2YTPA

Solution structure of the c2h2 type zinc finger (region 687-719) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERHYECSECGKAFARKSTLIMHQRIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 687-719) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytpA01
1ZU1A 1X6FA 2EN2A 2CT1A 2I13A 2YTFA 1A1HA 1P47A 1X6HA 2J7JA 2MKDA 2EM3A 2EOOA 2JPAA 3MHSC 1WJPA 1G2DC 4F6MA 2R1FA 1AAYA 2WBSA 2EPUA 2EOSA 5KL5A 2EN7A 2YTOA 1ZAAC 2EMFA 2EMAA 2EN8A 2EPAA 2ENAA 2MKNA 2EOFA 2EOQA 2EM4A 1X6EA 4WSGA 1JK1A 2NABA 2WBUA 2WCC3 1A1GA 1YUJA 2ELYA 4R2EA 2CTDA 2DGCA 2HGHA 2WBTA 1KJKA 2EL5A 2EMYA 1B69A 1UN6B 2DRPA 2ADRA 2EE8A 2EMBA 2EN4A 2YTQA 1ZR9A 2YTJA 1Z1BA 2GLIA 1X3CA 1LLMC 2EPPA 2LVHA 2EOHA 2GHFA 2YTIA 2EQ0A 3MHHC 2YU8A 4FK5C 1UBDC 3EPHA 1NCSA 2EPRA 4R2RA 2DMIA 2EMZA 2YTNA 2EM6A 3EPJA 4IS1C 2EMKA 2EMGA 1A1LA 2DLQA 2EPCA 2MDGA 4R2QA 4F2JC 1G2FC 2LCEA 5KL4A 2EMWA 2YTPA 4GZNC 2EL4A 1TN9A 4M9VC 5KL2A 3UK3C 2YU5A 4R2AA 2EMHA 2EORA 1A1IA 4F6NA 1YUIA 2EMIA 4R2DA 2CSHA 2LT7A 1A1KA 1RMDA 2YTGA 2EOIA 2LV2A 4R2CA 4R2SA 2RPCA 3M99B 2EMCA 2LO3A 1TF6A 4IJDA 2EM8A 2D9HA 1X5WA 2A25A 2EM2A 2EOXA 2EN6A 2EJ4A 2EM9A 2YTEA 4X9JA 2EPZA 2JP9A 2EOEA 1DGCA 1MEYC 2EQ1A 2EN1A 2E72A 2EP3A 1BB8A 2EPXA 2BB8A 1JK2A 2VRDA 1YSAC 1TF3A 5KL3A 3EPKA 2EOZA 2RSIA 3VHTB 1A1FA 2EM7A 2EQ3A 2YSOA 1F2IG 2ELZA 1A1JA 2EOMA 2EL6A 2EN3A 2ENCA 2YSPA 2PRTA 2YTDA 2EOYA 3EPLA 2DLKA 2M9AA 2YRMA 5KL7A 2EMLA 2YRHA 5KL6A 2EM0A 2YRKA 2EMXA 4R2PA 2EOJA 2ENHA 2EM5A 1BBOA
chains in the Genus database with same CATH superfamily
1ZU1A 5ADZA 5FLXC 2VF1A 2L3JA 2CT1A 2JY9A 4JI1E 2E5LE 1X6HA 2J7JA 2EM3A 4O4KA 4WX9A 2JPAA 4TUIA 2EPOA 3MHSC 3THNA 4KHPE 3AV0A 2NA2A 4X66E 4LTYA 4OOGC 4R03A 1AAYA 2EPUA 4O43A 1PDAA 2LJUA 2EMFA 3JU0A 4J8ZA 1MGTA 2YZTA 4MLQA 5DNYA 2EOFA 1GZ6A 2F4VE 4DV7E 4LF8E 1A1GA 2NUGA 1XMQE 1X49A 2N3GA 4OX9E 3THOB 2JVAA 2DMYA 2VE7C 3IWCA 2EMBA 2RSMA 3C6KA 4DUYE 3HTXA 2IHR1 2GLIA 3BBGA 2EPPA 2M7QA 2LVHA 2GHFA 4FK5C 1UBDC 2DMIA 2EMZA 1XMOE 3F6GA 5T6JA 5AE1A 2V8QB 2EMKA 2EMGA 2LJHA 4ZYGA 1L4SA 1PJTA 4F9CB 4R2QA 1G2FC 2EL4A 4M9VC 2ODRD 2WZOA 4R2AA 2FTXB 4DV3E 2EMIA 4R2DA 2LT7A 3J7AG 1WHQA 1A1KA 1T39A 2UUCE 2LV2A 4R2SA 2EMCA 2LO3A 1X48A 2LUPB 1RC7A 2D9HA 2A25A 4X8WA 2EM2A 2EJ4A 2HHHE 4X9JA 1IBLE 2DB2A 4B3ME 2EZ6A 1DGCA 4JV5E 1IQSA 1WRJA 2EN1A 4JI6E 3VK6A 1JK2A 3C6MA 1YSAC 2YPNA 4L5NC 5A6JA 1YZ9A 2EOZA 2LTRA 5IT9C 2EM7A 2YSOA 2RS7A 2EOMA 4LFAE 1HNZE 2L8TA 3LMLA 3AUZA 3EPLA 4M2ZA 4RHBB 3BGHA 4DV0E 4M0VA 2V83A 4KZSA 2NUFA 4JI4E 1BBOA 1X6FA 4N4RB 4RH8A 1GQEA 2K4VA 1QU6A 2V89A 1A1HA 2K7IA 2RQLA 2G7HA 4B3TE 1ZBQA 4JI8E 4F6MA 2F8BA 3H09A 2LMZA 2WBSA 5KL5A 2EOSA 4ZYHA 1FKAE 2JR1A 1YYOA 1ZAAC 3DF6A 2EPKX 1DI2A 4F54A 2EOQA 2EM4A 4WSGA 1JK1A 2ELYA 2CTDA 2UXDE 4MLVA 5AC5A 2EL5A 2EMYA 1B69A 1UN6B 2BBGA 2YTJA 4I8OA 3L00A 4P78A 5LLQA 5TSEA 3OMLA 4JI2E 2V85A 1IBME 1PJQA 4P7DA 4WXCA 4DMIA 1IQOA 4LF7E 4LF6E 5KL4A 4GZNC 2GPIA 2YU5A 1HNWE 2UXBE 2EMHA 2EORA 1A1IA 2DIXA 1YUIA 5A69A 3JTZA 5AE2A 3KZYA 1ZBTA 4NHRA 3JAMC 5A6BA 1EH8A 3ADIA 4GKJE 2EM8A 4B3RE 3MSWA 4DV2E 2EOXA 2EM9A 2H36X 5AASA 5A2QC 2JP9A 2EOEA 1MEYC 4DV1E 2EP3A 1BB8A 4DUZE 4L8NA 1DQ3A 2BB8A 1X47A 2JOBA 2JWOA 3T1YE 4DV5E 1EKZA 4GKKE 3KZZA 1J5EE 1A1FA 2EQ3A 2EPLX 2ENCA 1UHZA 1XNRE 2LTSA 2YTDA 4LF4E 2DLKA 1WHNA 5A6BD 1SFEA 2LE2A 3J81C 1NEIA 3IWDA 2EMLA 5KL6A 4R2PA 4DR7E 2EOJA 2EM5A 4Q28A 4X64E 4DR6E 2I9IA 2EPMX 2FGGA 2EPNA 4JI3E 3T1HE 2MC6A 2B7VA 3J7Yp 4O24A 3F6HA 1AH5A 4X62E 1WJPA 4NZVA 4LU9A 2R1FA 1YYWA 2L2MA 3ADGA 3IWBA 4BHBA 3J80C 2EN7A 2YTOA 2L6MA 1T4NA 4BS9A 2EN8A 2UXCE 2EPAA 3C4BA 4BBYA 1X6EA 2NABA 4ZYEA 2WBUA 1YUJA 4R2EA 2HGHA 2DGCA 1YYKA 1BBGA 3OTOE 5LL6R 5AE3A 2UUAE 1EH7A 4JI0E 4O5GA 2DRPA 3TQMA 1ZR9A 1PJSA 2KONA 1X3CA 2LUQA 3HXLA 5AC4A 2HC5A 1KYQA 2YU8A 4JI5E 1NCSA 4AQYE 2EPRA 4R2RA 2CPNA 1T4LB 4BMJA 4NXNE 1N32E 5A6AA 3QG5C 2YTNA 2EM6A 4IS1C 4F9BB 1A1LA 2EPCA 1XNQE 2LCEA 4JI7E 2EMWA 1PKPA 2YTPA 4JYAE 5KL2A 1IBKE 5BR8E 4F6NA 2JXPA 2JYAA 3EQ1A 2CSHA 3KWRA 2DSYA 1RMDA 4BC7A 1HNXE 2KOUA 4B3SE 3M99B 4LF5E 2M4IA 4Q35B 2EWLA 4GEQB 3ADJA 4K0KE 2EQ1A 3HPZA 5IWAE 1I94E 1N34E 5IV8B 2MC5A 2B9DA 4M30A 4HTGA 1TF3A 2YWQA 2MDRA 2YT4A 2RTXA 3EPKA 2L3CA 2ZM6E 1HR0E 1RQ0A 3C4TA 3BIDA 3LLHA 3VHTB 4DV6E 2EL6A 4WXDA 1IMUA 1N3GA 2M1SA 4WPYA 5F3WA 1FJGE 2M9AA 1UILA 2VQEE 3ECRA 2N8XA 4YHHE 2EM0A 2YRKA 2E1MA 2EMXA 2FV4B 4ZYDA 2ENHA 4DR5E 2V87A 3RMPA 2EN2A 2I13A 2YTFA 5LMUE 1P47A 1YFHA 2MKDA 2EOOA 4WYQB 2L33A 4KWYA 1G2DC 3DJWA 4BC9A 3VYYA 4DR3E 3HPSA 2EMAA 2B7TA 4F9AB 4DKKA 2JOXA 2UUBE 2ENAA 5IXMB 3ZOQB 2MKNA 5LMNE 2WCC3 2WBTA 1KJKA 2ADRA 2EE8A 4HEIA 2EN4A 2YTQA 1Z1BA 1T38A 5CFFE 1SR9A 4WFTA 1LLMC 2EOHA 3MHHC 2YTIA 2EQ0A 3EPHA 2KHXA 4BCAA 3HQ1A 2NUEA 2L2NA 3EPJA 2VQFE 3FIGA 2DLQA 1T4OA 2MDGA 4F2JC 2L92A 1O0WA 4BHCA 1TN9A 1GTKA 3UK3C 3BF2A 4LFCE 4DR2E 4TUGA 1EH6A 2Q8UA 2YTGA 2EOIA 4R2CA 2RPCA 1TF6A 1YPNA 4IJDA 1X5WA 3P1XA 2RS6A 2LBSB 4LFBE 2EN6A 2YTEA 1J26A 2EPZA 2ODRC 5A6KA 4YY3E 2E72A 4X65E 1WXRA 2EPXA 2N3HA 1N33E 4LF9E 2VRDA 1QNTA 2UU9E 5KL3A 2R76A 2RSIA 2LRSA 4DV4E 1F2IG 2ELZA 1A1JA 2EN3A 2YSPA 2PRTA 2EOYA 4R8OA 1N36E 2V86A 4DR1E 2L2KB 2YRMA 3ADLA 4DR4E 2B3TB 5KL7A 2YRHA 2V88A 4WSPA 2HJJA 1STUA 3K6QA 3VYXA 4NXME
chains in the Genus database with same CATH topology
1ZU1A 1X6FA 2EN2A 2CT1A 2I13A 2YTFA 1A1HA 1P47A 1X6HA 2J7JA 2MKDA 2EM3A 2EOOA 2JPAA 3MHSC 1WJPA 1G2DC 4F6MA 2R1FA 1AAYA 2WBSA 2EPUA 2EOSA 5KL5A 2EN7A 2YTOA 1ZAAC 2EMFA 2EMAA 2EN8A 2EPAA 2ENAA 2MKNA 2EOFA 2EOQA 2EM4A 1X6EA 4WSGA 1JK1A 2NABA 2WBUA 2WCC3 1A1GA 1YUJA 2ELYA 4R2EA 2CTDA 2DGCA 2HGHA 2WBTA 1KJKA 2EL5A 2EMYA 1B69A 1UN6B 2DRPA 2ADRA 2EE8A 2EMBA 2EN4A 2YTQA 1ZR9A 2YTJA 1Z1BA 2GLIA 1X3CA 1LLMC 2EPPA 2LVHA 2EOHA 2GHFA 2YTIA 2EQ0A 3MHHC 2YU8A 4FK5C 1UBDC 3EPHA 1NCSA 2EPRA 4R2RA 2DMIA 2EMZA 2YTNA 2EM6A 3EPJA 4IS1C 2EMKA 2EMGA 1A1LA 2DLQA 2EPCA 2MDGA 4R2QA 4F2JC 1G2FC 2LCEA 5KL4A 2EMWA 2YTPA 4GZNC 2EL4A 1TN9A 4M9VC 5KL2A 3UK3C 2YU5A 4R2AA 2EMHA 2EORA 1A1IA 4F6NA 1YUIA 2EMIA 4R2DA 2CSHA 2LT7A 1A1KA 1RMDA 2YTGA 2EOIA 2LV2A 4R2CA 4R2SA 2RPCA 3M99B 2EMCA 2LO3A 1TF6A 4IJDA 2EM8A 2D9HA 1X5WA 2A25A 2EM2A 2EOXA 2EN6A 2EJ4A 2EM9A 2YTEA 4X9JA 2EPZA 2JP9A 2EOEA 1DGCA 1MEYC 2EQ1A 2EN1A 2E72A 2EP3A 1BB8A 2EPXA 2BB8A 1JK2A 2VRDA 1YSAC 1TF3A 5KL3A 3EPKA 2EOZA 2RSIA 3VHTB 1A1FA 2EM7A 2EQ3A 2YSOA 1F2IG 2ELZA 1A1JA 2EOMA 2EL6A 2EN3A 2ENCA 2YSPA 2PRTA 2YTDA 2EOYA 3EPLA 2DLKA 2M9AA 2YRMA 5KL7A 2EMLA 2YRHA 5KL6A 2EM0A 2YRKA 2EMXA 4R2PA 2EOJA 2ENHA 2EM5A 1BBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU1 A;  1X6F A;  2EN2 A;  2CT1 A;  2I13 A;  2YTF A;  1A1H A;  1P47 A;  1X6H A;  2J7J A;  2MKD A;  2EM3 A;  2EOO A;  2JPA A;  3MHS C;  1WJP A;  1G2D C;  4F6M A;  2R1F A;  1AAY A;  2WBS A;  2EPU A;  2EOS A;  5KL5 A;  2EN7 A;  2YTO A;  1ZAA C;  2EMF A;  2EMA A;  2EN8 A;  2EPA A;  2ENA A;  2MKN A;  2EOF A;  2EOQ A;  2EM4 A;  1X6E A;  4WSG A;  1JK1 A;  2NAB A;  2WBU A;  2WCC 3;  1A1G A;  1YUJ A;  2ELY A;  4R2E A;  2CTD A;  2DGC A;  2HGH A;  2WBT A;  1KJK A;  2EL5 A;  2EMY A;  1B69 A;  1UN6 B;  2DRP A;  2ADR A;  2EE8 A;  2EMB A;  2EN4 A;  2YTQ A;  1ZR9 A;  2YTJ A;  1Z1B A;  2GLI A;  1X3C A;  1LLM C;  2EPP A;  2LVH A;  2EOH A;  2GHF A;  2YTI A;  2EQ0 A;  3MHH C;  2YU8 A;  4FK5 C;  1UBD C;  3EPH A;  1NCS A;  2EPR A;  4R2R A;  2DMI A;  2EMZ A;  2YTN A;  2EM6 A;  3EPJ A;  4IS1 C;  2EMK A;  2EMG A;  1A1L A;  2DLQ A;  2EPC A;  2MDG A;  4R2Q A;  4F2J C;  1G2F C;  2LCE A;  5KL4 A;  2EMW A;  2YTP A;  4GZN C;  2EL4 A;  1TN9 A;  4M9V C;  5KL2 A;  3UK3 C;  2YU5 A;  4R2A A;  2EMH A;  2EOR A;  1A1I A;  4F6N A;  1YUI A;  2EMI A;  4R2D A;  2CSH A;  2LT7 A;  1A1K A;  1RMD A;  2YTG A;  2EOI A;  2LV2 A;  4R2C A;  4R2S A;  2RPC A;  3M99 B;  2EMC A;  2LO3 A;  1TF6 A;  4IJD A;  2EM8 A;  2D9H A;  1X5W A;  2A25 A;  2EM2 A;  2EOX A;  2EN6 A;  2EJ4 A;  2EM9 A;  2YTE A;  4X9J A;  2EPZ A;  2JP9 A;  2EOE A;  1DGC A;  1MEY C;  2EQ1 A;  2EN1 A;  2E72 A;  2EP3 A;  1BB8 A;  2EPX A;  2BB8 A;  1JK2 A;  2VRD A;  1YSA C;  1TF3 A;  5KL3 A;  3EPK A;  2EOZ A;  2RSI A;  3VHT B;  1A1F A;  2EM7 A;  2EQ3 A;  2YSO A;  1F2I G;  2ELZ A;  1A1J A;  2EOM A;  2EL6 A;  2EN3 A;  2ENC A;  2YSP A;  2PRT A;  2YTD A;  2EOY A;  3EPL A;  2DLK A;  2M9A A;  2YRM A;  5KL7 A;  2EML A;  2YRH A;  5KL6 A;  2EM0 A;  2YRK A;  2EMX A;  4R2P A;  2EOJ A;  2ENH A;  2EM5 A;  1BBO A; 
#chains in the Genus database with same CATH topology
 1ZU1 A;  5ADZ A;  5FLX C;  2VF1 A;  2L3J A;  2CT1 A;  2JY9 A;  4JI1 E;  2E5L E;  1X6H A;  2J7J A;  2EM3 A;  4O4K A;  4WX9 A;  2JPA A;  4TUI A;  2EPO A;  3MHS C;  3THN A;  4KHP E;  3AV0 A;  2NA2 A;  4X66 E;  4LTY A;  4OOG C;  4R03 A;  1AAY A;  2EPU A;  4O43 A;  1PDA A;  2LJU A;  2EMF A;  3JU0 A;  4J8Z A;  1MGT A;  2YZT A;  4MLQ A;  5DNY A;  2EOF A;  1GZ6 A;  2F4V E;  4DV7 E;  4LF8 E;  1A1G A;  2NUG A;  1XMQ E;  1X49 A;  2N3G A;  4OX9 E;  3THO B;  2JVA A;  2DMY A;  2VE7 C;  3IWC A;  2EMB A;  2RSM A;  3C6K A;  4DUY E;  3HTX A;  2IHR 1;  2GLI A;  3BBG A;  2EPP A;  2M7Q A;  2LVH A;  2GHF A;  4FK5 C;  1UBD C;  2DMI A;  2EMZ A;  1XMO E;  3F6G A;  5T6J A;  5AE1 A;  2V8Q B;  2EMK A;  2EMG A;  2LJH A;  4ZYG A;  1L4S A;  1PJT A;  4F9C B;  4R2Q A;  1G2F C;  2EL4 A;  4M9V C;  2ODR D;  2WZO A;  4R2A A;  2FTX B;  4DV3 E;  2EMI A;  4R2D A;  2LT7 A;  3J7A G;  1WHQ A;  1A1K A;  1T39 A;  2UUC E;  2LV2 A;  4R2S A;  2EMC A;  2LO3 A;  1X48 A;  2LUP B;  1RC7 A;  2D9H A;  2A25 A;  4X8W A;  2EM2 A;  2EJ4 A;  2HHH E;  4X9J A;  1IBL E;  2DB2 A;  4B3M E;  2EZ6 A;  1DGC A;  4JV5 E;  1IQS A;  1WRJ A;  2EN1 A;  4JI6 E;  3VK6 A;  1JK2 A;  3C6M A;  1YSA C;  2YPN A;  4L5N C;  5A6J A;  1YZ9 A;  2EOZ A;  2LTR A;  5IT9 C;  2EM7 A;  2YSO A;  2RS7 A;  2EOM A;  4LFA E;  1HNZ E;  2L8T A;  3LML A;  3AUZ A;  3EPL A;  4M2Z A;  4RHB B;  3BGH A;  4DV0 E;  4M0V A;  2V83 A;  4KZS A;  2NUF A;  4JI4 E;  1BBO A;  1X6F A;  4N4R B;  4RH8 A;  1GQE A;  2K4V A;  1QU6 A;  2V89 A;  1A1H A;  2K7I A;  2RQL A;  2G7H A;  4B3T E;  1ZBQ A;  4JI8 E;  4F6M A;  2F8B A;  3H09 A;  2LMZ A;  2WBS A;  5KL5 A;  2EOS A;  4ZYH A;  1FKA E;  2JR1 A;  1YYO A;  1ZAA C;  3DF6 A;  2EPK X;  1DI2 A;  4F54 A;  2EOQ A;  2EM4 A;  4WSG A;  1JK1 A;  2ELY A;  2CTD A;  2UXD E;  4MLV A;  5AC5 A;  2EL5 A;  2EMY A;  1B69 A;  1UN6 B;  2BBG A;  2YTJ A;  4I8O A;  3L00 A;  4P78 A;  5LLQ A;  5TSE A;  3OML A;  4JI2 E;  2V85 A;  1IBM E;  1PJQ A;  4P7D A;  4WXC A;  4DMI A;  1IQO A;  4LF7 E;  4LF6 E;  5KL4 A;  4GZN C;  2GPI A;  2YU5 A;  1HNW E;  2UXB E;  2EMH A;  2EOR A;  1A1I A;  2DIX A;  1YUI A;  5A69 A;  3JTZ A;  5AE2 A;  3KZY A;  1ZBT A;  4NHR A;  3JAM C;  5A6B A;  1EH8 A;  3ADI A;  4GKJ E;  2EM8 A;  4B3R E;  3MSW A;  4DV2 E;  2EOX A;  2EM9 A;  2H36 X;  5AAS A;  5A2Q C;  2JP9 A;  2EOE A;  1MEY C;  4DV1 E;  2EP3 A;  1BB8 A;  4DUZ E;  4L8N A;  1DQ3 A;  2BB8 A;  1X47 A;  2JOB A;  2JWO A;  3T1Y E;  4DV5 E;  1EKZ A;  4GKK E;  3KZZ A;  1J5E E;  1A1F A;  2EQ3 A;  2EPL X;  2ENC A;  1UHZ A;  1XNR E;  2LTS A;  2YTD A;  4LF4 E;  2DLK A;  1WHN A;  5A6B D;  1SFE A;  2LE2 A;  3J81 C;  1NEI A;  3IWD A;  2EML A;  5KL6 A;  4R2P A;  4DR7 E;  2EOJ A;  2EM5 A;  4Q28 A;  4X64 E;  4DR6 E;  2I9I A;  2EPM X;  2FGG A;  2EPN A;  4JI3 E;  3T1H E;  2MC6 A;  2B7V A;  3J7Y p;  4O24 A;  3F6H A;  1AH5 A;  4X62 E;  1WJP A;  4NZV A;  4LU9 A;  2R1F A;  1YYW A;  2L2M A;  3ADG A;  3IWB A;  4BHB A;  3J80 C;  2EN7 A;  2YTO A;  2L6M A;  1T4N A;  4BS9 A;  2EN8 A;  2UXC E;  2EPA A;  3C4B A;  4BBY A;  1X6E A;  2NAB A;  4ZYE A;  2WBU A;  1YUJ A;  4R2E A;  2HGH A;  2DGC A;  1YYK A;  1BBG A;  3OTO E;  5LL6 R;  5AE3 A;  2UUA E;  1EH7 A;  4JI0 E;  4O5G A;  2DRP A;  3TQM A;  1ZR9 A;  1PJS A;  2KON A;  1X3C A;  2LUQ A;  3HXL A;  5AC4 A;  2HC5 A;  1KYQ A;  2YU8 A;  4JI5 E;  1NCS A;  4AQY E;  2EPR A;  4R2R A;  2CPN A;  1T4L B;  4BMJ A;  4NXN E;  1N32 E;  5A6A A;  3QG5 C;  2YTN A;  2EM6 A;  4IS1 C;  4F9B B;  1A1L A;  2EPC A;  1XNQ E;  2LCE A;  4JI7 E;  2EMW A;  1PKP A;  2YTP A;  4JYA E;  5KL2 A;  1IBK E;  5BR8 E;  4F6N A;  2JXP A;  2JYA A;  3EQ1 A;  2CSH A;  3KWR A;  2DSY A;  1RMD A;  4BC7 A;  1HNX E;  2KOU A;  4B3S E;  3M99 B;  4LF5 E;  2M4I A;  4Q35 B;  2EWL A;  4GEQ B;  3ADJ A;  4K0K E;  2EQ1 A;  3HPZ A;  5IWA E;  1I94 E;  1N34 E;  5IV8 B;  2MC5 A;  2B9D A;  4M30 A;  4HTG A;  1TF3 A;  2YWQ A;  2MDR A;  2YT4 A;  2RTX A;  3EPK A;  2L3C A;  2ZM6 E;  1HR0 E;  1RQ0 A;  3C4T A;  3BID A;  3LLH A;  3VHT B;  4DV6 E;  2EL6 A;  4WXD A;  1IMU A;  1N3G A;  2M1S A;  4WPY A;  5F3W A;  1FJG E;  2M9A A;  1UIL A;  2VQE E;  3ECR A;  2N8X A;  4YHH E;  2EM0 A;  2YRK A;  2E1M A;  2EMX A;  2FV4 B;  4ZYD A;  2ENH A;  4DR5 E;  2V87 A;  3RMP A;  2EN2 A;  2I13 A;  2YTF A;  5LMU E;  1P47 A;  1YFH A;  2MKD A;  2EOO A;  4WYQ B;  2L33 A;  4KWY A;  1G2D C;  3DJW A;  4BC9 A;  3VYY A;  4DR3 E;  3HPS A;  2EMA A;  2B7T A;  4F9A B;  4DKK A;  2JOX A;  2UUB E;  2ENA A;  5IXM B;  3ZOQ B;  2MKN A;  5LMN E;  2WCC 3;  2WBT A;  1KJK A;  2ADR A;  2EE8 A;  4HEI A;  2EN4 A;  2YTQ A;  1Z1B A;  1T38 A;  5CFF E;  1SR9 A;  4WFT A;  1LLM C;  2EOH A;  3MHH C;  2YTI A;  2EQ0 A;  3EPH A;  2KHX A;  4BCA A;  3HQ1 A;  2NUE A;  2L2N A;  3EPJ A;  2VQF E;  3FIG A;  2DLQ A;  1T4O A;  2MDG A;  4F2J C;  2L92 A;  1O0W A;  4BHC A;  1TN9 A;  1GTK A;  3UK3 C;  3BF2 A;  4LFC E;  4DR2 E;  4TUG A;  1EH6 A;  2Q8U A;  2YTG A;  2EOI A;  4R2C A;  2RPC A;  1TF6 A;  1YPN A;  4IJD A;  1X5W A;  3P1X A;  2RS6 A;  2LBS B;  4LFB E;  2EN6 A;  2YTE A;  1J26 A;  2EPZ A;  2ODR C;  5A6K A;  4YY3 E;  2E72 A;  4X65 E;  1WXR A;  2EPX A;  2N3H A;  1N33 E;  4LF9 E;  2VRD A;  1QNT A;  2UU9 E;  5KL3 A;  2R76 A;  2RSI A;  2LRS A;  4DV4 E;  1F2I G;  2ELZ A;  1A1J A;  2EN3 A;  2YSP A;  2PRT A;  2EOY A;  4R8O A;  1N36 E;  2V86 A;  4DR1 E;  2L2K B;  2YRM A;  3ADL A;  4DR4 E;  2B3T B;  5KL7 A;  2YRH A;  2V88 A;  4WSP A;  2HJJ A;  1STU A;  3K6Q A;  3VYX A;  4NXM E; 
#chains in the Genus database with same CATH homology
 1ZU1 A;  1X6F A;  2EN2 A;  2CT1 A;  2I13 A;  2YTF A;  1A1H A;  1P47 A;  1X6H A;  2J7J A;  2MKD A;  2EM3 A;  2EOO A;  2JPA A;  3MHS C;  1WJP A;  1G2D C;  4F6M A;  2R1F A;  1AAY A;  2WBS A;  2EPU A;  2EOS A;  5KL5 A;  2EN7 A;  2YTO A;  1ZAA C;  2EMF A;  2EMA A;  2EN8 A;  2EPA A;  2ENA A;  2MKN A;  2EOF A;  2EOQ A;  2EM4 A;  1X6E A;  4WSG A;  1JK1 A;  2NAB A;  2WBU A;  2WCC 3;  1A1G A;  1YUJ A;  2ELY A;  4R2E A;  2CTD A;  2DGC A;  2HGH A;  2WBT A;  1KJK A;  2EL5 A;  2EMY A;  1B69 A;  1UN6 B;  2DRP A;  2ADR A;  2EE8 A;  2EMB A;  2EN4 A;  2YTQ A;  1ZR9 A;  2YTJ A;  1Z1B A;  2GLI A;  1X3C A;  1LLM C;  2EPP A;  2LVH A;  2EOH A;  2GHF A;  2YTI A;  2EQ0 A;  3MHH C;  2YU8 A;  4FK5 C;  1UBD C;  3EPH A;  1NCS A;  2EPR A;  4R2R A;  2DMI A;  2EMZ A;  2YTN A;  2EM6 A;  3EPJ A;  4IS1 C;  2EMK A;  2EMG A;  1A1L A;  2DLQ A;  2EPC A;  2MDG A;  4R2Q A;  4F2J C;  1G2F C;  2LCE A;  5KL4 A;  2EMW A;  2YTP A;  4GZN C;  2EL4 A;  1TN9 A;  4M9V C;  5KL2 A;  3UK3 C;  2YU5 A;  4R2A A;  2EMH A;  2EOR A;  1A1I A;  4F6N A;  1YUI A;  2EMI A;  4R2D A;  2CSH A;  2LT7 A;  1A1K A;  1RMD A;  2YTG A;  2EOI A;  2LV2 A;  4R2C A;  4R2S A;  2RPC A;  3M99 B;  2EMC A;  2LO3 A;  1TF6 A;  4IJD A;  2EM8 A;  2D9H A;  1X5W A;  2A25 A;  2EM2 A;  2EOX A;  2EN6 A;  2EJ4 A;  2EM9 A;  2YTE A;  4X9J A;  2EPZ A;  2JP9 A;  2EOE A;  1DGC A;  1MEY C;  2EQ1 A;  2EN1 A;  2E72 A;  2EP3 A;  1BB8 A;  2EPX A;  2BB8 A;  1JK2 A;  2VRD A;  1YSA C;  1TF3 A;  5KL3 A;  3EPK A;  2EOZ A;  2RSI A;  3VHT B;  1A1F A;  2EM7 A;  2EQ3 A;  2YSO A;  1F2I G;  2ELZ A;  1A1J A;  2EOM A;  2EL6 A;  2EN3 A;  2ENC A;  2YSP A;  2PRT A;  2YTD A;  2EOY A;  3EPL A;  2DLK A;  2M9A A;  2YRM A;  5KL7 A;  2EML A;  2YRH A;  5KL6 A;  2EM0 A;  2YRK A;  2EMX A;  4R2P A;  2EOJ A;  2ENH A;  2EM5 A;  1BBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...