2YTPA

Solution structure of the c2h2 type zinc finger (region 687-719) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERHYECSECGKAFARKSTLIMHQRIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 687-719) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytpA01
2R1FA 2YTQA 1KJKA 4F6MA 2YSPA 2YRHA 2WCC3 2EM0A 2EPXA 2EOMA 2EMHA 2YTJA 2EOFA 2LO3A 3MHHC 2GLIA 2MKDA 2DLQA 2NABA 2EQ1A 4R2DA 2EMKA 2EL6A 5KL6A 1A1GA 4X9JA 3UK3C 4R2EA 2EOSA 2EOZA 2ELYA 1A1KA 2EM9A 2EMBA 2EMYA 2YRKA 5KL4A 2EOOA 2EN7A 2EOQA 2EM6A 1AAYA 4F2JC 2D9HA 2LVHA 4R2RA 2PRTA 1YUJA 2VRDA 1X6FA 2EN1A 1A1FA 1MEYC 4M9VC 5KL7A 2EM7A 2EPUA 1DGCA 1Z1BA 1TF6A 2EN8A 1YUIA 1LLMC 4WSGA 1X5WA 2DMIA 2EL4A 3VHTB 2EMFA 2EJ4A 3EPJA 1X6HA 1P47A 2JP9A 2YU8A 2EQ3A 3EPKA 2EM4A 1G2DC 1TN9A 2EM2A 2ENHA 2EPPA 5KL5A 1NCSA 1JK2A 5KL2A 2EN6A 1A1LA 2EMXA 4R2PA 2EM3A 3EPHA 2EMCA 2EPZA 2LT7A 2EOIA 2WBTA 1A1JA 2EP3A 3M99B 1BBOA 2EORA 2YTIA 2EOHA 2YU5A 2MKNA 2LV2A 1JK1A 2YTDA 2WBSA 2M9AA 1X3CA 3EPLA 2RSIA 1X6EA 1UN6B 2CSHA 1ZR9A 3MHSC 2YSOA 2CTDA 2EN4A 2EE8A 1B69A 2MDGA 2EMIA 1F2IG 2YTNA 2GHFA 4R2SA 4IJDA 2HGHA 4IS1C 1ZAAC 4R2CA 2EPAA 2YTGA 2EOXA 2YTFA 1RMDA 2EPCA 2EMWA 2EM5A 4R2QA 4R2AA 2EOJA 4F6NA 1BB8A 2EOEA 2RPCA 2YTEA 4FK5C 2EN3A 2EN2A 1YSAC 1ZU1A 1G2FC 2E72A 1WJPA 2EMAA 2DRPA 2J7JA 2YRMA 2YTOA 4GZNC 2DGCA 2EMZA 1UBDC 2ADRA 2EMGA 2ENCA 2LCEA 2I13A 2CT1A 5KL3A 2BB8A 2YTPA 2ELZA 2EPRA 2WBUA 2DLKA 2EQ0A 1TF3A 2EMLA 2A25A 2JPAA 2EOYA 1A1HA 1A1IA 2ENAA 2EL5A 2EM8A
chains in the Genus database with same CATH superfamily
2R1FA 2YTQA 2V87A 1YYOA 2YRHA 3JU0A 2WCC3 2JVAA 2EPXA 1DI2A 1ZBTA 1WHNA 2EOFA 2LO3A 4J8ZA 4JI3E 2HC5A 2I9IA 3C4TA 3ADJA 2DLQA 2NABA 1EH6A 1XMQE 5KL6A 2EPMX 3F6GA 1HR0E 4NZVA 2V89A 4B3RE 5FLXC 2EMYA 1T38A 1WXRA 5KL4A 4L5NC 2UXDE 2EOQA 4TUGA 4YHHE 2UUCE 4LU9A 4WX9A 2N8XA 4O24A 2RS6A 1PJQA 1UHZA 4O43A 1X6FA 4KZSA 4X64E 2RQLA 1MEYC 4M9VC 4HTGA 2ODRD 2EM7A 2EPUA 1DGCA 4KHPE 4LFBE 5LMNE 1Z1BA 2EN8A 1XMOE 1LLMC 4WSGA 2JP9A 2DMIA 2EPKX 5AC4A 1X6HA 3IWCA 4DV0E 1G2DC 2UXCE 2L3JA 1FJGE 1NCSA 4BHCA 3OTOE 4DV1E 2M1SA 2EMCA 4JI7E 4LFAE 2EORA 2YTIA 2WBSA 2IHR1 3EPLA 2VE7C 2RSIA 2CSHA 2FTXB 4N4RB 2LMZA 4JI1E 3MHSC 2JYAA 2YSOA 2CTDA 1B69A 2EE8A 2FV4B 2EMIA 2MC6A 4LTYA 2GHFA 5A6BD 4IS1C 4B3SE 4WXDA 2YTFA 3RMPA 4DV6E 1X47A 2RPCA 2YTEA 2L2KB 2EN2A 1ZU1A 1T4NA 1X48A 3OMLA 2L92A 3K6QA 3P1XA 2J7JA 2YTOA 1IQOA 4K0KE 1L4SA 4DR3E 1UBDC 2ADRA 1QU6A 2EMGA 5AE1A 1HNWE 4BMJA 2UUBE 2CT1A 4NXNE 3DF6A 2WBUA 1KYQA 1GZ6A 1IBKE 2EMLA 2EL5A 4DV7E 2R76A 2EM8A 2KHXA 4I8OA 4LF8E 1QNTA 2VQEE 4F6MA 3AUZA 5IT9C 2EOMA 1PJSA 2EMHA 2UXBE 2YTJA 2YT4A 2MDRA 3MHHC 2LTRA 2L6MA 3VYXA 2DSYA 2HHHE 4JI2E 1YPNA 1N36E 2V85A 3KWRA 4DV2E 4R2DA 2EMKA 2EL6A 4Q35B 4DR4E 2FGGA 2ELYA 1A1KA 2LTSA 2JOXA 1N3GA 1HNZE 4GKKE 2EN7A 2EM6A 1AAYA 1EKZA 1YYWA 1J26A 1PKPA 4YY3E 4M0VA 2ODRC 2BBGA 2B3TB 1A1FA 3IWBA 1SFEA 1TF6A 5LLQA 1WRJA 2YZTA 2EQ3A 2EM4A 2UU9E 3J7Yp 1GTKA 1IMUA 2ENHA 2EPPA 5KL5A 4R03A 5KL2A 4F9BB 1A1LA 1T4OA 3M99B 1PJTA 3FIGA 2YTDA 3HPSA 2LUQA 4ZYGA 4TUIA 1X49A 2GPIA 2JY9A 4NXME 2EPNA 2EN4A 1F2IG 2VQFE 3ADLA 1N34E 2NUFA 2HJJA 4M30A 1ZAAC 2EPAA 1RMDA 2NUGA 3T1HE 2EM5A 1BB8A 2EOJA 5IV8B 2EOEA 3JTZA 4FK5C 3C4BA 1YSAC 4BC7A 1G2FC 2JR1A 2N3GA 1EH8A 4MLVA 2YRMA 1J5EE 4GZNC 2DGCA 5T6JA 2EMZA 3EQ1A 3F6HA 2LCEA 1MGTA 3DJWA 5KL3A 3J81C 2JPAA 4WPYA 5TSEA 3THOB 5AE2A 3THNA 3TQMA 1KJKA 1O0WA 2YSPA 4DR5E 2MC5A 4WXCA 4JI5E 4DUZE 5CFFE 2GLIA 5ADZA 1XNRE 2B7VA 2EQ1A 4R2EA 1SR9A 2EOSA 2JOBA 3VK6A 2YRKA 2L3CA 3ADIA 1I94E 2EOOA 1IBLE 2DIXA 4F2JC 4WSPA 2N3HA 4RH8A 4R2RA 2PRTA 1YUJA 5BR8E 4OOGC 3C6KA 1IQSA 2RSMA 3IWDA 5KL7A 4BS9A 1WHQA 2E1MA 1YUIA 4LFCE 1X5WA 3VHTB 2V83A 3EPJA 4F9AB 2UUAE 2CPNA 2M4IA 2V8QB 3EPKA 3KZZA 3KZYA 1TN9A 4L8NA 1N33E 2EN6A 4KWYA 2EMXA 2EM3A 5AC5A 4LF4E 2EPZA 2EP3A 4BC9A 1N32E 1BBOA 2EOHA 2LJUA 1FKAE 1JK1A 2WZOA 2LE2A 2M9AA 2F8BA 4O4KA 4P78A 1UN6B 4MLQA 3ZOQB 2L8TA 4AQYE 3C6MA 2EPOA 1RQ0A 2H36X 2V88A 2MDGA 4Q28A 2YTNA 4JYAE 4IJDA 2ZM6E 2HGHA 4R2CA 5A6JA 4DR1E 2NUEA 3AV0A 2EMWA 4R2QA 4R2AA 3LLHA 5LL6R 4JI6E 1DQ3A 3HXLA 2L2MA 2LRSA 4LF6E 1PDAA 2DRPA 4X65E 1EH7A 4WYQB 4DMIA 1UILA 5DNYA 2KOUA 4BCAA 2I13A 5IWAE 2EZ6A 2BB8A 3QG5C 2ELZA 2EPRA 2DLKA 5A6AA 1TF3A 4DKKA 4BHBA 3JAMC 4DV4E 4O5GA 2ENAA 2JXPA 1A1IA 2K7IA 1BBGA 2M7QA 3L00A 2V86A 2B7TA 1YYKA 2EM0A 2RS7A 4GEQB 1ZBQA 4B3ME 2YWQA 2MKDA 4LF5E 5A69A 3BBGA 1A1GA 2F4VE 3LMLA 4X9JA 3UK3C 3J80C 2EOZA 2EM9A 2EMBA 1T39A 3H09A 4HEIA 2D9HA 1GQEA 2LVHA 2RTXA 4BBYA 2LUPB 4OX9E 2LJHA 2VRDA 4R8OA 2EN1A 4WFTA 4DR7E 4DR6E 2L2NA 4RHBB 4ZYHA 4DR2E 5F3WA 2EL4A 2EMFA 2EJ4A 1P47A 2YU8A 1YFHA 2EPLX 4DUYE 5IXMB 5LMUE 3BF2A 1STUA 2EM2A 5AE3A 1JK2A 4JI4E 5A6KA 2KONA 4JI0E 4NHRA 4R2PA 3EPHA 2LT7A 2EOIA 2WBTA 4B3TE 1A1JA 2YU5A 3ADGA 4JV5E 4DV3E 2LV2A 2DB2A 3MSWA 2MKNA 1X3CA 1X6EA 4ZYDA 1NEIA 3HQ1A 1ZR9A 2L33A 2K4VA 4JI8E 1RC7A 4P7DA 3T1YE 2E5LE 4R2SA 3ECRA 2JWOA 3VYYA 1HNXE 4GKJE 2YTGA 3BIDA 2EOXA 3BGHA 1AH5A 2EPCA 4F6NA 4M2ZA 3J7AG 2EWLA 2DMYA 4F9CB 1YZ9A 2EN3A 2YPNA 2Q8UA 4LF9E 1T4LB 5A6BA 1XNQE 4F54A 2E72A 4DV5E 1WJPA 2EMAA 4X62E 2G7HA 2B9DA 2NA2A 5A2QC 2ENCA 4X66E 2LBSB 3HPZA 2YTPA 2VF1A 5AASA 3HTXA 4X8WA 2EQ0A 2A25A 2EOYA 4LF7E 1A1HA 1IBME 4ZYEA
chains in the Genus database with same CATH topology
2R1FA 2YTQA 1KJKA 4F6MA 2YSPA 2YRHA 2WCC3 2EM0A 2EPXA 2EOMA 2EMHA 2YTJA 2EOFA 2LO3A 3MHHC 2GLIA 2MKDA 2DLQA 2NABA 2EQ1A 4R2DA 2EMKA 2EL6A 5KL6A 1A1GA 4X9JA 3UK3C 4R2EA 2EOSA 2EOZA 2ELYA 1A1KA 2EM9A 2EMBA 2EMYA 2YRKA 5KL4A 2EOOA 2EN7A 2EOQA 2EM6A 1AAYA 4F2JC 2D9HA 2LVHA 4R2RA 2PRTA 1YUJA 2VRDA 1X6FA 2EN1A 1A1FA 1MEYC 4M9VC 5KL7A 2EM7A 2EPUA 1DGCA 1Z1BA 1TF6A 2EN8A 1YUIA 1LLMC 4WSGA 1X5WA 2DMIA 2EL4A 3VHTB 2EMFA 2EJ4A 3EPJA 1X6HA 1P47A 2JP9A 2YU8A 2EQ3A 3EPKA 2EM4A 1G2DC 1TN9A 2EM2A 2ENHA 2EPPA 5KL5A 1NCSA 1JK2A 5KL2A 2EN6A 1A1LA 2EMXA 4R2PA 2EM3A 3EPHA 2EMCA 2EPZA 2LT7A 2EOIA 2WBTA 1A1JA 2EP3A 3M99B 1BBOA 2EORA 2YTIA 2EOHA 2YU5A 2MKNA 2LV2A 1JK1A 2YTDA 2WBSA 2M9AA 1X3CA 3EPLA 2RSIA 1X6EA 1UN6B 2CSHA 1ZR9A 3MHSC 2YSOA 2CTDA 2EN4A 2EE8A 1B69A 2MDGA 2EMIA 1F2IG 2YTNA 2GHFA 4R2SA 4IJDA 2HGHA 4IS1C 1ZAAC 4R2CA 2EPAA 2YTGA 2EOXA 2YTFA 1RMDA 2EPCA 2EMWA 2EM5A 4R2QA 4R2AA 2EOJA 4F6NA 1BB8A 2EOEA 2RPCA 2YTEA 4FK5C 2EN3A 2EN2A 1YSAC 1ZU1A 1G2FC 2E72A 1WJPA 2EMAA 2DRPA 2J7JA 2YRMA 2YTOA 4GZNC 2DGCA 2EMZA 1UBDC 2ADRA 2EMGA 2ENCA 2LCEA 2I13A 2CT1A 5KL3A 2BB8A 2YTPA 2ELZA 2EPRA 2WBUA 2DLKA 2EQ0A 1TF3A 2EMLA 2A25A 2JPAA 2EOYA 1A1HA 1A1IA 2ENAA 2EL5A 2EM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R1F A;  2YTQ A;  1KJK A;  4F6M A;  2YSP A;  2YRH A;  2WCC 3;  2EM0 A;  2EPX A;  2EOM A;  2EMH A;  2YTJ A;  2EOF A;  2LO3 A;  3MHH C;  2GLI A;  2MKD A;  2DLQ A;  2NAB A;  2EQ1 A;  4R2D A;  2EMK A;  2EL6 A;  5KL6 A;  1A1G A;  4X9J A;  3UK3 C;  4R2E A;  2EOS A;  2EOZ A;  2ELY A;  1A1K A;  2EM9 A;  2EMB A;  2EMY A;  2YRK A;  5KL4 A;  2EOO A;  2EN7 A;  2EOQ A;  2EM6 A;  1AAY A;  4F2J C;  2D9H A;  2LVH A;  4R2R A;  2PRT A;  1YUJ A;  2VRD A;  1X6F A;  2EN1 A;  1A1F A;  1MEY C;  4M9V C;  5KL7 A;  2EM7 A;  2EPU A;  1DGC A;  1Z1B A;  1TF6 A;  2EN8 A;  1YUI A;  1LLM C;  4WSG A;  1X5W A;  2DMI A;  2EL4 A;  3VHT B;  2EMF A;  2EJ4 A;  3EPJ A;  1X6H A;  1P47 A;  2JP9 A;  2YU8 A;  2EQ3 A;  3EPK A;  2EM4 A;  1G2D C;  1TN9 A;  2EM2 A;  2ENH A;  2EPP A;  5KL5 A;  1NCS A;  1JK2 A;  5KL2 A;  2EN6 A;  1A1L A;  2EMX A;  4R2P A;  2EM3 A;  3EPH A;  2EMC A;  2EPZ A;  2LT7 A;  2EOI A;  2WBT A;  1A1J A;  2EP3 A;  3M99 B;  1BBO A;  2EOR A;  2YTI A;  2EOH A;  2YU5 A;  2MKN A;  2LV2 A;  1JK1 A;  2YTD A;  2WBS A;  2M9A A;  1X3C A;  3EPL A;  2RSI A;  1X6E A;  1UN6 B;  2CSH A;  1ZR9 A;  3MHS C;  2YSO A;  2CTD A;  2EN4 A;  2EE8 A;  1B69 A;  2MDG A;  2EMI A;  1F2I G;  2YTN A;  2GHF A;  4R2S A;  4IJD A;  2HGH A;  4IS1 C;  1ZAA C;  4R2C A;  2EPA A;  2YTG A;  2EOX A;  2YTF A;  1RMD A;  2EPC A;  2EMW A;  2EM5 A;  4R2Q A;  4R2A A;  2EOJ A;  4F6N A;  1BB8 A;  2EOE A;  2RPC A;  2YTE A;  4FK5 C;  2EN3 A;  2EN2 A;  1YSA C;  1ZU1 A;  1G2F C;  2E72 A;  1WJP A;  2EMA A;  2DRP A;  2J7J A;  2YRM A;  2YTO A;  4GZN C;  2DGC A;  2EMZ A;  1UBD C;  2ADR A;  2EMG A;  2ENC A;  2LCE A;  2I13 A;  2CT1 A;  5KL3 A;  2BB8 A;  2YTP A;  2ELZ A;  2EPR A;  2WBU A;  2DLK A;  2EQ0 A;  1TF3 A;  2EML A;  2A25 A;  2JPA A;  2EOY A;  1A1H A;  1A1I A;  2ENA A;  2EL5 A;  2EM8 A; 
#chains in the Genus database with same CATH topology
 2R1F A;  2YTQ A;  2V87 A;  1YYO A;  2YRH A;  3JU0 A;  2WCC 3;  2JVA A;  2EPX A;  1DI2 A;  1ZBT A;  1WHN A;  2EOF A;  2LO3 A;  4J8Z A;  4JI3 E;  2HC5 A;  2I9I A;  3C4T A;  3ADJ A;  2DLQ A;  2NAB A;  1EH6 A;  1XMQ E;  5KL6 A;  2EPM X;  3F6G A;  1HR0 E;  4NZV A;  2V89 A;  4B3R E;  5FLX C;  2EMY A;  1T38 A;  1WXR A;  5KL4 A;  4L5N C;  2UXD E;  2EOQ A;  4TUG A;  4YHH E;  2UUC E;  4LU9 A;  4WX9 A;  2N8X A;  4O24 A;  2RS6 A;  1PJQ A;  1UHZ A;  4O43 A;  1X6F A;  4KZS A;  4X64 E;  2RQL A;  1MEY C;  4M9V C;  4HTG A;  2ODR D;  2EM7 A;  2EPU A;  1DGC A;  4KHP E;  4LFB E;  5LMN E;  1Z1B A;  2EN8 A;  1XMO E;  1LLM C;  4WSG A;  2JP9 A;  2DMI A;  2EPK X;  5AC4 A;  1X6H A;  3IWC A;  4DV0 E;  1G2D C;  2UXC E;  2L3J A;  1FJG E;  1NCS A;  4BHC A;  3OTO E;  4DV1 E;  2M1S A;  2EMC A;  4JI7 E;  4LFA E;  2EOR A;  2YTI A;  2WBS A;  2IHR 1;  3EPL A;  2VE7 C;  2RSI A;  2CSH A;  2FTX B;  4N4R B;  2LMZ A;  4JI1 E;  3MHS C;  2JYA A;  2YSO A;  2CTD A;  1B69 A;  2EE8 A;  2FV4 B;  2EMI A;  2MC6 A;  4LTY A;  2GHF A;  5A6B D;  4IS1 C;  4B3S E;  4WXD A;  2YTF A;  3RMP A;  4DV6 E;  1X47 A;  2RPC A;  2YTE A;  2L2K B;  2EN2 A;  1ZU1 A;  1T4N A;  1X48 A;  3OML A;  2L92 A;  3K6Q A;  3P1X A;  2J7J A;  2YTO A;  1IQO A;  4K0K E;  1L4S A;  4DR3 E;  1UBD C;  2ADR A;  1QU6 A;  2EMG A;  5AE1 A;  1HNW E;  4BMJ A;  2UUB E;  2CT1 A;  4NXN E;  3DF6 A;  2WBU A;  1KYQ A;  1GZ6 A;  1IBK E;  2EML A;  2EL5 A;  4DV7 E;  2R76 A;  2EM8 A;  2KHX A;  4I8O A;  4LF8 E;  1QNT A;  2VQE E;  4F6M A;  3AUZ A;  5IT9 C;  2EOM A;  1PJS A;  2EMH A;  2UXB E;  2YTJ A;  2YT4 A;  2MDR A;  3MHH C;  2LTR A;  2L6M A;  3VYX A;  2DSY A;  2HHH E;  4JI2 E;  1YPN A;  1N36 E;  2V85 A;  3KWR A;  4DV2 E;  4R2D A;  2EMK A;  2EL6 A;  4Q35 B;  4DR4 E;  2FGG A;  2ELY A;  1A1K A;  2LTS A;  2JOX A;  1N3G A;  1HNZ E;  4GKK E;  2EN7 A;  2EM6 A;  1AAY A;  1EKZ A;  1YYW A;  1J26 A;  1PKP A;  4YY3 E;  4M0V A;  2ODR C;  2BBG A;  2B3T B;  1A1F A;  3IWB A;  1SFE A;  1TF6 A;  5LLQ A;  1WRJ A;  2YZT A;  2EQ3 A;  2EM4 A;  2UU9 E;  3J7Y p;  1GTK A;  1IMU A;  2ENH A;  2EPP A;  5KL5 A;  4R03 A;  5KL2 A;  4F9B B;  1A1L A;  1T4O A;  3M99 B;  1PJT A;  3FIG A;  2YTD A;  3HPS A;  2LUQ A;  4ZYG A;  4TUI A;  1X49 A;  2GPI A;  2JY9 A;  4NXM E;  2EPN A;  2EN4 A;  1F2I G;  2VQF E;  3ADL A;  1N34 E;  2NUF A;  2HJJ A;  4M30 A;  1ZAA C;  2EPA A;  1RMD A;  2NUG A;  3T1H E;  2EM5 A;  1BB8 A;  2EOJ A;  5IV8 B;  2EOE A;  3JTZ A;  4FK5 C;  3C4B A;  1YSA C;  4BC7 A;  1G2F C;  2JR1 A;  2N3G A;  1EH8 A;  4MLV A;  2YRM A;  1J5E E;  4GZN C;  2DGC A;  5T6J A;  2EMZ A;  3EQ1 A;  3F6H A;  2LCE A;  1MGT A;  3DJW A;  5KL3 A;  3J81 C;  2JPA A;  4WPY A;  5TSE A;  3THO B;  5AE2 A;  3THN A;  3TQM A;  1KJK A;  1O0W A;  2YSP A;  4DR5 E;  2MC5 A;  4WXC A;  4JI5 E;  4DUZ E;  5CFF E;  2GLI A;  5ADZ A;  1XNR E;  2B7V A;  2EQ1 A;  4R2E A;  1SR9 A;  2EOS A;  2JOB A;  3VK6 A;  2YRK A;  2L3C A;  3ADI A;  1I94 E;  2EOO A;  1IBL E;  2DIX A;  4F2J C;  4WSP A;  2N3H A;  4RH8 A;  4R2R A;  2PRT A;  1YUJ A;  5BR8 E;  4OOG C;  3C6K A;  1IQS A;  2RSM A;  3IWD A;  5KL7 A;  4BS9 A;  1WHQ A;  2E1M A;  1YUI A;  4LFC E;  1X5W A;  3VHT B;  2V83 A;  3EPJ A;  4F9A B;  2UUA E;  2CPN A;  2M4I A;  2V8Q B;  3EPK A;  3KZZ A;  3KZY A;  1TN9 A;  4L8N A;  1N33 E;  2EN6 A;  4KWY A;  2EMX A;  2EM3 A;  5AC5 A;  4LF4 E;  2EPZ A;  2EP3 A;  4BC9 A;  1N32 E;  1BBO A;  2EOH A;  2LJU A;  1FKA E;  1JK1 A;  2WZO A;  2LE2 A;  2M9A A;  2F8B A;  4O4K A;  4P78 A;  1UN6 B;  4MLQ A;  3ZOQ B;  2L8T A;  4AQY E;  3C6M A;  2EPO A;  1RQ0 A;  2H36 X;  2V88 A;  2MDG A;  4Q28 A;  2YTN A;  4JYA E;  4IJD A;  2ZM6 E;  2HGH A;  4R2C A;  5A6J A;  4DR1 E;  2NUE A;  3AV0 A;  2EMW A;  4R2Q A;  4R2A A;  3LLH A;  5LL6 R;  4JI6 E;  1DQ3 A;  3HXL A;  2L2M A;  2LRS A;  4LF6 E;  1PDA A;  2DRP A;  4X65 E;  1EH7 A;  4WYQ B;  4DMI A;  1UIL A;  5DNY A;  2KOU A;  4BCA A;  2I13 A;  5IWA E;  2EZ6 A;  2BB8 A;  3QG5 C;  2ELZ A;  2EPR A;  2DLK A;  5A6A A;  1TF3 A;  4DKK A;  4BHB A;  3JAM C;  4DV4 E;  4O5G A;  2ENA A;  2JXP A;  1A1I A;  2K7I A;  1BBG A;  2M7Q A;  3L00 A;  2V86 A;  2B7T A;  1YYK A;  2EM0 A;  2RS7 A;  4GEQ B;  1ZBQ A;  4B3M E;  2YWQ A;  2MKD A;  4LF5 E;  5A69 A;  3BBG A;  1A1G A;  2F4V E;  3LML A;  4X9J A;  3UK3 C;  3J80 C;  2EOZ A;  2EM9 A;  2EMB A;  1T39 A;  3H09 A;  4HEI A;  2D9H A;  1GQE A;  2LVH A;  2RTX A;  4BBY A;  2LUP B;  4OX9 E;  2LJH A;  2VRD A;  4R8O A;  2EN1 A;  4WFT A;  4DR7 E;  4DR6 E;  2L2N A;  4RHB B;  4ZYH A;  4DR2 E;  5F3W A;  2EL4 A;  2EMF A;  2EJ4 A;  1P47 A;  2YU8 A;  1YFH A;  2EPL X;  4DUY E;  5IXM B;  5LMU E;  3BF2 A;  1STU A;  2EM2 A;  5AE3 A;  1JK2 A;  4JI4 E;  5A6K A;  2KON A;  4JI0 E;  4NHR A;  4R2P A;  3EPH A;  2LT7 A;  2EOI A;  2WBT A;  4B3T E;  1A1J A;  2YU5 A;  3ADG A;  4JV5 E;  4DV3 E;  2LV2 A;  2DB2 A;  3MSW A;  2MKN A;  1X3C A;  1X6E A;  4ZYD A;  1NEI A;  3HQ1 A;  1ZR9 A;  2L33 A;  2K4V A;  4JI8 E;  1RC7 A;  4P7D A;  3T1Y E;  2E5L E;  4R2S A;  3ECR A;  2JWO A;  3VYY A;  1HNX E;  4GKJ E;  2YTG A;  3BID A;  2EOX A;  3BGH A;  1AH5 A;  2EPC A;  4F6N A;  4M2Z A;  3J7A G;  2EWL A;  2DMY A;  4F9C B;  1YZ9 A;  2EN3 A;  2YPN A;  2Q8U A;  4LF9 E;  1T4L B;  5A6B A;  1XNQ E;  4F54 A;  2E72 A;  4DV5 E;  1WJP A;  2EMA A;  4X62 E;  2G7H A;  2B9D A;  2NA2 A;  5A2Q C;  2ENC A;  4X66 E;  2LBS B;  3HPZ A;  2YTP A;  2VF1 A;  5AAS A;  3HTX A;  4X8W A;  2EQ0 A;  2A25 A;  2EOY A;  4LF7 E;  1A1H A;  1IBM E;  4ZYE A; 
#chains in the Genus database with same CATH homology
 2R1F A;  2YTQ A;  1KJK A;  4F6M A;  2YSP A;  2YRH A;  2WCC 3;  2EM0 A;  2EPX A;  2EOM A;  2EMH A;  2YTJ A;  2EOF A;  2LO3 A;  3MHH C;  2GLI A;  2MKD A;  2DLQ A;  2NAB A;  2EQ1 A;  4R2D A;  2EMK A;  2EL6 A;  5KL6 A;  1A1G A;  4X9J A;  3UK3 C;  4R2E A;  2EOS A;  2EOZ A;  2ELY A;  1A1K A;  2EM9 A;  2EMB A;  2EMY A;  2YRK A;  5KL4 A;  2EOO A;  2EN7 A;  2EOQ A;  2EM6 A;  1AAY A;  4F2J C;  2D9H A;  2LVH A;  4R2R A;  2PRT A;  1YUJ A;  2VRD A;  1X6F A;  2EN1 A;  1A1F A;  1MEY C;  4M9V C;  5KL7 A;  2EM7 A;  2EPU A;  1DGC A;  1Z1B A;  1TF6 A;  2EN8 A;  1YUI A;  1LLM C;  4WSG A;  1X5W A;  2DMI A;  2EL4 A;  3VHT B;  2EMF A;  2EJ4 A;  3EPJ A;  1X6H A;  1P47 A;  2JP9 A;  2YU8 A;  2EQ3 A;  3EPK A;  2EM4 A;  1G2D C;  1TN9 A;  2EM2 A;  2ENH A;  2EPP A;  5KL5 A;  1NCS A;  1JK2 A;  5KL2 A;  2EN6 A;  1A1L A;  2EMX A;  4R2P A;  2EM3 A;  3EPH A;  2EMC A;  2EPZ A;  2LT7 A;  2EOI A;  2WBT A;  1A1J A;  2EP3 A;  3M99 B;  1BBO A;  2EOR A;  2YTI A;  2EOH A;  2YU5 A;  2MKN A;  2LV2 A;  1JK1 A;  2YTD A;  2WBS A;  2M9A A;  1X3C A;  3EPL A;  2RSI A;  1X6E A;  1UN6 B;  2CSH A;  1ZR9 A;  3MHS C;  2YSO A;  2CTD A;  2EN4 A;  2EE8 A;  1B69 A;  2MDG A;  2EMI A;  1F2I G;  2YTN A;  2GHF A;  4R2S A;  4IJD A;  2HGH A;  4IS1 C;  1ZAA C;  4R2C A;  2EPA A;  2YTG A;  2EOX A;  2YTF A;  1RMD A;  2EPC A;  2EMW A;  2EM5 A;  4R2Q A;  4R2A A;  2EOJ A;  4F6N A;  1BB8 A;  2EOE A;  2RPC A;  2YTE A;  4FK5 C;  2EN3 A;  2EN2 A;  1YSA C;  1ZU1 A;  1G2F C;  2E72 A;  1WJP A;  2EMA A;  2DRP A;  2J7J A;  2YRM A;  2YTO A;  4GZN C;  2DGC A;  2EMZ A;  1UBD C;  2ADR A;  2EMG A;  2ENC A;  2LCE A;  2I13 A;  2CT1 A;  5KL3 A;  2BB8 A;  2YTP A;  2ELZ A;  2EPR A;  2WBU A;  2DLK A;  2EQ0 A;  1TF3 A;  2EML A;  2A25 A;  2JPA A;  2EOY A;  1A1H A;  1A1I A;  2ENA A;  2EL5 A;  2EM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...