2EOJA

Solution structure of the c2h2 type zinc finger (region 355-385) of human zinc finger protein 268
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
44
structure length
44
Chain Sequence
b'GSSGSSGTGENPYECCECGKVFSRKDQLVSHQKTHSGQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 355-385) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eojA01
2DLKA 2WCC3 1RMDA 1X6EA 1YUJA 1TF6A 2EOJA 1X5WA 2EN3A 2RSIA 4R2QA 2MDGA 2A25A 2EORA 1X6HA 4FK5C 2EOEA 4R2PA 2EOFA 2LO3A 2DGCA 2I13A 2CT1A 2EPUA 1MEYC 2EM9A 4F2JC 2YTPA 1A1KA 2D9HA 1X3CA 2EM4A 3EPJA 1Z1BA 4R2AA 1A1HA 2EMXA 4IS1C 1TF3A 2GHFA 2EOSA 2EM3A 1B69A 2EN2A 2YTJA 2YU5A 2CSHA 1DGCA 2EPRA 2YTOA 2EE8A 2EMKA 5KL7A 2BB8A 3M99B 2EMCA 4R2RA 2EOXA 1BB8A 2YSPA 1WJPA 2ELYA 4GZNC 1YSAC 2EMZA 2R1FA 1P47A 2EOMA 2EQ0A 2YRMA 2EP3A 2CTDA 1A1IA 2YTQA 2HGHA 5KL6A 2EN6A 2J7JA 2EPZA 1JK1A 4X9JA 2EM8A 2EN1A 2WBTA 2EL6A 2WBSA 2EM2A 1G2DC 2EMFA 5KL2A 2EPAA 1JK2A 2YRKA 1A1LA 2EMYA 2VRDA 2EQ3A 3VHTB 2JP9A 1AAYA 1UN6B 2EMHA 4M9VC 1X6FA 2EMAA 2ENAA 4IJDA 2EN8A 4F6MA 2LV2A 3EPHA 2ADRA 2ENHA 1A1JA 1ZU1A 2EL4A 2EM0A 1A1GA 1YUIA 2YSOA 1KJKA 1LLMC 4F6NA 2LCEA 2YTNA 2EJ4A 2EMGA 2YTEA 2RPCA 5KL5A 5KL4A 4R2SA 2EM6A 1UBDC 1NCSA 2EOQA 2EPCA 2MKDA 2EM7A 2E72A 4R2EA 3MHHC 4WSGA 2EOHA 2ELZA 2EM5A 2EMLA 2LVHA 2YU8A 5KL3A 2MKNA 1BBOA 3EPLA 2M9AA 2YTIA 2EL5A 4R2CA 3MHSC 1ZR9A 2WBUA 2GLIA 2NABA 2DRPA 2EPPA 2DMIA 2EOOA 1F2IG 2EN4A 2YTFA 2YRHA 3UK3C 2EOZA 2LT7A 2EPXA 1TN9A 2ENCA 1G2FC 2EMIA 2JPAA 4R2DA 2EN7A 1ZAAC 2YTGA 2EMWA 1A1FA 2EMBA 2EQ1A 2DLQA 2EOYA 2PRTA 2EOIA 2YTDA 3EPKA
chains in the Genus database with same CATH superfamily
3C4BA 2HJJA 4BHBA 1PKPA 1I94E 2EOJA 1X5WA 2MDGA 3H09A 3FIGA 3HQ1A 4KHPE 2EORA 4FK5C 2VQEE 1WHNA 4K0KE 4WX9A 2V85A 1A1KA 3ADLA 2EM4A 1WXRA 4DR2E 3VYXA 2EM3A 4B3RE 2YTJA 4DV0E 2CSHA 4DMIA 1AH5A 4L8NA 2B7VA 4X65E 2HC5A 3J81C 2YTOA 4JI3E 5KL7A 3DJWA 2JOBA 4JI5E 1T4LB 4B3SE 2NUEA 2L92A 4LU9A 2LUPB 2HGHA 2V86A 4Q35B 1JK1A 2EM8A 4YY3E 1EKZA 1IMUA 2EM2A 2UUAE 2LTSA 2EMYA 5TSEA 1N33E 2E1MA 2HHHE 2UXCE 2MC6A 1RQ0A 5A6KA 1X6FA 3EPHA 1ZU1A 1T4NA 3DF6A 5AE3A 4DV6E 3T1YE 2FV4B 3L00A 1LLMC 2KHXA 4R8OA 3HPSA 2LCEA 3AUZA 4L5NC 5KL5A 1UBDC 2EM6A 2EOQA 2EPCA 4DR3E 2NA2A 2MKDA 1J5EE 2E72A 3J7Yp 2RSMA 2FTXB 2LVHA 2MKNA 1BBOA 3BF2A 3EPLA 3LLHA 1HNWE 4BS9A 2K4VA 3MHSC 3HTXA 4O43A 2DRPA 5LMUE 4WYQB 2MDRA 1F2IG 4DR4E 2YTFA 2VE7C 1G2FC 2LBSB 3C6MA 2V89A 1J26A 4JI7E 3ADJA 2EN7A 1T4OA 1A1FA 2M4IA 2EMBA 2LTRA 4DKKA 2V87A 1TF3A 2YTDA 2L2NA 2KOUA 3EPKA 2DLKA 1RMDA 4X62E 1TF6A 4DR1E 1YZ9A 3ECRA 4R2QA 4R03A 1PDAA 2RS6A 5A69A 4RHBB 5DNYA 4R2PA 5IWAE 2L8TA 2DGCA 2L2MA 3AV0A 2F4VE 2EM9A 1UILA 4TUGA 4F2JC 2YTPA 4JI4E 2JWOA 2N8XA 1X3CA 3EPJA 2UUBE 4DV2E 1A1HA 2GHFA 4ZYGA 1B69A 1RC7A 2I9IA 5IXMB 3MSWA 4N4RB 4OX9E 2EE8A 2H36X 2BB8A 3M99B 4B3ME 2EMCA 4R2RA 3HXLA 4JI1E 1IBKE 1N32E 4MLQA 1BB8A 1WJPA 3IWDA 2L3JA 4GZNC 4AQYE 1YSAC 2E5LE 4DR7E 2ODRD 1P47A 4F9AB 1FJGE 2CTDA 2YTQA 3VK6A 5T6JA 2ZM6E 3J80C 2EPNA 2EN1A 5AE2A 3KZZA 5KL2A 1JK2A 4I8OA 3VHTB 2EPLX 2UXBE 3JTZA 4M9VC 5AE1A 2RS7A 1DI2A 1GTKA 2CPNA 4GKJE 1IBME 1KJKA 4M0VA 2FGGA 1ZBQA 3OMLA 2EMGA 3ADIA 3P1XA 5KL4A 4R2SA 2EPKX 2L33A 4TUIA 2WZOA 2EM7A 4WSGA 5AC5A 2EMLA 5F3WA 1XMOE 4OOGC 1YYWA 4JV5E 4LF5E 4WFTA 2EPPA 2DMIA 2EOOA 2N3GA 4X64E 2YRHA 4BC7A 3UK3C 1TN9A 2ENCA 5A6AA 1L4SA 2EMIA 2IHR1 5BR8E 2LUQA 4LF7E 4DV1E 2YTGA 4X66E 2EMWA 2L6MA 5A2QC 2DLQA 2EPMX 1IQSA 4ZYEA 1X6EA 1YUJA 4F9BB 5A6JA 2DIXA 1T38A 5ADZA 2A25A 2EWLA 3IWCA 4GKKE 1X6HA 3KZYA 4KWYA 2EOEA 2LRSA 4GEQB 2V88A 2EOFA 2LO3A 2Q8UA 2V8QB 2CT1A 2EPUA 5IV8B 2NUGA 1HNZE 2D9HA 3ZOQB 1Z1BA 4R2AA 2EMXA 3OTOE 2RQLA 3RMPA 2EN2A 1UHZA 4DUZE 2BBGA 4WXCA 4M2ZA 3JAMC 4O4KA 4M30A 1DGCA 2LJUA 2YPNA 1ZBTA 3TQMA 3ADGA 2EOXA 4J8ZA 1N36E 4X8WA 1SFEA 2KONA 2EOMA 1PJSA 2EP3A 1T39A 2JR1A 1A1IA 2L3CA 2K7IA 2EN6A 2RTXA 4LFBE 1GZ6A 4X9JA 2WBTA 4F54A 1FKAE 2B7TA 4BBYA 2EMFA 2EQ3A 2JP9A 1AAYA 1UN6B 4BCAA 1QU6A 2EN8A 2MC5A 3BBGA 2ADRA 1A1JA 4DR6E 2EM0A 1O0WA 1YUIA 3JU0A 2YSOA 3BGHA 1STUA 4WXDA 1YFHA 2JOXA 4F6NA 4JI2E 1WHQA 4BHCA 4RH8A 2EM5A 1YYOA 3K6QA 2YU8A 4YHHE 2M9AA 2JXPA 2UXDE 5LMNE 2DB2A 2EL5A 4R2CA 2JYAA 1GQEA 4NXME 1KYQA 3IWBA 1EH6A 2V83A 3THOB 2EPXA 4O24A 4JI8E 2L2KB 2EPOA 4BC9A 4LFAE 1PJTA 1YYKA 4P78A 1EH8A 5IT9C 2EQ1A 4B3TE 4WSPA 3F6HA 1X49A 4MLVA 2EOIA 2PRTA 1SR9A 2WCC3 2LJHA 1XNQE 4LF9E 2EN3A 2RSIA 4WPYA 1XMQE 2GPIA 5LL6R 4BMJA 3BIDA 2G7HA 2I13A 4LF4E 5LLQA 1MEYC 2VF1A 2JY9A 1WRJA 2LMZA 4ZYDA 4IS1C 4DV5E 2EOSA 4NXNE 2YU5A 1MGTA 4LFCE 2R76A 4F9CB 2EPRA 4NHRA 2EMKA 4HEIA 5FLXC 2NUFA 4DUYE 1PJQA 4JI6E 2YSPA 2ELYA 1XNRE 2EMZA 2R1FA 2EQ0A 2YRMA 2DSYA 2N3HA 1QNTA 2YZTA 2DMYA 1YPNA 1N34E 1DQ3A 5KL6A 3VYYA 2J7JA 2B3TB 2EPZA 4KZSA 3THNA 4DV3E 2EL6A 5CFFE 2WBSA 1G2DC 2EZ6A 1A1LA 2EPAA 2YRKA 2VRDA 1IQOA 2UU9E 4LF8E 2EMHA 4JI0E 1N3GA 1X47A 2EMAA 2ENAA 3F6GA 4IJDA 4F6MA 2LV2A 5A6BD 2ENHA 4ZYHA 2EL4A 2JVAA 1A1GA 4JYAE 4LTYA 2YTNA 3T1HE 2EJ4A 2YTEA 1HNXE 2RPCA 4O5GA 3J7AG 1X48A 1NCSA 1EH7A 3C4TA 4HTGA 2LE2A 4Q28A 5A6BA 4R2EA 2B9DA 3MHHC 1NEIA 2EOHA 2ELZA 5KL3A 3C6KA 3HPZA 2F8BA 2YTIA 4DR5E 4DV7E 2YT4A 1ZR9A 2WBUA 2VQFE 4DV4E 2GLIA 5AASA 2NABA 2EN4A 1BBGA 3KWRA 3LMLA 2EOZA 2LT7A 4LF6E 4P7DA 3QG5C 1HR0E 2M7QA 2JPAA 4R2DA 2YWQA 2M1SA 4NZVA 1ZAAC 1IBLE 2ODRC 2UUCE 2EOYA 5AC4A 3EQ1A
chains in the Genus database with same CATH topology
2DLKA 2WCC3 1RMDA 1X6EA 1YUJA 1TF6A 2EOJA 1X5WA 2EN3A 2RSIA 4R2QA 2MDGA 2A25A 2EORA 1X6HA 4FK5C 2EOEA 4R2PA 2EOFA 2LO3A 2DGCA 2I13A 2CT1A 2EPUA 1MEYC 2EM9A 4F2JC 2YTPA 1A1KA 2D9HA 1X3CA 2EM4A 3EPJA 1Z1BA 4R2AA 1A1HA 2EMXA 4IS1C 1TF3A 2GHFA 2EOSA 2EM3A 1B69A 2EN2A 2YTJA 2YU5A 2CSHA 1DGCA 2EPRA 2YTOA 2EE8A 2EMKA 5KL7A 2BB8A 3M99B 2EMCA 4R2RA 2EOXA 1BB8A 2YSPA 1WJPA 2ELYA 4GZNC 1YSAC 2EMZA 2R1FA 1P47A 2EOMA 2EQ0A 2YRMA 2EP3A 2CTDA 1A1IA 2YTQA 2HGHA 5KL6A 2EN6A 2J7JA 2EPZA 1JK1A 4X9JA 2EM8A 2EN1A 2WBTA 2EL6A 2WBSA 2EM2A 1G2DC 2EMFA 5KL2A 2EPAA 1JK2A 2YRKA 1A1LA 2EMYA 2VRDA 2EQ3A 3VHTB 2JP9A 1AAYA 1UN6B 2EMHA 4M9VC 1X6FA 2EMAA 2ENAA 4IJDA 2EN8A 4F6MA 2LV2A 3EPHA 2ADRA 2ENHA 1A1JA 1ZU1A 2EL4A 2EM0A 1A1GA 1YUIA 2YSOA 1KJKA 1LLMC 4F6NA 2LCEA 2YTNA 2EJ4A 2EMGA 2YTEA 2RPCA 5KL5A 5KL4A 4R2SA 2EM6A 1UBDC 1NCSA 2EOQA 2EPCA 2MKDA 2EM7A 2E72A 4R2EA 3MHHC 4WSGA 2EOHA 2ELZA 2EM5A 2EMLA 2LVHA 2YU8A 5KL3A 2MKNA 1BBOA 3EPLA 2M9AA 2YTIA 2EL5A 4R2CA 3MHSC 1ZR9A 2WBUA 2GLIA 2NABA 2DRPA 2EPPA 2DMIA 2EOOA 1F2IG 2EN4A 2YTFA 2YRHA 3UK3C 2EOZA 2LT7A 2EPXA 1TN9A 2ENCA 1G2FC 2EMIA 2JPAA 4R2DA 2EN7A 1ZAAC 2YTGA 2EMWA 1A1FA 2EMBA 2EQ1A 2DLQA 2EOYA 2PRTA 2EOIA 2YTDA 3EPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLK A;  2WCC 3;  1RMD A;  1X6E A;  1YUJ A;  1TF6 A;  2EOJ A;  1X5W A;  2EN3 A;  2RSI A;  4R2Q A;  2MDG A;  2A25 A;  2EOR A;  1X6H A;  4FK5 C;  2EOE A;  4R2P A;  2EOF A;  2LO3 A;  2DGC A;  2I13 A;  2CT1 A;  2EPU A;  1MEY C;  2EM9 A;  4F2J C;  2YTP A;  1A1K A;  2D9H A;  1X3C A;  2EM4 A;  3EPJ A;  1Z1B A;  4R2A A;  1A1H A;  2EMX A;  4IS1 C;  1TF3 A;  2GHF A;  2EOS A;  2EM3 A;  1B69 A;  2EN2 A;  2YTJ A;  2YU5 A;  2CSH A;  1DGC A;  2EPR A;  2YTO A;  2EE8 A;  2EMK A;  5KL7 A;  2BB8 A;  3M99 B;  2EMC A;  4R2R A;  2EOX A;  1BB8 A;  2YSP A;  1WJP A;  2ELY A;  4GZN C;  1YSA C;  2EMZ A;  2R1F A;  1P47 A;  2EOM A;  2EQ0 A;  2YRM A;  2EP3 A;  2CTD A;  1A1I A;  2YTQ A;  2HGH A;  5KL6 A;  2EN6 A;  2J7J A;  2EPZ A;  1JK1 A;  4X9J A;  2EM8 A;  2EN1 A;  2WBT A;  2EL6 A;  2WBS A;  2EM2 A;  1G2D C;  2EMF A;  5KL2 A;  2EPA A;  1JK2 A;  2YRK A;  1A1L A;  2EMY A;  2VRD A;  2EQ3 A;  3VHT B;  2JP9 A;  1AAY A;  1UN6 B;  2EMH A;  4M9V C;  1X6F A;  2EMA A;  2ENA A;  4IJD A;  2EN8 A;  4F6M A;  2LV2 A;  3EPH A;  2ADR A;  2ENH A;  1A1J A;  1ZU1 A;  2EL4 A;  2EM0 A;  1A1G A;  1YUI A;  2YSO A;  1KJK A;  1LLM C;  4F6N A;  2LCE A;  2YTN A;  2EJ4 A;  2EMG A;  2YTE A;  2RPC A;  5KL5 A;  5KL4 A;  4R2S A;  2EM6 A;  1UBD C;  1NCS A;  2EOQ A;  2EPC A;  2MKD A;  2EM7 A;  2E72 A;  4R2E A;  3MHH C;  4WSG A;  2EOH A;  2ELZ A;  2EM5 A;  2EML A;  2LVH A;  2YU8 A;  5KL3 A;  2MKN A;  1BBO A;  3EPL A;  2M9A A;  2YTI A;  2EL5 A;  4R2C A;  3MHS C;  1ZR9 A;  2WBU A;  2GLI A;  2NAB A;  2DRP A;  2EPP A;  2DMI A;  2EOO A;  1F2I G;  2EN4 A;  2YTF A;  2YRH A;  3UK3 C;  2EOZ A;  2LT7 A;  2EPX A;  1TN9 A;  2ENC A;  1G2F C;  2EMI A;  2JPA A;  4R2D A;  2EN7 A;  1ZAA C;  2YTG A;  2EMW A;  1A1F A;  2EMB A;  2EQ1 A;  2DLQ A;  2EOY A;  2PRT A;  2EOI A;  2YTD A;  3EPK A; 
#chains in the Genus database with same CATH topology
 3C4B A;  2HJJ A;  4BHB A;  1PKP A;  1I94 E;  2EOJ A;  1X5W A;  2MDG A;  3H09 A;  3FIG A;  3HQ1 A;  4KHP E;  2EOR A;  4FK5 C;  2VQE E;  1WHN A;  4K0K E;  4WX9 A;  2V85 A;  1A1K A;  3ADL A;  2EM4 A;  1WXR A;  4DR2 E;  3VYX A;  2EM3 A;  4B3R E;  2YTJ A;  4DV0 E;  2CSH A;  4DMI A;  1AH5 A;  4L8N A;  2B7V A;  4X65 E;  2HC5 A;  3J81 C;  2YTO A;  4JI3 E;  5KL7 A;  3DJW A;  2JOB A;  4JI5 E;  1T4L B;  4B3S E;  2NUE A;  2L92 A;  4LU9 A;  2LUP B;  2HGH A;  2V86 A;  4Q35 B;  1JK1 A;  2EM8 A;  4YY3 E;  1EKZ A;  1IMU A;  2EM2 A;  2UUA E;  2LTS A;  2EMY A;  5TSE A;  1N33 E;  2E1M A;  2HHH E;  2UXC E;  2MC6 A;  1RQ0 A;  5A6K A;  1X6F A;  3EPH A;  1ZU1 A;  1T4N A;  3DF6 A;  5AE3 A;  4DV6 E;  3T1Y E;  2FV4 B;  3L00 A;  1LLM C;  2KHX A;  4R8O A;  3HPS A;  2LCE A;  3AUZ A;  4L5N C;  5KL5 A;  1UBD C;  2EM6 A;  2EOQ A;  2EPC A;  4DR3 E;  2NA2 A;  2MKD A;  1J5E E;  2E72 A;  3J7Y p;  2RSM A;  2FTX B;  2LVH A;  2MKN A;  1BBO A;  3BF2 A;  3EPL A;  3LLH A;  1HNW E;  4BS9 A;  2K4V A;  3MHS C;  3HTX A;  4O43 A;  2DRP A;  5LMU E;  4WYQ B;  2MDR A;  1F2I G;  4DR4 E;  2YTF A;  2VE7 C;  1G2F C;  2LBS B;  3C6M A;  2V89 A;  1J26 A;  4JI7 E;  3ADJ A;  2EN7 A;  1T4O A;  1A1F A;  2M4I A;  2EMB A;  2LTR A;  4DKK A;  2V87 A;  1TF3 A;  2YTD A;  2L2N A;  2KOU A;  3EPK A;  2DLK A;  1RMD A;  4X62 E;  1TF6 A;  4DR1 E;  1YZ9 A;  3ECR A;  4R2Q A;  4R03 A;  1PDA A;  2RS6 A;  5A69 A;  4RHB B;  5DNY A;  4R2P A;  5IWA E;  2L8T A;  2DGC A;  2L2M A;  3AV0 A;  2F4V E;  2EM9 A;  1UIL A;  4TUG A;  4F2J C;  2YTP A;  4JI4 E;  2JWO A;  2N8X A;  1X3C A;  3EPJ A;  2UUB E;  4DV2 E;  1A1H A;  2GHF A;  4ZYG A;  1B69 A;  1RC7 A;  2I9I A;  5IXM B;  3MSW A;  4N4R B;  4OX9 E;  2EE8 A;  2H36 X;  2BB8 A;  3M99 B;  4B3M E;  2EMC A;  4R2R A;  3HXL A;  4JI1 E;  1IBK E;  1N32 E;  4MLQ A;  1BB8 A;  1WJP A;  3IWD A;  2L3J A;  4GZN C;  4AQY E;  1YSA C;  2E5L E;  4DR7 E;  2ODR D;  1P47 A;  4F9A B;  1FJG E;  2CTD A;  2YTQ A;  3VK6 A;  5T6J A;  2ZM6 E;  3J80 C;  2EPN A;  2EN1 A;  5AE2 A;  3KZZ A;  5KL2 A;  1JK2 A;  4I8O A;  3VHT B;  2EPL X;  2UXB E;  3JTZ A;  4M9V C;  5AE1 A;  2RS7 A;  1DI2 A;  1GTK A;  2CPN A;  4GKJ E;  1IBM E;  1KJK A;  4M0V A;  2FGG A;  1ZBQ A;  3OML A;  2EMG A;  3ADI A;  3P1X A;  5KL4 A;  4R2S A;  2EPK X;  2L33 A;  4TUI A;  2WZO A;  2EM7 A;  4WSG A;  5AC5 A;  2EML A;  5F3W A;  1XMO E;  4OOG C;  1YYW A;  4JV5 E;  4LF5 E;  4WFT A;  2EPP A;  2DMI A;  2EOO A;  2N3G A;  4X64 E;  2YRH A;  4BC7 A;  3UK3 C;  1TN9 A;  2ENC A;  5A6A A;  1L4S A;  2EMI A;  2IHR 1;  5BR8 E;  2LUQ A;  4LF7 E;  4DV1 E;  2YTG A;  4X66 E;  2EMW A;  2L6M A;  5A2Q C;  2DLQ A;  2EPM X;  1IQS A;  4ZYE A;  1X6E A;  1YUJ A;  4F9B B;  5A6J A;  2DIX A;  1T38 A;  5ADZ A;  2A25 A;  2EWL A;  3IWC A;  4GKK E;  1X6H A;  3KZY A;  4KWY A;  2EOE A;  2LRS A;  4GEQ B;  2V88 A;  2EOF A;  2LO3 A;  2Q8U A;  2V8Q B;  2CT1 A;  2EPU A;  5IV8 B;  2NUG A;  1HNZ E;  2D9H A;  3ZOQ B;  1Z1B A;  4R2A A;  2EMX A;  3OTO E;  2RQL A;  3RMP A;  2EN2 A;  1UHZ A;  4DUZ E;  2BBG A;  4WXC A;  4M2Z A;  3JAM C;  4O4K A;  4M30 A;  1DGC A;  2LJU A;  2YPN A;  1ZBT A;  3TQM A;  3ADG A;  2EOX A;  4J8Z A;  1N36 E;  4X8W A;  1SFE A;  2KON A;  2EOM A;  1PJS A;  2EP3 A;  1T39 A;  2JR1 A;  1A1I A;  2L3C A;  2K7I A;  2EN6 A;  2RTX A;  4LFB E;  1GZ6 A;  4X9J A;  2WBT A;  4F54 A;  1FKA E;  2B7T A;  4BBY A;  2EMF A;  2EQ3 A;  2JP9 A;  1AAY A;  1UN6 B;  4BCA A;  1QU6 A;  2EN8 A;  2MC5 A;  3BBG A;  2ADR A;  1A1J A;  4DR6 E;  2EM0 A;  1O0W A;  1YUI A;  3JU0 A;  2YSO A;  3BGH A;  1STU A;  4WXD A;  1YFH A;  2JOX A;  4F6N A;  4JI2 E;  1WHQ A;  4BHC A;  4RH8 A;  2EM5 A;  1YYO A;  3K6Q A;  2YU8 A;  4YHH E;  2M9A A;  2JXP A;  2UXD E;  5LMN E;  2DB2 A;  2EL5 A;  4R2C A;  2JYA A;  1GQE A;  4NXM E;  1KYQ A;  3IWB A;  1EH6 A;  2V83 A;  3THO B;  2EPX A;  4O24 A;  4JI8 E;  2L2K B;  2EPO A;  4BC9 A;  4LFA E;  1PJT A;  1YYK A;  4P78 A;  1EH8 A;  5IT9 C;  2EQ1 A;  4B3T E;  4WSP A;  3F6H A;  1X49 A;  4MLV A;  2EOI A;  2PRT A;  1SR9 A;  2WCC 3;  2LJH A;  1XNQ E;  4LF9 E;  2EN3 A;  2RSI A;  4WPY A;  1XMQ E;  2GPI A;  5LL6 R;  4BMJ A;  3BID A;  2G7H A;  2I13 A;  4LF4 E;  5LLQ A;  1MEY C;  2VF1 A;  2JY9 A;  1WRJ A;  2LMZ A;  4ZYD A;  4IS1 C;  4DV5 E;  2EOS A;  4NXN E;  2YU5 A;  1MGT A;  4LFC E;  2R76 A;  4F9C B;  2EPR A;  4NHR A;  2EMK A;  4HEI A;  5FLX C;  2NUF A;  4DUY E;  1PJQ A;  4JI6 E;  2YSP A;  2ELY A;  1XNR E;  2EMZ A;  2R1F A;  2EQ0 A;  2YRM A;  2DSY A;  2N3H A;  1QNT A;  2YZT A;  2DMY A;  1YPN A;  1N34 E;  1DQ3 A;  5KL6 A;  3VYY A;  2J7J A;  2B3T B;  2EPZ A;  4KZS A;  3THN A;  4DV3 E;  2EL6 A;  5CFF E;  2WBS A;  1G2D C;  2EZ6 A;  1A1L A;  2EPA A;  2YRK A;  2VRD A;  1IQO A;  2UU9 E;  4LF8 E;  2EMH A;  4JI0 E;  1N3G A;  1X47 A;  2EMA A;  2ENA A;  3F6G A;  4IJD A;  4F6M A;  2LV2 A;  5A6B D;  2ENH A;  4ZYH A;  2EL4 A;  2JVA A;  1A1G A;  4JYA E;  4LTY A;  2YTN A;  3T1H E;  2EJ4 A;  2YTE A;  1HNX E;  2RPC A;  4O5G A;  3J7A G;  1X48 A;  1NCS A;  1EH7 A;  3C4T A;  4HTG A;  2LE2 A;  4Q28 A;  5A6B A;  4R2E A;  2B9D A;  3MHH C;  1NEI A;  2EOH A;  2ELZ A;  5KL3 A;  3C6K A;  3HPZ A;  2F8B A;  2YTI A;  4DR5 E;  4DV7 E;  2YT4 A;  1ZR9 A;  2WBU A;  2VQF E;  4DV4 E;  2GLI A;  5AAS A;  2NAB A;  2EN4 A;  1BBG A;  3KWR A;  3LML A;  2EOZ A;  2LT7 A;  4LF6 E;  4P7D A;  3QG5 C;  1HR0 E;  2M7Q A;  2JPA A;  4R2D A;  2YWQ A;  2M1S A;  4NZV A;  1ZAA C;  1IBL E;  2ODR C;  2UUC E;  2EOY A;  5AC4 A;  3EQ1 A; 
#chains in the Genus database with same CATH homology
 2DLK A;  2WCC 3;  1RMD A;  1X6E A;  1YUJ A;  1TF6 A;  2EOJ A;  1X5W A;  2EN3 A;  2RSI A;  4R2Q A;  2MDG A;  2A25 A;  2EOR A;  1X6H A;  4FK5 C;  2EOE A;  4R2P A;  2EOF A;  2LO3 A;  2DGC A;  2I13 A;  2CT1 A;  2EPU A;  1MEY C;  2EM9 A;  4F2J C;  2YTP A;  1A1K A;  2D9H A;  1X3C A;  2EM4 A;  3EPJ A;  1Z1B A;  4R2A A;  1A1H A;  2EMX A;  4IS1 C;  1TF3 A;  2GHF A;  2EOS A;  2EM3 A;  1B69 A;  2EN2 A;  2YTJ A;  2YU5 A;  2CSH A;  1DGC A;  2EPR A;  2YTO A;  2EE8 A;  2EMK A;  5KL7 A;  2BB8 A;  3M99 B;  2EMC A;  4R2R A;  2EOX A;  1BB8 A;  2YSP A;  1WJP A;  2ELY A;  4GZN C;  1YSA C;  2EMZ A;  2R1F A;  1P47 A;  2EOM A;  2EQ0 A;  2YRM A;  2EP3 A;  2CTD A;  1A1I A;  2YTQ A;  2HGH A;  5KL6 A;  2EN6 A;  2J7J A;  2EPZ A;  1JK1 A;  4X9J A;  2EM8 A;  2EN1 A;  2WBT A;  2EL6 A;  2WBS A;  2EM2 A;  1G2D C;  2EMF A;  5KL2 A;  2EPA A;  1JK2 A;  2YRK A;  1A1L A;  2EMY A;  2VRD A;  2EQ3 A;  3VHT B;  2JP9 A;  1AAY A;  1UN6 B;  2EMH A;  4M9V C;  1X6F A;  2EMA A;  2ENA A;  4IJD A;  2EN8 A;  4F6M A;  2LV2 A;  3EPH A;  2ADR A;  2ENH A;  1A1J A;  1ZU1 A;  2EL4 A;  2EM0 A;  1A1G A;  1YUI A;  2YSO A;  1KJK A;  1LLM C;  4F6N A;  2LCE A;  2YTN A;  2EJ4 A;  2EMG A;  2YTE A;  2RPC A;  5KL5 A;  5KL4 A;  4R2S A;  2EM6 A;  1UBD C;  1NCS A;  2EOQ A;  2EPC A;  2MKD A;  2EM7 A;  2E72 A;  4R2E A;  3MHH C;  4WSG A;  2EOH A;  2ELZ A;  2EM5 A;  2EML A;  2LVH A;  2YU8 A;  5KL3 A;  2MKN A;  1BBO A;  3EPL A;  2M9A A;  2YTI A;  2EL5 A;  4R2C A;  3MHS C;  1ZR9 A;  2WBU A;  2GLI A;  2NAB A;  2DRP A;  2EPP A;  2DMI A;  2EOO A;  1F2I G;  2EN4 A;  2YTF A;  2YRH A;  3UK3 C;  2EOZ A;  2LT7 A;  2EPX A;  1TN9 A;  2ENC A;  1G2F C;  2EMI A;  2JPA A;  4R2D A;  2EN7 A;  1ZAA C;  2YTG A;  2EMW A;  1A1F A;  2EMB A;  2EQ1 A;  2DLQ A;  2EOY A;  2PRT A;  2EOI A;  2YTD A;  3EPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...