2YTPA

Solution structure of the c2h2 type zinc finger (region 687-719) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERHYECSECGKAFARKSTLIMHQRIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 687-719) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 484
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytpA01
2EMBA 1UBDC 2EOQA 2D9HA 2EMLA 2EOZA 4WSGA 2EMHA 4GZNC 2YTOA 4R2QA 1ZU1A 2LCEA 1TN9A 1UN6B 2EQ3A 2EM2A 2GHFA 2YU8A 2EMZA 4R2SA 2EPPA 2EORA 2EN4A 3EPHA 2ELZA 1YUIA 2VRDA 2YTNA 4F6NA 2EPCA 1BBOA 2EPRA 4M9VC 5KL6A 4F6MA 2EOIA 2EP3A 2DRPA 1X3CA 2EM6A 1WJPA 1BB8A 2ENAA 2YTIA 2EN3A 2I13A 2EL5A 2EOSA 2A25A 3EPJA 4R2CA 2EE8A 1YUJA 2ENCA 2YTPA 1ZAAC 2YSPA 1G2FC 2EM5A 2HGHA 3MHHC 2EN6A 2EL4A 2ADRA 2EN1A 2EMKA 2ELYA 2EOEA 2YU5A 4R2DA 1A1KA 1AAYA 2EM4A 2E72A 2EMIA 2GLIA 5KL7A 1A1IA 1LLMC 2EPUA 1A1GA 1ZR9A 2DMIA 4F2JC 2EOFA 2EPXA 2EM0A 4FK5C 5KL5A 2EL6A 2CT1A 2EJ4A 1A1FA 1NCSA 2EMWA 2MDGA 1F2IG 2JPAA 2RPCA 2EOOA 5KL3A 4IS1C 1JK1A 1MEYC 2EOJA 2EOMA 1A1JA 2LVHA 4R2PA 2JP9A 2EM7A 2YTGA 1A1HA 2WBTA 1G2DC 4R2RA 4R2AA 2WCC3 3VHTB 1RMDA 2DLKA 3M99B 2WBSA 2EQ0A 1Z1BA 3EPKA 2EMFA 1JK2A 2YSOA 2YTQA 2EM9A 1TF6A 2YRHA 1X6HA 1A1LA 2CSHA 2NABA 4X9JA 2EMGA 2YTJA 3EPLA 2EMAA 2EOXA 4R2EA 2LT7A 2CTDA 2J7JA 2LO3A 2DLQA 2R1FA 2EN8A 2EPAA 2DGCA 2MKNA 2YTFA 2EMYA 1X6EA 2RSIA 4IJDA 2LV2A 2YRKA 1DGCA 2EN2A 2EM8A 2WBUA 1B69A 3MHSC 2YRMA 1P47A 2EM3A 2ENHA 2EPZA 1YSAC 2M9AA 1KJKA 2YTEA 1TF3A 5KL4A 2EMCA 2EN7A 2EQ1A 3UK3C 2MKDA 2BB8A 1X5WA 2EMXA 5KL2A 2PRTA 2EOYA 2EOHA 2YTDA 1X6FA
chains in the Genus database with same CATH superfamily
4L8NA 5A6BA 1NEIA 5A2QC 2D9HA 2EMLA 2EOZA 5TSEA 4DR7E 2RQLA 2VQEE 2YTOA 1ZU1A 2DB2A 2LCEA 3IWCA 2GHFA 3DJWA 2LJUA 5IWAE 1YUIA 4F9AB 4F6NA 1BBOA 4F6MA 2EOIA 1GZ6A 5AASA 1WJPA 2HC5A 3HXLA 5DNYA 2NUFA 2Q8UA 1BB8A 2EN3A 2EL5A 2EOSA 1YPNA 2L92A 3J7Yp 2EE8A 4L5NC 2YTPA 4NHRA 1ZAAC 2YSPA 2EN6A 5LLQA 2YU5A 3ADGA 2EM4A 2E72A 4LF8E 1J5EE 5CFFE 1LLMC 2EPUA 4YHHE 4WSPA 3QG5C 4F2JC 5A69A 2EOFA 3C4BA 2B7VA 2YWQA 4BC9A 5LL6R 4BHBA 5KL5A 2CT1A 4GKKE 1HNXE 2M1SA 1NCSA 2VQFE 3LLHA 2F4VE 2EOJA 2LMZA 4O4KA 2JP9A 2F8BA 4DV7E 4DR2E 1G2DC 4LTYA 4R2RA 4R2AA 3J81C 2DLKA 2WBSA 3AUZA 4ZYEA 1MGTA 1X49A 2MDRA 1JK2A 2JVAA 4LU9A 4K0KE 2YTJA 4R2EA 2I9IA 2DLQA 2EN8A 3TQMA 2YTFA 1O0WA 2M4IA 2EMYA 1WHNA 1YYOA 4LFAE 4DR3E 2EPZA 2EPMX 4BCAA 2YTEA 4X8WA 4ZYHA 2RTXA 5AC5A 2WZOA 1PJSA 2BB8A 4MLQA 2EOYA 2EMKA 2UXDE 2E1MA 2LBSB 4BMJA 2EOQA 4M2ZA 3J80C 4JI4E 4JV5E 1T4OA 4WXCA 4DV2E 4DR4E 4R2QA 1TN9A 1UN6B 3RMPA 2L2MA 2NA2A 4R2SA 2EPPA 2EORA 1DI2A 4Q28A 3EPHA 2ELZA 4X66E 2NUGA 3C6KA 2YTNA 4HEIA 3T1YE 2EPCA 3F6GA 3THOB 1WRJA 2DMYA 1PKPA 3BBGA 1DQ3A 4N4RB 5LMNE 5KL6A 1STUA 2EPKX 2GPIA 4F54A 1XMOE 2EM6A 1IBME 1X47A 2M7QA 4Q35B 1T4LB 2V83A 3VK6A 3EPJA 1YFHA 4JI8E 4M0VA 1HR0E 2K7IA 4WX9A 1YUJA 3MHHC 4R2DA 4LFCE 1UHZA 1BBGA 4BS9A 1IQSA 5A6BD 1ZR9A 4WFTA 1A1GA 2NUEA 3BF2A 4WPYA 3THNA 2L6MA 3EQ1A 4HTGA 2EM0A 4GEQB 2EJ4A 4DUZE 3OTOE 2RPCA 2HHHE 2B3TB 2LVHA 1A1HA 2YTGA 2L2NA 1AH5A 2JYAA 2WBTA 4JYAE 4KHPE 4X65E 2HJJA 4DR6E 2YT4A 1RQ0A 4X62E 3M99B 1EH7A 1Z1BA 4P7DA 2H36X 1L4SA 1FKAE 1XNQE 2UXCE 2ODRC 1TF6A 1N34E 2CSHA 4JI7E 4X9JA 2EMGA 2L3CA 4I8OA 2EMAA 3K6QA 2CTDA 4NZVA 2LO3A 2R1FA 4JI5E 5FLXC 4LF5E 4DV0E 2DGCA 1HNWE 2MKNA 2B9DA 2JOXA 4IJDA 1T4NA 2EN2A 3DF6A 1XMQE 1N32E 2L33A 4LF7E 2N8XA 2M9AA 2JOBA 5KL4A 2EPLX 3UK3C 3ADIA 2EMXA 2YTDA 2VF1A 3BGHA 5A6JA 1IBLE 2EMBA 2JY9A 4BC7A 2FV4B 2V89A 2EMHA 2IHR1 2EPOA 2EQ3A 4MLVA 2YU8A 1PDAA 1N33E 2V88A 4DUYE 4O24A 4RH8A 1HNZE 2EPNA 1J26A 2V86A 1YYWA 1X3CA 3HPZA 2ENAA 2YTIA 3JAMC 3C4TA 1I94E 2YZTA 2A25A 2LTSA 2K4VA 4R2CA 2EWLA 2ENCA 2LE2A 2LTRA 2HGHA 4RHBB 2ELYA 3KZZA 1AAYA 5IXMB 1T38A 4KWYA 5T6JA 2UXBE 4NXNE 5AE3A 2DMIA 4DV4E 2UU9E 3VYXA 2B7TA 4B3SE 2EL6A 4O43A 4JI1E 2CPNA 1A1FA 3IWDA 2MDGA 1N36E 1F2IG 4BBYA 3MSWA 2N3GA 4R2PA 1KYQA 2EM7A 4LFBE 2R76A 1XNRE 1ZBTA 4DV1E 4DV3E 2LUPB 4F9BB 1PJTA 3VHTB 1RMDA 2L2KB 2LUQA 3JU0A 3EPKA 3LMLA 5AE1A 2JR1A 2EMFA 4TUGA 1X48A 3BIDA 4DKKA 3F6HA 2V8QB 2EM9A 1A1LA 3ADLA 2V87A 4R8OA 3EPLA 2DIXA 2UUCE 5IV8B 2J7JA 2MC5A 2EPAA 1QNTA 4YY3E 2N3HA 2RSIA 1IBKE 3P1XA 2LV2A 2FGGA 2YRKA 1YZ9A 2EM8A 2WBUA 1P47A 3H09A 1YSAC 4B3TE 1QU6A 1GTKA 1T39A 2FTXB 2VE7C 2DSYA 1KJKA 4ZYGA 4DR1E 1WHQA 4LF4E 2EN7A 5KL2A 1EH6A 2EOHA 4DV5E 1UBDC 2KONA 4WSGA 4GZNC 2RS7A 2EM2A 4OX9E 3VYYA 3HPSA 1EH8A 5IT9C 2EMZA 4M30A 2EN4A 5BR8E 2VRDA 2ODRD 3ADJA 5F3WA 2EPRA 4DMIA 3AV0A 2JWOA 4M9VC 1RC7A 2EP3A 4BHCA 2DRPA 1SFEA 2I13A 3ECRA 3HTXA 1SR9A 2V85A 1N3GA 4ZYDA 3FIGA 2EM5A 2ZM6E 1G2FC 2JPAA 2EL4A 2ADRA 2EN1A 1A1KA 1IMUA 2EOEA 2KHXA 4TUIA 2UUBE 2EMIA 2GLIA 4GKJE 5KL7A 1A1IA 2MC6A 4X64E 4WYQB 3J7AG 2EZ6A 2EPXA 3IWBA 4JI2E 1IQOA 2RS6A 4FK5C 4P78A 3OMLA 2EMWA 5AC4A 2EOOA 4NXME 5KL3A 4IS1C 1JK1A 1MEYC 4JI6E 2EOMA 1A1JA 1EKZA 4LF6E 5A6KA 4F9CB 4JI3E 2JXPA 5LMUE 2WCC3 3JTZA 4B3ME 2E5LE 3HQ1A 1GQEA 4DV6E 2EQ0A 2YPNA 2LJHA 4O5GA 3ZOQB 4B3RE 2YSOA 2YTQA 1PJQA 1X6HA 2BBGA 2YRHA 2G7HA 2NABA 4JI0E 5AE2A 4OOGC 4DR5E 2EOXA 2LT7A 4R03A 2RSMA 3C6MA 4AQYE 1X6EA 3KWRA 3KZYA 4WXDA 2UUAE 5A6AA 1DGCA 1UILA 4J8ZA 1B69A 4LF9E 3MHSC 2YRMA 2KOUA 2EM3A 2ENHA 4KZSA 2L8TA 2L3JA 3T1HE 1TF3A 1YYKA 3L00A 2EMCA 2LRSA 2EQ1A 1FJGE 2MKDA 1ZBQA 1X5WA 2PRTA 5ADZA 1WXRA 1X6FA
chains in the Genus database with same CATH topology
2EMBA 1UBDC 2EOQA 2D9HA 2EMLA 2EOZA 4WSGA 2EMHA 4GZNC 2YTOA 4R2QA 1ZU1A 2LCEA 1TN9A 1UN6B 2EQ3A 2EM2A 2GHFA 2YU8A 2EMZA 4R2SA 2EPPA 2EORA 2EN4A 3EPHA 2ELZA 1YUIA 2VRDA 2YTNA 4F6NA 2EPCA 1BBOA 2EPRA 4M9VC 5KL6A 4F6MA 2EOIA 2EP3A 2DRPA 1X3CA 2EM6A 1WJPA 1BB8A 2ENAA 2YTIA 2EN3A 2I13A 2EL5A 2EOSA 2A25A 3EPJA 4R2CA 2EE8A 1YUJA 2ENCA 2YTPA 1ZAAC 2YSPA 1G2FC 2EM5A 2HGHA 3MHHC 2EN6A 2EL4A 2ADRA 2EN1A 2EMKA 2ELYA 2EOEA 2YU5A 4R2DA 1A1KA 1AAYA 2EM4A 2E72A 2EMIA 2GLIA 5KL7A 1A1IA 1LLMC 2EPUA 1A1GA 1ZR9A 2DMIA 4F2JC 2EOFA 2EPXA 2EM0A 4FK5C 5KL5A 2EL6A 2CT1A 2EJ4A 1A1FA 1NCSA 2EMWA 2MDGA 1F2IG 2JPAA 2RPCA 2EOOA 5KL3A 4IS1C 1JK1A 1MEYC 2EOJA 2EOMA 1A1JA 2LVHA 4R2PA 2JP9A 2EM7A 2YTGA 1A1HA 2WBTA 1G2DC 4R2RA 4R2AA 2WCC3 3VHTB 1RMDA 2DLKA 3M99B 2WBSA 2EQ0A 1Z1BA 3EPKA 2EMFA 1JK2A 2YSOA 2YTQA 2EM9A 1TF6A 2YRHA 1X6HA 1A1LA 2CSHA 2NABA 4X9JA 2EMGA 2YTJA 3EPLA 2EMAA 2EOXA 4R2EA 2LT7A 2CTDA 2J7JA 2LO3A 2DLQA 2R1FA 2EN8A 2EPAA 2DGCA 2MKNA 2YTFA 2EMYA 1X6EA 2RSIA 4IJDA 2LV2A 2YRKA 1DGCA 2EN2A 2EM8A 2WBUA 1B69A 3MHSC 2YRMA 1P47A 2EM3A 2ENHA 2EPZA 1YSAC 2M9AA 1KJKA 2YTEA 1TF3A 5KL4A 2EMCA 2EN7A 2EQ1A 3UK3C 2MKDA 2BB8A 1X5WA 2EMXA 5KL2A 2PRTA 2EOYA 2EOHA 2YTDA 1X6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMB A;  1UBD C;  2EOQ A;  2D9H A;  2EML A;  2EOZ A;  4WSG A;  2EMH A;  4GZN C;  2YTO A;  4R2Q A;  1ZU1 A;  2LCE A;  1TN9 A;  1UN6 B;  2EQ3 A;  2EM2 A;  2GHF A;  2YU8 A;  2EMZ A;  4R2S A;  2EPP A;  2EOR A;  2EN4 A;  3EPH A;  2ELZ A;  1YUI A;  2VRD A;  2YTN A;  4F6N A;  2EPC A;  1BBO A;  2EPR A;  4M9V C;  5KL6 A;  4F6M A;  2EOI A;  2EP3 A;  2DRP A;  1X3C A;  2EM6 A;  1WJP A;  1BB8 A;  2ENA A;  2YTI A;  2EN3 A;  2I13 A;  2EL5 A;  2EOS A;  2A25 A;  3EPJ A;  4R2C A;  2EE8 A;  1YUJ A;  2ENC A;  2YTP A;  1ZAA C;  2YSP A;  1G2F C;  2EM5 A;  2HGH A;  3MHH C;  2EN6 A;  2EL4 A;  2ADR A;  2EN1 A;  2EMK A;  2ELY A;  2EOE A;  2YU5 A;  4R2D A;  1A1K A;  1AAY A;  2EM4 A;  2E72 A;  2EMI A;  2GLI A;  5KL7 A;  1A1I A;  1LLM C;  2EPU A;  1A1G A;  1ZR9 A;  2DMI A;  4F2J C;  2EOF A;  2EPX A;  2EM0 A;  4FK5 C;  5KL5 A;  2EL6 A;  2CT1 A;  2EJ4 A;  1A1F A;  1NCS A;  2EMW A;  2MDG A;  1F2I G;  2JPA A;  2RPC A;  2EOO A;  5KL3 A;  4IS1 C;  1JK1 A;  1MEY C;  2EOJ A;  2EOM A;  1A1J A;  2LVH A;  4R2P A;  2JP9 A;  2EM7 A;  2YTG A;  1A1H A;  2WBT A;  1G2D C;  4R2R A;  4R2A A;  2WCC 3;  3VHT B;  1RMD A;  2DLK A;  3M99 B;  2WBS A;  2EQ0 A;  1Z1B A;  3EPK A;  2EMF A;  1JK2 A;  2YSO A;  2YTQ A;  2EM9 A;  1TF6 A;  2YRH A;  1X6H A;  1A1L A;  2CSH A;  2NAB A;  4X9J A;  2EMG A;  2YTJ A;  3EPL A;  2EMA A;  2EOX A;  4R2E A;  2LT7 A;  2CTD A;  2J7J A;  2LO3 A;  2DLQ A;  2R1F A;  2EN8 A;  2EPA A;  2DGC A;  2MKN A;  2YTF A;  2EMY A;  1X6E A;  2RSI A;  4IJD A;  2LV2 A;  2YRK A;  1DGC A;  2EN2 A;  2EM8 A;  2WBU A;  1B69 A;  3MHS C;  2YRM A;  1P47 A;  2EM3 A;  2ENH A;  2EPZ A;  1YSA C;  2M9A A;  1KJK A;  2YTE A;  1TF3 A;  5KL4 A;  2EMC A;  2EN7 A;  2EQ1 A;  3UK3 C;  2MKD A;  2BB8 A;  1X5W A;  2EMX A;  5KL2 A;  2PRT A;  2EOY A;  2EOH A;  2YTD A;  1X6F A; 
#chains in the Genus database with same CATH topology
 4L8N A;  5A6B A;  1NEI A;  5A2Q C;  2D9H A;  2EML A;  2EOZ A;  5TSE A;  4DR7 E;  2RQL A;  2VQE E;  2YTO A;  1ZU1 A;  2DB2 A;  2LCE A;  3IWC A;  2GHF A;  3DJW A;  2LJU A;  5IWA E;  1YUI A;  4F9A B;  4F6N A;  1BBO A;  4F6M A;  2EOI A;  1GZ6 A;  5AAS A;  1WJP A;  2HC5 A;  3HXL A;  5DNY A;  2NUF A;  2Q8U A;  1BB8 A;  2EN3 A;  2EL5 A;  2EOS A;  1YPN A;  2L92 A;  3J7Y p;  2EE8 A;  4L5N C;  2YTP A;  4NHR A;  1ZAA C;  2YSP A;  2EN6 A;  5LLQ A;  2YU5 A;  3ADG A;  2EM4 A;  2E72 A;  4LF8 E;  1J5E E;  5CFF E;  1LLM C;  2EPU A;  4YHH E;  4WSP A;  3QG5 C;  4F2J C;  5A69 A;  2EOF A;  3C4B A;  2B7V A;  2YWQ A;  4BC9 A;  5LL6 R;  4BHB A;  5KL5 A;  2CT1 A;  4GKK E;  1HNX E;  2M1S A;  1NCS A;  2VQF E;  3LLH A;  2F4V E;  2EOJ A;  2LMZ A;  4O4K A;  2JP9 A;  2F8B A;  4DV7 E;  4DR2 E;  1G2D C;  4LTY A;  4R2R A;  4R2A A;  3J81 C;  2DLK A;  2WBS A;  3AUZ A;  4ZYE A;  1MGT A;  1X49 A;  2MDR A;  1JK2 A;  2JVA A;  4LU9 A;  4K0K E;  2YTJ A;  4R2E A;  2I9I A;  2DLQ A;  2EN8 A;  3TQM A;  2YTF A;  1O0W A;  2M4I A;  2EMY A;  1WHN A;  1YYO A;  4LFA E;  4DR3 E;  2EPZ A;  2EPM X;  4BCA A;  2YTE A;  4X8W A;  4ZYH A;  2RTX A;  5AC5 A;  2WZO A;  1PJS A;  2BB8 A;  4MLQ A;  2EOY A;  2EMK A;  2UXD E;  2E1M A;  2LBS B;  4BMJ A;  2EOQ A;  4M2Z A;  3J80 C;  4JI4 E;  4JV5 E;  1T4O A;  4WXC A;  4DV2 E;  4DR4 E;  4R2Q A;  1TN9 A;  1UN6 B;  3RMP A;  2L2M A;  2NA2 A;  4R2S A;  2EPP A;  2EOR A;  1DI2 A;  4Q28 A;  3EPH A;  2ELZ A;  4X66 E;  2NUG A;  3C6K A;  2YTN A;  4HEI A;  3T1Y E;  2EPC A;  3F6G A;  3THO B;  1WRJ A;  2DMY A;  1PKP A;  3BBG A;  1DQ3 A;  4N4R B;  5LMN E;  5KL6 A;  1STU A;  2EPK X;  2GPI A;  4F54 A;  1XMO E;  2EM6 A;  1IBM E;  1X47 A;  2M7Q A;  4Q35 B;  1T4L B;  2V83 A;  3VK6 A;  3EPJ A;  1YFH A;  4JI8 E;  4M0V A;  1HR0 E;  2K7I A;  4WX9 A;  1YUJ A;  3MHH C;  4R2D A;  4LFC E;  1UHZ A;  1BBG A;  4BS9 A;  1IQS A;  5A6B D;  1ZR9 A;  4WFT A;  1A1G A;  2NUE A;  3BF2 A;  4WPY A;  3THN A;  2L6M A;  3EQ1 A;  4HTG A;  2EM0 A;  4GEQ B;  2EJ4 A;  4DUZ E;  3OTO E;  2RPC A;  2HHH E;  2B3T B;  2LVH A;  1A1H A;  2YTG A;  2L2N A;  1AH5 A;  2JYA A;  2WBT A;  4JYA E;  4KHP E;  4X65 E;  2HJJ A;  4DR6 E;  2YT4 A;  1RQ0 A;  4X62 E;  3M99 B;  1EH7 A;  1Z1B A;  4P7D A;  2H36 X;  1L4S A;  1FKA E;  1XNQ E;  2UXC E;  2ODR C;  1TF6 A;  1N34 E;  2CSH A;  4JI7 E;  4X9J A;  2EMG A;  2L3C A;  4I8O A;  2EMA A;  3K6Q A;  2CTD A;  4NZV A;  2LO3 A;  2R1F A;  4JI5 E;  5FLX C;  4LF5 E;  4DV0 E;  2DGC A;  1HNW E;  2MKN A;  2B9D A;  2JOX A;  4IJD A;  1T4N A;  2EN2 A;  3DF6 A;  1XMQ E;  1N32 E;  2L33 A;  4LF7 E;  2N8X A;  2M9A A;  2JOB A;  5KL4 A;  2EPL X;  3UK3 C;  3ADI A;  2EMX A;  2YTD A;  2VF1 A;  3BGH A;  5A6J A;  1IBL E;  2EMB A;  2JY9 A;  4BC7 A;  2FV4 B;  2V89 A;  2EMH A;  2IHR 1;  2EPO A;  2EQ3 A;  4MLV A;  2YU8 A;  1PDA A;  1N33 E;  2V88 A;  4DUY E;  4O24 A;  4RH8 A;  1HNZ E;  2EPN A;  1J26 A;  2V86 A;  1YYW A;  1X3C A;  3HPZ A;  2ENA A;  2YTI A;  3JAM C;  3C4T A;  1I94 E;  2YZT A;  2A25 A;  2LTS A;  2K4V A;  4R2C A;  2EWL A;  2ENC A;  2LE2 A;  2LTR A;  2HGH A;  4RHB B;  2ELY A;  3KZZ A;  1AAY A;  5IXM B;  1T38 A;  4KWY A;  5T6J A;  2UXB E;  4NXN E;  5AE3 A;  2DMI A;  4DV4 E;  2UU9 E;  3VYX A;  2B7T A;  4B3S E;  2EL6 A;  4O43 A;  4JI1 E;  2CPN A;  1A1F A;  3IWD A;  2MDG A;  1N36 E;  1F2I G;  4BBY A;  3MSW A;  2N3G A;  4R2P A;  1KYQ A;  2EM7 A;  4LFB E;  2R76 A;  1XNR E;  1ZBT A;  4DV1 E;  4DV3 E;  2LUP B;  4F9B B;  1PJT A;  3VHT B;  1RMD A;  2L2K B;  2LUQ A;  3JU0 A;  3EPK A;  3LML A;  5AE1 A;  2JR1 A;  2EMF A;  4TUG A;  1X48 A;  3BID A;  4DKK A;  3F6H A;  2V8Q B;  2EM9 A;  1A1L A;  3ADL A;  2V87 A;  4R8O A;  3EPL A;  2DIX A;  2UUC E;  5IV8 B;  2J7J A;  2MC5 A;  2EPA A;  1QNT A;  4YY3 E;  2N3H A;  2RSI A;  1IBK E;  3P1X A;  2LV2 A;  2FGG A;  2YRK A;  1YZ9 A;  2EM8 A;  2WBU A;  1P47 A;  3H09 A;  1YSA C;  4B3T E;  1QU6 A;  1GTK A;  1T39 A;  2FTX B;  2VE7 C;  2DSY A;  1KJK A;  4ZYG A;  4DR1 E;  1WHQ A;  4LF4 E;  2EN7 A;  5KL2 A;  1EH6 A;  2EOH A;  4DV5 E;  1UBD C;  2KON A;  4WSG A;  4GZN C;  2RS7 A;  2EM2 A;  4OX9 E;  3VYY A;  3HPS A;  1EH8 A;  5IT9 C;  2EMZ A;  4M30 A;  2EN4 A;  5BR8 E;  2VRD A;  2ODR D;  3ADJ A;  5F3W A;  2EPR A;  4DMI A;  3AV0 A;  2JWO A;  4M9V C;  1RC7 A;  2EP3 A;  4BHC A;  2DRP A;  1SFE A;  2I13 A;  3ECR A;  3HTX A;  1SR9 A;  2V85 A;  1N3G A;  4ZYD A;  3FIG A;  2EM5 A;  2ZM6 E;  1G2F C;  2JPA A;  2EL4 A;  2ADR A;  2EN1 A;  1A1K A;  1IMU A;  2EOE A;  2KHX A;  4TUI A;  2UUB E;  2EMI A;  2GLI A;  4GKJ E;  5KL7 A;  1A1I A;  2MC6 A;  4X64 E;  4WYQ B;  3J7A G;  2EZ6 A;  2EPX A;  3IWB A;  4JI2 E;  1IQO A;  2RS6 A;  4FK5 C;  4P78 A;  3OML A;  2EMW A;  5AC4 A;  2EOO A;  4NXM E;  5KL3 A;  4IS1 C;  1JK1 A;  1MEY C;  4JI6 E;  2EOM A;  1A1J A;  1EKZ A;  4LF6 E;  5A6K A;  4F9C B;  4JI3 E;  2JXP A;  5LMU E;  2WCC 3;  3JTZ A;  4B3M E;  2E5L E;  3HQ1 A;  1GQE A;  4DV6 E;  2EQ0 A;  2YPN A;  2LJH A;  4O5G A;  3ZOQ B;  4B3R E;  2YSO A;  2YTQ A;  1PJQ A;  1X6H A;  2BBG A;  2YRH A;  2G7H A;  2NAB A;  4JI0 E;  5AE2 A;  4OOG C;  4DR5 E;  2EOX A;  2LT7 A;  4R03 A;  2RSM A;  3C6M A;  4AQY E;  1X6E A;  3KWR A;  3KZY A;  4WXD A;  2UUA E;  5A6A A;  1DGC A;  1UIL A;  4J8Z A;  1B69 A;  4LF9 E;  3MHS C;  2YRM A;  2KOU A;  2EM3 A;  2ENH A;  4KZS A;  2L8T A;  2L3J A;  3T1H E;  1TF3 A;  1YYK A;  3L00 A;  2EMC A;  2LRS A;  2EQ1 A;  1FJG E;  2MKD A;  1ZBQ A;  1X5W A;  2PRT A;  5ADZ A;  1WXR A;  1X6F A; 
#chains in the Genus database with same CATH homology
 2EMB A;  1UBD C;  2EOQ A;  2D9H A;  2EML A;  2EOZ A;  4WSG A;  2EMH A;  4GZN C;  2YTO A;  4R2Q A;  1ZU1 A;  2LCE A;  1TN9 A;  1UN6 B;  2EQ3 A;  2EM2 A;  2GHF A;  2YU8 A;  2EMZ A;  4R2S A;  2EPP A;  2EOR A;  2EN4 A;  3EPH A;  2ELZ A;  1YUI A;  2VRD A;  2YTN A;  4F6N A;  2EPC A;  1BBO A;  2EPR A;  4M9V C;  5KL6 A;  4F6M A;  2EOI A;  2EP3 A;  2DRP A;  1X3C A;  2EM6 A;  1WJP A;  1BB8 A;  2ENA A;  2YTI A;  2EN3 A;  2I13 A;  2EL5 A;  2EOS A;  2A25 A;  3EPJ A;  4R2C A;  2EE8 A;  1YUJ A;  2ENC A;  2YTP A;  1ZAA C;  2YSP A;  1G2F C;  2EM5 A;  2HGH A;  3MHH C;  2EN6 A;  2EL4 A;  2ADR A;  2EN1 A;  2EMK A;  2ELY A;  2EOE A;  2YU5 A;  4R2D A;  1A1K A;  1AAY A;  2EM4 A;  2E72 A;  2EMI A;  2GLI A;  5KL7 A;  1A1I A;  1LLM C;  2EPU A;  1A1G A;  1ZR9 A;  2DMI A;  4F2J C;  2EOF A;  2EPX A;  2EM0 A;  4FK5 C;  5KL5 A;  2EL6 A;  2CT1 A;  2EJ4 A;  1A1F A;  1NCS A;  2EMW A;  2MDG A;  1F2I G;  2JPA A;  2RPC A;  2EOO A;  5KL3 A;  4IS1 C;  1JK1 A;  1MEY C;  2EOJ A;  2EOM A;  1A1J A;  2LVH A;  4R2P A;  2JP9 A;  2EM7 A;  2YTG A;  1A1H A;  2WBT A;  1G2D C;  4R2R A;  4R2A A;  2WCC 3;  3VHT B;  1RMD A;  2DLK A;  3M99 B;  2WBS A;  2EQ0 A;  1Z1B A;  3EPK A;  2EMF A;  1JK2 A;  2YSO A;  2YTQ A;  2EM9 A;  1TF6 A;  2YRH A;  1X6H A;  1A1L A;  2CSH A;  2NAB A;  4X9J A;  2EMG A;  2YTJ A;  3EPL A;  2EMA A;  2EOX A;  4R2E A;  2LT7 A;  2CTD A;  2J7J A;  2LO3 A;  2DLQ A;  2R1F A;  2EN8 A;  2EPA A;  2DGC A;  2MKN A;  2YTF A;  2EMY A;  1X6E A;  2RSI A;  4IJD A;  2LV2 A;  2YRK A;  1DGC A;  2EN2 A;  2EM8 A;  2WBU A;  1B69 A;  3MHS C;  2YRM A;  1P47 A;  2EM3 A;  2ENH A;  2EPZ A;  1YSA C;  2M9A A;  1KJK A;  2YTE A;  1TF3 A;  5KL4 A;  2EMC A;  2EN7 A;  2EQ1 A;  3UK3 C;  2MKD A;  2BB8 A;  1X5W A;  2EMX A;  5KL2 A;  2PRT A;  2EOY A;  2EOH A;  2YTD A;  1X6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...