2YTPA

Solution structure of the c2h2 type zinc finger (region 687-719) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERHYECSECGKAFARKSTLIMHQRIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 687-719) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytpA01
1TN9A 2EM7A 2EPRA 2WCC3 2EPXA 1YUIA 2EOMA 2LV2A 1TF6A 1ZR9A 2EMIA 2MDGA 4R2PA 3M99B 1X5WA 1DGCA 2EN2A 1A1GA 2EM8A 2YTNA 2EM4A 2EM3A 1X6EA 4X9JA 4R2RA 2EMFA 2EJ4A 3MHSC 1G2DC 1NCSA 1TF3A 4F2JC 2YTEA 2WBSA 2DLKA 2EPUA 2ELZA 1A1IA 1KJKA 2LO3A 5KL3A 2LCEA 2EL4A 1X6HA 2EOEA 1Z1BA 1B69A 5KL2A 2YTOA 4GZNC 2LT7A 1AAYA 2R1FA 2WBUA 1A1FA 1RMDA 2DLQA 1A1KA 2EORA 2DGCA 2MKDA 2EQ1A 5KL5A 1X6FA 1JK1A 2DMIA 4WSGA 2A25A 4F6MA 2ELYA 2EMXA 2EP3A 2GHFA 2M9AA 2EN1A 2EE8A 2EN7A 2EMZA 2EPZA 1JK2A 2EQ0A 2EOZA 2LVHA 2YU5A 4FK5C 4R2QA 2EM5A 2EN3A 3EPJA 2GLIA 5KL7A 2EMKA 2EM0A 1X3CA 2EOSA 2EM6A 2EOHA 1MEYC 2YSOA 1ZAAC 2VRDA 2YTGA 2CSHA 2EQ3A 4R2AA 2YTDA 2PRTA 3MHHC 1A1HA 2EMYA 2HGHA 2EMHA 2E72A 2EPPA 2EN6A 2EMWA 4R2EA 2EOOA 2YTQA 2WBTA 4IJDA 1ZU1A 1BBOA 2J7JA 2YSPA 2EOQA 3EPKA 4IS1C 1YSAC 4R2DA 2MKNA 2DRPA 2EM2A 2EOJA 1F2IG 2EL6A 2JP9A 2EN4A 2EN8A 2EMLA 2EMBA 2EMCA 2ENAA 2ENHA 2CT1A 1UN6B 2YRMA 4R2SA 2EPCA 2EMGA 4F6NA 2YU8A 5KL6A 2EOFA 2YTJA 3VHTB 3EPHA 4R2CA 2EM9A 2RPCA 2RSIA 1UBDC 1YUJA 2I13A 2YRHA 4M9VC 1WJPA 2EOIA 3UK3C 2NABA 2YTPA 2YTFA 2CTDA 2EMAA 2EOXA 2JPAA 2EPAA 2YTIA 5KL4A 1LLMC 2BB8A 2D9HA 2YRKA 1A1LA 2EL5A 1P47A 2ENCA 2ADRA 3EPLA 1A1JA 1BB8A 2EOYA 1G2FC
chains in the Genus database with same CATH superfamily
4DR2E 1TN9A 2JOBA 2EPRA 4JYAE 2MC6A 3LLHA 2L8TA 1YUIA 4BCAA 4R2PA 3M99B 1X5WA 5A6BD 1DGCA 4DR6E 4O4KA 4BC9A 1FKAE 1IMUA 4R2RA 1HR0E 1N33E 2V89A 1PKPA 4X8WA 4ZYGA 2DMYA 2JXPA 1YYOA 3QG5C 2E1MA 2LO3A 2VQEE 3MSWA 1Z1BA 4LF8E 4GZNC 2UUBE 2KHXA 1A1FA 2DLQA 4BHBA 2EORA 3OTOE 2DGCA 2EQ1A 4LTYA 4KWYA 2DB2A 4F6MA 2K4VA 4MLQA 1JK2A 4DUZE 1N32E 2M7QA 4M2ZA 5AE2A 2GLIA 4LF7E 4ZYDA 5LMNE 4WXDA 2EOSA 2N3GA 2YTGA 4DKKA 4LF4E 5A2QC 1PJSA 3BF2A 1WHNA 2RQLA 2E72A 5AC5A 1HNZE 4GKKE 2EN6A 2V83A 1ZU1A 2VF1A 4ZYHA 2J7JA 4YY3E 1YSAC 4R2DA 5LL6R 2DRPA 2NUFA 2JY9A 2EL6A 3THNA 4YHHE 2HHHE 2LTRA 2EMCA 2ENAA 2LUQA 4KHPE 4X65E 2EPCA 2ODRD 1EH7A 1YPNA 2KOUA 2ODRC 3AUZA 4AQYE 2RSIA 2I13A 4JI2E 4LF5E 2JR1A 4M9VC 1N34E 2CTDA 4KZSA 1ZBQA 2YTIA 4O43A 2RS6A 1P47A 1STUA 2B3TB 1N36E 2E5LE 2V8QB 4JI6E 3IWBA 4WYQB 1ZBTA 3JAMC 4HEIA 2LBSB 2EPXA 4MLVA 1TF6A 1ZR9A 2MC5A 2JVAA 3JU0A 4BC7A 4JI7E 2EM4A 2EPMX 4X9JA 1I94E 4WSPA 1GZ6A 2V88A 4Q35B 3ADGA 2RSMA 1G2DC 1WRJA 2YTEA 5T6JA 2WBSA 2DLKA 5AE1A 4F9BB 2EPOA 3HPSA 4NHRA 1A1IA 1KJKA 3ADIA 1PDAA 2L3CA 2EL4A 2VQFE 2FTXB 1AAYA 2WZOA 2B7VA 1RMDA 1A1KA 2YT4A 2HJJA 3DJWA 5KL5A 2L33A 1JK1A 5DNYA 2DMIA 2A25A 1L4SA 2ELYA 2EMXA 2EP3A 2M9AA 5F3WA 2FV4B 2EN7A 2EPZA 2LJHA 4R2QA 3EPJA 4BS9A 5KL7A 1IBLE 2EM0A 3J81C 4OOGC 1MEYC 3C4BA 1J5EE 4R2AA 2CSHA 2YTDA 3MHHC 2M4IA 4DV5E 2JYAA 2HGHA 2EMHA 2EPPA 1O0WA 2UXBE 2L92A 2WBTA 5AE3A 2MDRA 4P78A 4DV6E 1XNRE 2F4VE 2MKNA 3VYYA 1F2IG 4DR3E 4B3RE 4NZVA 2R76A 4J8ZA 4JV5E 1WXRA 4F6NA 4DV0E 4RHBB 2EOFA 2YTJA 3VHTB 1T4LB 2EZ6A 2L2MA 2EM9A 4B3ME 4HTGA 1UBDC 3IWCA 4Q28A 2JWOA 4R8OA 4DUYE 1WJPA 3UK3C 1WHQA 2LTSA 4F9CB 1LLMC 3VYXA 2D9HA 1A1LA 3T1HE 3P1XA 4M30A 2ADRA 1KYQA 2RS7A 1X49A 2EM7A 5A6BA 4DR1E 2LV2A 3BGHA 2MDGA 4LF6E 4DV7E 4F54A 3AV0A 2UU9E 5ADZA 4M0VA 1A1GA 5LLQA 3KWRA 4DV1E 2EM3A 1X6EA 1EH6A 2B9DA 2DIXA 4P7DA 1IQOA 4DR5E 3MHSC 1SFEA 4BBYA 3J7AG 3ECRA 4O24A 5AC4A 3BBGA 2NA2A 4TUGA 4DMIA 1X48A 3IWDA 1NCSA 4DV4E 1UHZA 1AH5A 4TUIA 4L5NC 4N4RB 1XMQE 1X6HA 1B69A 5KL2A 2YTOA 2R1FA 4O5GA 2EWLA 4WFTA 4JI8E 1T39A 2L6MA 1X6FA 2UXDE 4WSGA 2H36X 5LMUE 4WPYA 2EN1A 3TQMA 2EE8A 3K6QA 2LVHA 4RH8A 4FK5C 2BBGA 1RQ0A 3T1YE 2EMKA 1XMOE 2YPNA 4JI4E 1IBME 2L3JA 2EM6A 4I8OA 1ZAAC 2VRDA 2EQ3A 1QNTA 4R03A 2PRTA 1A1HA 4LFCE 1YYWA 2EMYA 1EH8A 2G7HA 4F9AB 1J26A 4OX9E 1T4NA 5A6JA 3THOB 1YZ9A 2EMWA 4R2EA 2YTQA 4LFBE 2EPLX 5A69A 2I9IA 4IJDA 1PJTA 1BBOA 2EOQA 3EPKA 4IS1C 1HNWE 3DF6A 4JI3E 2EOJA 3HQ1A 2JP9A 2EN8A 3C4TA 1HNXE 1UILA 1DQ3A 2LUPB 2K7IA 5A6KA 3KZYA 4L8NA 2EMBA 2ENHA 2YRMA 4R2SA 2EMGA 5IWAE 1XNQE 3HXLA 3HPZA 2V85A 1FJGE 3VK6A 2GPIA 2EOIA 4JI1E 2YTPA 4BHCA 2YTFA 2EMAA 2JPAA 2EPAA 5KL4A 2YRKA 2UXCE 2L2NA 2YWQA 5IV8B 1G2FC 3L00A 4NXME 2WCC3 1X47A 3C6KA 2EOMA 2EMIA 4X62E 2NUGA 3J80C 2CPNA 2EN2A 1N3GA 2FGGA 1YFHA 1RC7A 2EM8A 2YTNA 3C6MA 3F6HA 2EMFA 3OMLA 2EJ4A 3EQ1A 1BBGA 1YYKA 1TF3A 4F2JC 2KONA 3ADLA 1NEIA 2EPUA 2LE2A 2ELZA 4K0KE 2B7TA 2LCEA 2LMZA 2V87A 5BR8E 2EOEA 1T4OA 5IXMB 5KL3A 2LJUA 4GKJE 1PJQA 3BIDA 2LT7A 4WX9A 2WBUA 4LFAE 1DI2A 3H09A 4GEQB 2MKDA 1QU6A 2N3HA 3J7Yp 3JTZA 2LRSA 2GHFA 2Q8UA 3LMLA 4X64E 4DR7E 2EMZA 2EQ0A 2EOZA 2YU5A 2EM5A 2EN3A 2ZM6E 2NUEA 2DSYA 1X3CA 3HTXA 2V86A 2EPNA 2EOHA 3ZOQB 3RMPA 4JI5E 2YSOA 2M1SA 5A6AA 5AASA 2HC5A 2EOOA 2JOXA 4B3TE 2YSPA 2IHR1 3ADJA 4NXNE 4BMJA 2EM2A 1EKZA 2UUAE 2EN4A 2VE7C 5IT9C 2F8BA 5FLXC 4X66E 2EMLA 2CT1A 1UN6B 1IQSA 1GQEA 4LF9E 2RTXA 2YU8A 5KL6A 2L2KB 1GTKA 1MGTA 3FIGA 3EPHA 4R2CA 2RPCA 4B3SE 1YUJA 4LU9A 2YZTA 2YRHA 1IBKE 4DR4E 2NABA 5TSEA 2EOXA 4WXCA 1SR9A 2BB8A 2EPKX 1T38A 3KZZA 5CFFE 4DV3E 2EL5A 4JI0E 4ZYEA 3F6GA 4DV2E 2ENCA 2UUCE 3EPLA 1A1JA 1BB8A 2N8XA 2EOYA
chains in the Genus database with same CATH topology
1TN9A 2EM7A 2EPRA 2WCC3 2EPXA 1YUIA 2EOMA 2LV2A 1TF6A 1ZR9A 2EMIA 2MDGA 4R2PA 3M99B 1X5WA 1DGCA 2EN2A 1A1GA 2EM8A 2YTNA 2EM4A 2EM3A 1X6EA 4X9JA 4R2RA 2EMFA 2EJ4A 3MHSC 1G2DC 1NCSA 1TF3A 4F2JC 2YTEA 2WBSA 2DLKA 2EPUA 2ELZA 1A1IA 1KJKA 2LO3A 5KL3A 2LCEA 2EL4A 1X6HA 2EOEA 1Z1BA 1B69A 5KL2A 2YTOA 4GZNC 2LT7A 1AAYA 2R1FA 2WBUA 1A1FA 1RMDA 2DLQA 1A1KA 2EORA 2DGCA 2MKDA 2EQ1A 5KL5A 1X6FA 1JK1A 2DMIA 4WSGA 2A25A 4F6MA 2ELYA 2EMXA 2EP3A 2GHFA 2M9AA 2EN1A 2EE8A 2EN7A 2EMZA 2EPZA 1JK2A 2EQ0A 2EOZA 2LVHA 2YU5A 4FK5C 4R2QA 2EM5A 2EN3A 3EPJA 2GLIA 5KL7A 2EMKA 2EM0A 1X3CA 2EOSA 2EM6A 2EOHA 1MEYC 2YSOA 1ZAAC 2VRDA 2YTGA 2CSHA 2EQ3A 4R2AA 2YTDA 2PRTA 3MHHC 1A1HA 2EMYA 2HGHA 2EMHA 2E72A 2EPPA 2EN6A 2EMWA 4R2EA 2EOOA 2YTQA 2WBTA 4IJDA 1ZU1A 1BBOA 2J7JA 2YSPA 2EOQA 3EPKA 4IS1C 1YSAC 4R2DA 2MKNA 2DRPA 2EM2A 2EOJA 1F2IG 2EL6A 2JP9A 2EN4A 2EN8A 2EMLA 2EMBA 2EMCA 2ENAA 2ENHA 2CT1A 1UN6B 2YRMA 4R2SA 2EPCA 2EMGA 4F6NA 2YU8A 5KL6A 2EOFA 2YTJA 3VHTB 3EPHA 4R2CA 2EM9A 2RPCA 2RSIA 1UBDC 1YUJA 2I13A 2YRHA 4M9VC 1WJPA 2EOIA 3UK3C 2NABA 2YTPA 2YTFA 2CTDA 2EMAA 2EOXA 2JPAA 2EPAA 2YTIA 5KL4A 1LLMC 2BB8A 2D9HA 2YRKA 1A1LA 2EL5A 1P47A 2ENCA 2ADRA 3EPLA 1A1JA 1BB8A 2EOYA 1G2FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN9 A;  2EM7 A;  2EPR A;  2WCC 3;  2EPX A;  1YUI A;  2EOM A;  2LV2 A;  1TF6 A;  1ZR9 A;  2EMI A;  2MDG A;  4R2P A;  3M99 B;  1X5W A;  1DGC A;  2EN2 A;  1A1G A;  2EM8 A;  2YTN A;  2EM4 A;  2EM3 A;  1X6E A;  4X9J A;  4R2R A;  2EMF A;  2EJ4 A;  3MHS C;  1G2D C;  1NCS A;  1TF3 A;  4F2J C;  2YTE A;  2WBS A;  2DLK A;  2EPU A;  2ELZ A;  1A1I A;  1KJK A;  2LO3 A;  5KL3 A;  2LCE A;  2EL4 A;  1X6H A;  2EOE A;  1Z1B A;  1B69 A;  5KL2 A;  2YTO A;  4GZN C;  2LT7 A;  1AAY A;  2R1F A;  2WBU A;  1A1F A;  1RMD A;  2DLQ A;  1A1K A;  2EOR A;  2DGC A;  2MKD A;  2EQ1 A;  5KL5 A;  1X6F A;  1JK1 A;  2DMI A;  4WSG A;  2A25 A;  4F6M A;  2ELY A;  2EMX A;  2EP3 A;  2GHF A;  2M9A A;  2EN1 A;  2EE8 A;  2EN7 A;  2EMZ A;  2EPZ A;  1JK2 A;  2EQ0 A;  2EOZ A;  2LVH A;  2YU5 A;  4FK5 C;  4R2Q A;  2EM5 A;  2EN3 A;  3EPJ A;  2GLI A;  5KL7 A;  2EMK A;  2EM0 A;  1X3C A;  2EOS A;  2EM6 A;  2EOH A;  1MEY C;  2YSO A;  1ZAA C;  2VRD A;  2YTG A;  2CSH A;  2EQ3 A;  4R2A A;  2YTD A;  2PRT A;  3MHH C;  1A1H A;  2EMY A;  2HGH A;  2EMH A;  2E72 A;  2EPP A;  2EN6 A;  2EMW A;  4R2E A;  2EOO A;  2YTQ A;  2WBT A;  4IJD A;  1ZU1 A;  1BBO A;  2J7J A;  2YSP A;  2EOQ A;  3EPK A;  4IS1 C;  1YSA C;  4R2D A;  2MKN A;  2DRP A;  2EM2 A;  2EOJ A;  1F2I G;  2EL6 A;  2JP9 A;  2EN4 A;  2EN8 A;  2EML A;  2EMB A;  2EMC A;  2ENA A;  2ENH A;  2CT1 A;  1UN6 B;  2YRM A;  4R2S A;  2EPC A;  2EMG A;  4F6N A;  2YU8 A;  5KL6 A;  2EOF A;  2YTJ A;  3VHT B;  3EPH A;  4R2C A;  2EM9 A;  2RPC A;  2RSI A;  1UBD C;  1YUJ A;  2I13 A;  2YRH A;  4M9V C;  1WJP A;  2EOI A;  3UK3 C;  2NAB A;  2YTP A;  2YTF A;  2CTD A;  2EMA A;  2EOX A;  2JPA A;  2EPA A;  2YTI A;  5KL4 A;  1LLM C;  2BB8 A;  2D9H A;  2YRK A;  1A1L A;  2EL5 A;  1P47 A;  2ENC A;  2ADR A;  3EPL A;  1A1J A;  1BB8 A;  2EOY A;  1G2F C; 
#chains in the Genus database with same CATH topology
 4DR2 E;  1TN9 A;  2JOB A;  2EPR A;  4JYA E;  2MC6 A;  3LLH A;  2L8T A;  1YUI A;  4BCA A;  4R2P A;  3M99 B;  1X5W A;  5A6B D;  1DGC A;  4DR6 E;  4O4K A;  4BC9 A;  1FKA E;  1IMU A;  4R2R A;  1HR0 E;  1N33 E;  2V89 A;  1PKP A;  4X8W A;  4ZYG A;  2DMY A;  2JXP A;  1YYO A;  3QG5 C;  2E1M A;  2LO3 A;  2VQE E;  3MSW A;  1Z1B A;  4LF8 E;  4GZN C;  2UUB E;  2KHX A;  1A1F A;  2DLQ A;  4BHB A;  2EOR A;  3OTO E;  2DGC A;  2EQ1 A;  4LTY A;  4KWY A;  2DB2 A;  4F6M A;  2K4V A;  4MLQ A;  1JK2 A;  4DUZ E;  1N32 E;  2M7Q A;  4M2Z A;  5AE2 A;  2GLI A;  4LF7 E;  4ZYD A;  5LMN E;  4WXD A;  2EOS A;  2N3G A;  2YTG A;  4DKK A;  4LF4 E;  5A2Q C;  1PJS A;  3BF2 A;  1WHN A;  2RQL A;  2E72 A;  5AC5 A;  1HNZ E;  4GKK E;  2EN6 A;  2V83 A;  1ZU1 A;  2VF1 A;  4ZYH A;  2J7J A;  4YY3 E;  1YSA C;  4R2D A;  5LL6 R;  2DRP A;  2NUF A;  2JY9 A;  2EL6 A;  3THN A;  4YHH E;  2HHH E;  2LTR A;  2EMC A;  2ENA A;  2LUQ A;  4KHP E;  4X65 E;  2EPC A;  2ODR D;  1EH7 A;  1YPN A;  2KOU A;  2ODR C;  3AUZ A;  4AQY E;  2RSI A;  2I13 A;  4JI2 E;  4LF5 E;  2JR1 A;  4M9V C;  1N34 E;  2CTD A;  4KZS A;  1ZBQ A;  2YTI A;  4O43 A;  2RS6 A;  1P47 A;  1STU A;  2B3T B;  1N36 E;  2E5L E;  2V8Q B;  4JI6 E;  3IWB A;  4WYQ B;  1ZBT A;  3JAM C;  4HEI A;  2LBS B;  2EPX A;  4MLV A;  1TF6 A;  1ZR9 A;  2MC5 A;  2JVA A;  3JU0 A;  4BC7 A;  4JI7 E;  2EM4 A;  2EPM X;  4X9J A;  1I94 E;  4WSP A;  1GZ6 A;  2V88 A;  4Q35 B;  3ADG A;  2RSM A;  1G2D C;  1WRJ A;  2YTE A;  5T6J A;  2WBS A;  2DLK A;  5AE1 A;  4F9B B;  2EPO A;  3HPS A;  4NHR A;  1A1I A;  1KJK A;  3ADI A;  1PDA A;  2L3C A;  2EL4 A;  2VQF E;  2FTX B;  1AAY A;  2WZO A;  2B7V A;  1RMD A;  1A1K A;  2YT4 A;  2HJJ A;  3DJW A;  5KL5 A;  2L33 A;  1JK1 A;  5DNY A;  2DMI A;  2A25 A;  1L4S A;  2ELY A;  2EMX A;  2EP3 A;  2M9A A;  5F3W A;  2FV4 B;  2EN7 A;  2EPZ A;  2LJH A;  4R2Q A;  3EPJ A;  4BS9 A;  5KL7 A;  1IBL E;  2EM0 A;  3J81 C;  4OOG C;  1MEY C;  3C4B A;  1J5E E;  4R2A A;  2CSH A;  2YTD A;  3MHH C;  2M4I A;  4DV5 E;  2JYA A;  2HGH A;  2EMH A;  2EPP A;  1O0W A;  2UXB E;  2L92 A;  2WBT A;  5AE3 A;  2MDR A;  4P78 A;  4DV6 E;  1XNR E;  2F4V E;  2MKN A;  3VYY A;  1F2I G;  4DR3 E;  4B3R E;  4NZV A;  2R76 A;  4J8Z A;  4JV5 E;  1WXR A;  4F6N A;  4DV0 E;  4RHB B;  2EOF A;  2YTJ A;  3VHT B;  1T4L B;  2EZ6 A;  2L2M A;  2EM9 A;  4B3M E;  4HTG A;  1UBD C;  3IWC A;  4Q28 A;  2JWO A;  4R8O A;  4DUY E;  1WJP A;  3UK3 C;  1WHQ A;  2LTS A;  4F9C B;  1LLM C;  3VYX A;  2D9H A;  1A1L A;  3T1H E;  3P1X A;  4M30 A;  2ADR A;  1KYQ A;  2RS7 A;  1X49 A;  2EM7 A;  5A6B A;  4DR1 E;  2LV2 A;  3BGH A;  2MDG A;  4LF6 E;  4DV7 E;  4F54 A;  3AV0 A;  2UU9 E;  5ADZ A;  4M0V A;  1A1G A;  5LLQ A;  3KWR A;  4DV1 E;  2EM3 A;  1X6E A;  1EH6 A;  2B9D A;  2DIX A;  4P7D A;  1IQO A;  4DR5 E;  3MHS C;  1SFE A;  4BBY A;  3J7A G;  3ECR A;  4O24 A;  5AC4 A;  3BBG A;  2NA2 A;  4TUG A;  4DMI A;  1X48 A;  3IWD A;  1NCS A;  4DV4 E;  1UHZ A;  1AH5 A;  4TUI A;  4L5N C;  4N4R B;  1XMQ E;  1X6H A;  1B69 A;  5KL2 A;  2YTO A;  2R1F A;  4O5G A;  2EWL A;  4WFT A;  4JI8 E;  1T39 A;  2L6M A;  1X6F A;  2UXD E;  4WSG A;  2H36 X;  5LMU E;  4WPY A;  2EN1 A;  3TQM A;  2EE8 A;  3K6Q A;  2LVH A;  4RH8 A;  4FK5 C;  2BBG A;  1RQ0 A;  3T1Y E;  2EMK A;  1XMO E;  2YPN A;  4JI4 E;  1IBM E;  2L3J A;  2EM6 A;  4I8O A;  1ZAA C;  2VRD A;  2EQ3 A;  1QNT A;  4R03 A;  2PRT A;  1A1H A;  4LFC E;  1YYW A;  2EMY A;  1EH8 A;  2G7H A;  4F9A B;  1J26 A;  4OX9 E;  1T4N A;  5A6J A;  3THO B;  1YZ9 A;  2EMW A;  4R2E A;  2YTQ A;  4LFB E;  2EPL X;  5A69 A;  2I9I A;  4IJD A;  1PJT A;  1BBO A;  2EOQ A;  3EPK A;  4IS1 C;  1HNW E;  3DF6 A;  4JI3 E;  2EOJ A;  3HQ1 A;  2JP9 A;  2EN8 A;  3C4T A;  1HNX E;  1UIL A;  1DQ3 A;  2LUP B;  2K7I A;  5A6K A;  3KZY A;  4L8N A;  2EMB A;  2ENH A;  2YRM A;  4R2S A;  2EMG A;  5IWA E;  1XNQ E;  3HXL A;  3HPZ A;  2V85 A;  1FJG E;  3VK6 A;  2GPI A;  2EOI A;  4JI1 E;  2YTP A;  4BHC A;  2YTF A;  2EMA A;  2JPA A;  2EPA A;  5KL4 A;  2YRK A;  2UXC E;  2L2N A;  2YWQ A;  5IV8 B;  1G2F C;  3L00 A;  4NXM E;  2WCC 3;  1X47 A;  3C6K A;  2EOM A;  2EMI A;  4X62 E;  2NUG A;  3J80 C;  2CPN A;  2EN2 A;  1N3G A;  2FGG A;  1YFH A;  1RC7 A;  2EM8 A;  2YTN A;  3C6M A;  3F6H A;  2EMF A;  3OML A;  2EJ4 A;  3EQ1 A;  1BBG A;  1YYK A;  1TF3 A;  4F2J C;  2KON A;  3ADL A;  1NEI A;  2EPU A;  2LE2 A;  2ELZ A;  4K0K E;  2B7T A;  2LCE A;  2LMZ A;  2V87 A;  5BR8 E;  2EOE A;  1T4O A;  5IXM B;  5KL3 A;  2LJU A;  4GKJ E;  1PJQ A;  3BID A;  2LT7 A;  4WX9 A;  2WBU A;  4LFA E;  1DI2 A;  3H09 A;  4GEQ B;  2MKD A;  1QU6 A;  2N3H A;  3J7Y p;  3JTZ A;  2LRS A;  2GHF A;  2Q8U A;  3LML A;  4X64 E;  4DR7 E;  2EMZ A;  2EQ0 A;  2EOZ A;  2YU5 A;  2EM5 A;  2EN3 A;  2ZM6 E;  2NUE A;  2DSY A;  1X3C A;  3HTX A;  2V86 A;  2EPN A;  2EOH A;  3ZOQ B;  3RMP A;  4JI5 E;  2YSO A;  2M1S A;  5A6A A;  5AAS A;  2HC5 A;  2EOO A;  2JOX A;  4B3T E;  2YSP A;  2IHR 1;  3ADJ A;  4NXN E;  4BMJ A;  2EM2 A;  1EKZ A;  2UUA E;  2EN4 A;  2VE7 C;  5IT9 C;  2F8B A;  5FLX C;  4X66 E;  2EML A;  2CT1 A;  1UN6 B;  1IQS A;  1GQE A;  4LF9 E;  2RTX A;  2YU8 A;  5KL6 A;  2L2K B;  1GTK A;  1MGT A;  3FIG A;  3EPH A;  4R2C A;  2RPC A;  4B3S E;  1YUJ A;  4LU9 A;  2YZT A;  2YRH A;  1IBK E;  4DR4 E;  2NAB A;  5TSE A;  2EOX A;  4WXC A;  1SR9 A;  2BB8 A;  2EPK X;  1T38 A;  3KZZ A;  5CFF E;  4DV3 E;  2EL5 A;  4JI0 E;  4ZYE A;  3F6G A;  4DV2 E;  2ENC A;  2UUC E;  3EPL A;  1A1J A;  1BB8 A;  2N8X A;  2EOY A; 
#chains in the Genus database with same CATH homology
 1TN9 A;  2EM7 A;  2EPR A;  2WCC 3;  2EPX A;  1YUI A;  2EOM A;  2LV2 A;  1TF6 A;  1ZR9 A;  2EMI A;  2MDG A;  4R2P A;  3M99 B;  1X5W A;  1DGC A;  2EN2 A;  1A1G A;  2EM8 A;  2YTN A;  2EM4 A;  2EM3 A;  1X6E A;  4X9J A;  4R2R A;  2EMF A;  2EJ4 A;  3MHS C;  1G2D C;  1NCS A;  1TF3 A;  4F2J C;  2YTE A;  2WBS A;  2DLK A;  2EPU A;  2ELZ A;  1A1I A;  1KJK A;  2LO3 A;  5KL3 A;  2LCE A;  2EL4 A;  1X6H A;  2EOE A;  1Z1B A;  1B69 A;  5KL2 A;  2YTO A;  4GZN C;  2LT7 A;  1AAY A;  2R1F A;  2WBU A;  1A1F A;  1RMD A;  2DLQ A;  1A1K A;  2EOR A;  2DGC A;  2MKD A;  2EQ1 A;  5KL5 A;  1X6F A;  1JK1 A;  2DMI A;  4WSG A;  2A25 A;  4F6M A;  2ELY A;  2EMX A;  2EP3 A;  2GHF A;  2M9A A;  2EN1 A;  2EE8 A;  2EN7 A;  2EMZ A;  2EPZ A;  1JK2 A;  2EQ0 A;  2EOZ A;  2LVH A;  2YU5 A;  4FK5 C;  4R2Q A;  2EM5 A;  2EN3 A;  3EPJ A;  2GLI A;  5KL7 A;  2EMK A;  2EM0 A;  1X3C A;  2EOS A;  2EM6 A;  2EOH A;  1MEY C;  2YSO A;  1ZAA C;  2VRD A;  2YTG A;  2CSH A;  2EQ3 A;  4R2A A;  2YTD A;  2PRT A;  3MHH C;  1A1H A;  2EMY A;  2HGH A;  2EMH A;  2E72 A;  2EPP A;  2EN6 A;  2EMW A;  4R2E A;  2EOO A;  2YTQ A;  2WBT A;  4IJD A;  1ZU1 A;  1BBO A;  2J7J A;  2YSP A;  2EOQ A;  3EPK A;  4IS1 C;  1YSA C;  4R2D A;  2MKN A;  2DRP A;  2EM2 A;  2EOJ A;  1F2I G;  2EL6 A;  2JP9 A;  2EN4 A;  2EN8 A;  2EML A;  2EMB A;  2EMC A;  2ENA A;  2ENH A;  2CT1 A;  1UN6 B;  2YRM A;  4R2S A;  2EPC A;  2EMG A;  4F6N A;  2YU8 A;  5KL6 A;  2EOF A;  2YTJ A;  3VHT B;  3EPH A;  4R2C A;  2EM9 A;  2RPC A;  2RSI A;  1UBD C;  1YUJ A;  2I13 A;  2YRH A;  4M9V C;  1WJP A;  2EOI A;  3UK3 C;  2NAB A;  2YTP A;  2YTF A;  2CTD A;  2EMA A;  2EOX A;  2JPA A;  2EPA A;  2YTI A;  5KL4 A;  1LLM C;  2BB8 A;  2D9H A;  2YRK A;  1A1L A;  2EL5 A;  1P47 A;  2ENC A;  2ADR A;  3EPL A;  1A1J A;  1BB8 A;  2EOY A;  1G2F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...