LTSA 2NUFA 1X6HA 1PJTA 2YTFA 2DLKA 2LRSA 2R1FA 5KL4A 2EMAA 3ADIA 3RMPA 1IBME 4K0KE 2F4VE 2L3CA 4B3RE 4I8OA 1XNRE 2EN2A 1DQ3A 5BR8E 1IQOA 2V86A 3ZOQB 1J5EE 4O43A 1X5WA 1BBGA 4WFTA 1TN9A 1YUJA 3P1XA 4R2CA 4X8WA 1YZ9A 2EMKA 2CPNA 1FKAE 5AE3A 2UXBE 4BBYA 4NXME 2HGHA 3EQ1A 4M9VC 2EMBA 2WBSA 2LMZA 2LJUA 3IWCA 4R8OA 4X64E 2MC5A 2EOMA 3K6QA 5KL6A 2EOYA 2L6MA 2EN7A 4JI3E 4TUGA 2NUGA 3L00A 1MGTA 4KZSA 1B69A 3VHTB 2R76A 2EM8A 2ODRC 1IBKE 1A1KA 4X66E 4TUIA 1AH5A 2LVHA 1EH8A 2MKNA 2EM2A 2EPXA 2JWOA 2EN3A 1QNTA 1ZBTA 2WBUA 2LJHA 2YTGA 2EMGA 3DJWA 1GQEA 2V83A 3UK3C 4MLQA 2ADRA 2EN8A 3LLHA 1Z1BA 2JYAA 1WXRA 1HNWE 2EPAA 3EPLA 2H36X 2E1MA 4BCAA 2GPIA 1TF3A 2V8QB 1GZ6A 2VQEE 2N8XA 3OMLA 2EWLA 3QG5C 2M7QA 1UHZA 2YTJA 2JY9A 4R2DA 2B7VA 2EL5A 5LMNE 1JK1A 4M2ZA 2EPLX 2VRDA 1NEIA 4JI8E 3HPZA 5CFFE 5IXMB 3BIDA 1A1GA 1PKPA 2UU9E 3JTZA 2HJJA 3HTXA 5IT9C 5F3WA 2M1SA 1X3CA 1X48A 2KHXA 1IQSA 5AASA 5IWAE 4GEQB 4DV3E 3THOB 2DIXA 4NHRA 2NABA 1IMUA 2IHR1 4R2QA 1YUIA 4BC7A 2EL4A 2CTDA 4ZYGA 2LUPB 2LE2A 1T39A 1RQ0A 1BB8A 1X6EA 2K4VA 4FK5C 2G7HA 3FIGA 2LCEA 2YTQA 3HPSA 1IBLE 2E5LE 2ENHA 1G2FC 4DR7E 3EPHA 2EOHA 2EM9A 2NUEA 5KL3A 1P47A 2I13A 2EMXA 4JV5E 2EPZA 4IJDA 4JI4E 4O24A 2EM4A 3IWDA 4GKJE 1HNXE 4DR6E 2A25A 1O0WA 3TQMA 3ADGA 1JK2A 3BGHA 4R2RA 4JI0E 2FV4B 2HHHE 2YPNA 1ZAAC 4M0VA 2EOFA 4KWYA 1UN6B 2N3GA 4P78A 2HC5A 2KOUA 3F6HA 2L2NA 3ADJA 2EORA 1SR9A 2EN6A 1A1LA 4R2PA 4LF6E 4LTYA 4KHPE 1ZU1A 2L92A 5A69A 1X49A 2ENAA 4DV7E 1X6FA 2YTDA 4F6NA 3J7Yp 2EPRA 3T1HE 3J7AG 3AUZA 2EN1A 4M30A 1RC7A 4MLVA 2YTIA 2M9AA 4F9CB 1GTKA 4DV1E 2WBTA 4DUZE 2DMIA 1QU6A 5A6JA 4BHCA 1MEYC 1YPNA 2EOJA 4DMIA 4YY3E 2BBGA 2YTNA 2EOZA 4LF5E 4X62E 4WPYA 2DLQA 3EPJA 2EPMX 4OX9E 2V89A 4JI6E 4BHBA 3JU0A 2LV2A 4DKKA 2UUCE 2EMLA 2YZTA 2GLIA 3IWBA 2KONA 2L33A 2EM6A 1STUA 4OOGC 4L5NC 4LF8E 2YTEA 2EQ3A 2FGGA 3C6MA 4O4KA 3MHHC 2RPCA 4ZYEA 1YSAC 2L2MA 4BC9A 1N3GA 3ECRA 2RQLA 4NZVA 2YT4A 2EL6A 1AAYA 1UBDC 2DSYA 5A2QC 1HNZE 1YYKA 4R03A 3J81C 1YYOA 2RTXA 3EPKA 2DMYA 2UUAE 4F54A 1T4NA
chains in the Genus database with same CATH topology
2K7IA 3BIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7I A;  3BID A; 
#chains in the Genus database with same CATH topology
 4DV4 E;  4JYA E;  3VK6 A;  3F6G A;  3AV0 A;  2JR1 A;  4LF7 E;  2B9D A;  4DR4 E;  2YSP A;  5KL2 A;  1WHN A;  4X9J A;  1N32 E;  2L2K B;  4JI1 E;  2K7I A;  5A6B D;  5DNY A;  2JPA A;  4WSG A;  2EPU A;  5A6K A;  3HXL A;  4DV0 E;  2LUQ A;  2YRK A;  4F9A B;  4Q28 A;  1A1H A;  2YU8 A;  4F6M A;  2EMI A;  3LML A;  5A6B A;  4GZN C;  4ZYH A;  2JOB A;  4J8Z A;  2V87 A;  2EJ4 A;  1PJS A;  2EM3 A;  2L8T A;  2YWQ A;  4RH8 A;  1YFH A;  4DR2 E;  3JAM C;  4N4R B;  2NA2 A;  5AE1 A;  3ADL A;  2I9I A;  2YTP A;  5ADZ A;  2MC6 A;  2EMY A;  4Q35 B;  2EOQ A;  4RHB B;  4GKK E;  2VF1 A;  4DR1 E;  4P7D A;  2DGC A;  2EMF A;  4JI5 E;  2MKD A;  4R2A A;  1ZR9 A;  2EMC A;  2V85 A;  1ZBQ A;  1KJK A;  1A1F A;  1SFE A;  3KWR A;  2EPK X;  1EH6 A;  2ENC A;  2RS7 A;  2ELZ A;  4X65 E;  1N34 E;  2EPO A;  4WXD A;  3C6K A;  4F2J C;  3VYX A;  4WXC A;  4DV2 E;  2YTO A;  4L8N A;  2FTX B;  1DGC A;  3MSW A;  2EMW A;  2LO3 A;  1DI2 A;  2UXD E;  3OTO E;  4DR3 E;  2VE7 C;  4B3S E;  2EMH A;  2L3J A;  4JI2 E;  5AC5 A;  4HTG A;  1T38 A;  2LTR A;  4BS9 A;  5AE2 A;  2UXC E;  3C4B A;  1F2I G;  1XMQ E;  1EKZ A;  2BB8 A;  1WJP A;  4B3T E;  2EE8 A;  4ZYD A;  2LBS B;  2Q8U A;  5KL5 A;  4R2S A;  4DR5 E;  4JI7 E;  2B7T A;  5IV8 B;  2V88 A;  2J7J A;  4LU9 A;  2EOO A;  2F8B A;  3KZY A;  4LFC E;  2CSH A;  3HQ1 A;  2EOS A;  2CT1 A;  5TSE A;  5LL6 R;  3THN A;  1PDA A;  4DUY E;  2D9H A;  2JVA A;  1TF6 A;  2EP3 A;  1EH7 A;  1XNQ E;  1HR0 E;  2ZM6 E;  2EM5 A;  2EMZ A;  2E72 A;  2EZ6 A;  4WSP A;  2MDG A;  1XMO E;  5LLQ A;  2EN4 A;  1BBO A;  1KYQ A;  2DB2 A;  3M99 B;  1LLM C;  2YSO A;  4HEI A;  5AC4 A;  4F9B B;  2M4I A;  4LF9 E;  1A1I A;  2YRH A;  1I94 E;  1WRJ A;  4O5G A;  2EQ1 A;  5FLX C;  4WYQ B;  1YYW A;  3C4T A;  2WCC 3;  1PJQ A;  1RMD A;  3DF6 A;  2ODR D;  2N3H A;  3T1Y E;  2MDR A;  2RSI A;  3H09 A;  4R2E A;  1T4O A;  2DRP A;  2JOX A;  4LFB E;  2B3T B;  2EPC A;  1N33 E;  1UIL A;  1N36 E;  2RSM A;  4DV6 E;  2EOI A;  4NXN E;  2ELY A;  2LT7 A;  2YU5 A;  3VYY A;  4LFA E;  1WHQ A;  4WX9 A;  4AQY E;  2JP9 A;  1X47 A;  2PRT A;  5KL7 A;  2RS6 A;  2EM0 A;  5T6J A;  2VQF E;  5A6A A;  1L4S A;  2EPN A;  3BF2 A;  1A1J A;  4BMJ A;  2EPP A;  1FJG E;  4IS1 C;  2YRM A;  2EOE A;  2UUB E;  5LMU E;  2WZO A;  3MHS C;  3BBG A;  1T4L B;  4B3M E;  1J26 A;  2EOX A;  4DV5 E;  2EQ0 A;  2EM7 A;  4LF4 E;  1NCS A;  3J80 C;  1G2D C;  4YHH E;  2JXP A;  3KZZ A;  2GHF A;  2LTS A;  2NUF A;  1X6H A;  1PJT A;  2YTF A;  2DLK A;  2LRS A;  2R1F A;  5KL4 A;  2EMA A;  3ADI A;  3RMP A;  1IBM E;  4K0K E;  2F4V E;  2L3C A;  4B3R E;  4I8O A;  1XNR E;  2EN2 A;  1DQ3 A;  5BR8 E;  1IQO A;  2V86 A;  3ZOQ B;  1J5E E;  4O43 A;  1X5W A;  1BBG A;  4WFT A;  1TN9 A;  1YUJ A;  3P1X A;  4R2C A;  4X8W A;  1YZ9 A;  2EMK A;  2CPN A;  1FKA E;  5AE3 A;  2UXB E;  4BBY A;  4NXM E;  2HGH A;  3EQ1 A;  4M9V C;  2EMB A;  2WBS A;  2LMZ A;  2LJU A;  3IWC A;  4R8O A;  4X64 E;  2MC5 A;  2EOM A;  3K6Q A;  5KL6 A;  2EOY A;  2L6M A;  2EN7 A;  4JI3 E;  4TUG A;  2NUG A;  3L00 A;  1MGT A;  4KZS A;  1B69 A;  3VHT B;  2R76 A;  2EM8 A;  2ODR C;  1IBK E;  1A1K A;  4X66 E;  4TUI A;  1AH5 A;  2LVH A;  1EH8 A;  2MKN A;  2EM2 A;  2EPX A;  2JWO A;  2EN3 A;  1QNT A;  1ZBT A;  2WBU A;  2LJH A;  2YTG A;  2EMG A;  3DJW A;  1GQE A;  2V83 A;  3UK3 C;  4MLQ A;  2ADR A;  2EN8 A;  3LLH A;  1Z1B A;  2JYA A;  1WXR A;  1HNW E;  2EPA A;  3EPL A;  2H36 X;  2E1M A;  4BCA A;  2GPI A;  1TF3 A;  2V8Q B;  1GZ6 A;  2VQE E;  2N8X A;  3OML A;  2EWL A;  3QG5 C;  2M7Q A;  1UHZ A;  2YTJ A;  2JY9 A;  4R2D A;  2B7V A;  2EL5 A;  5LMN E;  1JK1 A;  4M2Z A;  2EPL X;  2VRD A;  1NEI A;  4JI8 E;  3HPZ A;  5CFF E;  5IXM B;  3BID A;  1A1G A;  1PKP A;  2UU9 E;  3JTZ A;  2HJJ A;  3HTX A;  5IT9 C;  5F3W A;  2M1S A;  1X3C A;  1X48 A;  2KHX A;  1IQS A;  5AAS A;  5IWA E;  4GEQ B;  4DV3 E;  3THO B;  2DIX A;  4NHR A;  2NAB A;  1IMU A;  2IHR 1;  4R2Q A;  1YUI A;  4BC7 A;  2EL4 A;  2CTD A;  4ZYG A;  2LUP B;  2LE2 A;  1T39 A;  1RQ0 A;  1BB8 A;  1X6E A;  2K4V A;  4FK5 C;  2G7H A;  3FIG A;  2LCE A;  2YTQ A;  3HPS A;  1IBL E;  2E5L E;  2ENH A;  1G2F C;  4DR7 E;  3EPH A;  2EOH A;  2EM9 A;  2NUE A;  5KL3 A;  1P47 A;  2I13 A;  2EMX A;  4JV5 E;  2EPZ A;  4IJD A;  4JI4 E;  4O24 A;  2EM4 A;  3IWD A;  4GKJ E;  1HNX E;  4DR6 E;  2A25 A;  1O0W A;  3TQM A;  3ADG A;  1JK2 A;  3BGH A;  4R2R A;  4JI0 E;  2FV4 B;  2HHH E;  2YPN A;  1ZAA C;  4M0V A;  2EOF A;  4KWY A;  1UN6 B;  2N3G A;  4P78 A;  2HC5 A;  2KOU A;  3F6H A;  2L2N A;  3ADJ A;  2EOR A;  1SR9 A;  2EN6 A;  1A1L A;  4R2P A;  4LF6 E;  4LTY A;  4KHP E;  1ZU1 A;  2L92 A;  5A69 A;  1X49 A;  2ENA A;  4DV7 E;  1X6F A;  2YTD A;  4F6N A;  3J7Y p;  2EPR A;  3T1H E;  3J7A G;  3AUZ A;  2EN1 A;  4M30 A;  1RC7 A;  4MLV A;  2YTI A;  2M9A A;  4F9C B;  1GTK A;  4DV1 E;  2WBT A;  4DUZ E;  2DMI A;  1QU6 A;  5A6J A;  4BHC A;  1MEY C;  1YPN A;  2EOJ A;  4DMI A;  4YY3 E;  2BBG A;  2YTN A;  2EOZ A;  4LF5 E;  4X62 E;  4WPY A;  2DLQ A;  3EPJ A;  2EPM X;  4OX9 E;  2V89 A;  4JI6 E;  4BHB A;  3JU0 A;  2LV2 A;  4DKK A;  2UUC E;  2EML A;  2YZT A;  2GLI A;  3IWB A;  2KON A;  2L33 A;  2EM6 A;  1STU A;  4OOG C;  4L5N C;  4LF8 E;  2YTE A;  2EQ3 A;  2FGG A;  3C6M A;  4O4K A;  3MHH C;  2RPC A;  4ZYE A;  1YSA C;  2L2M A;  4BC9 A;  1N3G A;  3ECR A;  2RQL A;  4NZV A;  2YT4 A;  2EL6 A;  1AAY A;  1UBD C;  2DSY A;  5A2Q C;  1HNZ E;  1YYK A;  4R03 A;  3J81 C;  1YYO A;  2RTX A;  3EPK A;  2DMY A;  2UUA E;  4F54 A;  1T4N A; 
#chains in the Genus database with same CATH homology
 2K7I A;  3BID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...