2EOJA

Solution structure of the c2h2 type zinc finger (region 355-385) of human zinc finger protein 268
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTGENPYECCECGKVFSRKDQLVSHQKTHSGQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 355-385) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eojA01
3EPKA 5KL2A 1X6HA 1ZR9A 2EM7A 2EN4A 1NCSA 2EOIA 2EM6A 2LT7A 3MHSC 2EM0A 2WBSA 1G2DC 2DLQA 1F2IG 2EN7A 3UK3C 2EMCA 2EOZA 2LVHA 1P47A 2ENAA 2EMGA 1YSAC 2YTEA 4R2SA 2EPZA 2EQ3A 2EL4A 2YTIA 2YTOA 1A1JA 1YUIA 1KJKA 4GZNC 2EM9A 2EOHA 1Z1BA 2EM2A 2ELYA 2J7JA 4X9JA 2EM3A 2MKDA 2PRTA 4F6MA 2I13A 2EOXA 2EOMA 2WBTA 4IJDA 2YTFA 2EE8A 5KL6A 4M9VC 2EMBA 2YTJA 2YTGA 1A1IA 2A25A 2EMZA 2EPXA 1TN9A 1DGCA 1ZU1A 2DLKA 2WCC3 2EMIA 2EQ1A 2EOJA 4R2DA 1A1GA 3M99B 2EORA 3VHTB 1A1HA 2EMHA 2EL5A 2ADRA 2EN1A 2EN2A 2EM4A 4R2EA 4F6NA 2EM5A 2EN3A 2RSIA 4F2JC 2GLIA 1UN6B 3MHHC 2EMXA 4R2RA 2R1FA 2YRMA 1BBOA 2EL6A 3EPLA 2EPCA 1YUJA 1ZAAC 2EQ0A 2YRHA 1B69A 2EPAA 1G2FC 2EOYA 2YTDA 2RPCA 4R2QA 1JK1A 2YSOA 2MDGA 2EOOA 2WBUA 1AAYA 4IS1C 2DMIA 2LCEA 2EOSA 1MEYC 2ELZA 2DGCA 2EM8A 2D9HA 2CSHA 5KL5A 3EPJA 5KL4A 4R2PA 1X3CA 1LLMC 1UBDC 2EMFA 1TF3A 2EPRA 2NABA 2CT1A 2YTNA 4WSGA 5KL3A 2EPUA 2YSPA 2YU8A 2EOFA 2ENHA 5KL7A 1BB8A 2BB8A 2VRDA 2YTPA 2YU5A 2EP3A 1A1FA 4FK5C 1WJPA 2JP9A 2YRKA 4R2CA 1RMDA 1JK2A 2LV2A 2JPAA 2EOEA 1X5WA 3EPHA 2YTQA 2EOQA 2EJ4A 2ENCA 1X6EA 4R2AA 2CTDA 2EPPA 1X6FA 2EMKA 2DRPA 2E72A 2EN8A 1A1KA 1TF6A 2GHFA 1A1LA 2HGHA 2EN6A 2EMLA 2M9AA 2EMYA 2EMWA 2LO3A 2MKNA 2EMAA
chains in the Genus database with same CATH superfamily
4DMIA 3J81C 2EPOA 2EM0A 4YY3E 2JY9A 2V86A 3T1HE 2K7IA 3RMPA 1G2DC 3VYXA 3LMLA 4B3ME 2EMCA 4NXNE 3ADIA 3J80C 2ENAA 2EMGA 2MC6A 4P7DA 2VF1A 4BS9A 4JI7E 1X47A 1YSAC 3F6GA 4DV1E 2EL4A 2YTOA 1YUIA 4Q35B 2EM9A 4X9JA 5A6KA 2JXPA 5LMUE 1PJQA 4F6MA 2WBTA 4IJDA 4BMJA 4L8NA 2EMBA 2L6MA 2UXBE 1DGCA 3IWDA 2EMIA 4ZYDA 1FKAE 2ODRC 3KZZA 4BBYA 2V89A 2NUEA 3VHTB 4O4KA 2EMHA 3OTOE 2EL5A 3ZOQB 1YYOA 1EH6A 2L33A 4F6NA 4O24A 4B3SE 2RSIA 4GEQB 2GPIA 2YRMA 2KHXA 2EL6A 1YUJA 2JR1A 1DI2A 2JWOA 1N32E 2EPLX 1QU6A 2RPCA 4R2QA 2JOXA 2EOOA 5DNYA 4JI4E 5IT9C 5A2QC 3OMLA 2EM8A 2LBSB 1ZBTA 1J5EE 3EPJA 5KL4A 1LLMC 2LJHA 2NUFA 1T4LB 2CT1A 1IBKE 1J26A 4M2ZA 3BIDA 3IWCA 2YU8A 5KL7A 3HXLA 4TUGA 2YTPA 2YU5A 2EP3A 4RH8A 3C6KA 4FK5C 3T1YE 1X48A 1RMDA 5A6AA 4P78A 3EPHA 1X6EA 2CTDA 2MC5A 4I8OA 2EPPA 2DRPA 2EMKA 1A1KA 4KHPE 2M9AA 4AQYE 4WXCA 4DV0E 4X62E 4DR2E 2EMYA 3ADLA 4BC7A 4DR1E 2RS6A 1ZR9A 2EN4A 2LTRA 1NCSA 3JAMC 4JI2E 3DJWA 2L2KB 2LT7A 2F4VE 4M0VA 4BHBA 4DR5E 5AE3A 3VYYA 1BBGA 4R03A 1IBME 4X64E 3ADJA 2EPZA 5AC5A 1KYQA 1A1JA 2DMYA 3AUZA 5TSEA 4DUYE 4JYAE 2ELYA 2J7JA 4DV4E 2V87A 2PRTA 3TQMA 2YTFA 2RS7A 5KL6A 4M9VC 1MGTA 2YTJA 1A1IA 2EMZA 1N34E 1ZU1A 2N8XA 2RSMA 2LUPB 4WPYA 2EOJA 4NZVA 3BF2A 4R2DA 2FGGA 1WRJA 4Q28A 2L2NA 1A1HA 2LE2A 2ADRA 1SFEA 2FTXB 1FJGE 2DIXA 4LF9E 2EPMX 3AV0A 1HR0E 2EN3A 4LTYA 5T6JA 3KWRA 3MHHC 4DR7E 2L3JA 4J8ZA 1L4SA 3EPLA 3ADGA 1ZAAC 1RC7A 2HJJA 2YRHA 2B7VA 2EOYA 1G2FC 2YTDA 4KZSA 1YYKA 2RTXA 4DV5E 2MDRA 4LF8E 3BBGA 4LF7E 2LCEA 2EOSA 2M1SA 2D9HA 2CSHA 1PJTA 4OX9E 4LFCE 1TF3A 2NABA 2JVAA 4JI5E 4NHRA 3FIGA 5IXMB 3BGHA 4X66E 4WSGA 2UXCE 1XNQE 5KL3A 2LTSA 2EPUA 2EOFA 2ENHA 2LMZA 3F6HA 4X65E 2UUAE 1HNWE 2EWLA 2R76A 1XMOE 2JP9A 2EOEA 2YTQA 2EOQA 2EJ4A 1UHZA 2ENCA 3JTZA 3C4TA 5CFFE 4MLQA 5AE2A 2EN8A 4OOGC 3THNA 2EMLA 2EPNA 2EMWA 2H36X 3EPKA 5KL2A 2EOIA 2EM6A 2DB2A 1T4NA 4RHBB 2V83A 4HEIA 4M30A 2ODRD 1YPNA 2NA2A 3UK3C 4ZYGA 2B9DA 2EOZA 2LVHA 1P47A 2B3TB 2YT4A 5IWAE 1HNZE 3C4BA 3HPSA 5LL6R 1KJKA 3C6MA 1WHNA 3QG5C 3H09A 4GZNC 1Z1BA 2NUGA 4KWYA 4GKKE 4F9BB 2L92A 4BHCA 1SR9A 2E1MA 2B7TA 2I13A 2UUBE 2A25A 1RQ0A 1GZ6A 2WCC3 2EQ1A 4F54A 4JI8E 2V85A 3M99B 1T38A 2K4VA 4LF6E 1GQEA 2EN2A 2EN1A 2EM4A 1YZ9A 4NXME 4GKJE 4R2EA 2EM5A 3KZYA 1UN6B 4YHHE 4R2RA 2ZM6E 1YYWA 4WXDA 1WHQA 1EH7A 1B69A 4LFBE 4R8OA 4DR4E 4DKKA 1JK1A 2YSOA 4JI3E 1XNRE 1AAYA 2JYAA 4IS1C 5A6BA 3LLHA 2HC5A 5IV8B 3K6QA 1N3GA 2ELZA 2DGCA 4B3TE 5AASA 3ECRA 1IQSA 5A6BD 4WYQB 4R2PA 4WFTA 2EMFA 2EPRA 5ADZA 2YTNA 4N4RB 2UXDE 5LLQA 5LMNE 2VRDA 4F9AB 2DSYA 2M7QA 4DUZE 5F3WA 4LF5E 5A6JA 1WJPA 4DV7E 2YRKA 3J7Yp 1EKZA 2V88A 1T4OA 2FV4B 5FLXC 2LJUA 1ZBQA 2L8TA 1X6FA 1EH8A 2E72A 3THOB 1PDAA 1A1LA 2EN6A 2M4IA 3MSWA 4WX9A 4HTGA 2E5LE 2MKNA 2EPKX 1X6HA 2EM7A 4ZYHA 3MHSC 2WBSA 2LUQA 4F9CB 2DLQA 1F2IG 5AE1A 4ZYEA 4K0KE 4BC9A 2EN7A 1NEIA 1IMUA 1HNXE 4B3RE 2YTEA 4R2SA 3JU0A 2YPNA 2EQ3A 2V8QB 2YTIA 4JI0E 2EOHA 2EM2A 1PJSA 3IWBA 2RQLA 2EM3A 2MKDA 2KONA 3P1XA 3L00A 2EOXA 2EOMA 2EE8A 4DR6E 4WSPA 2YTGA 2EPXA 1TN9A 2DLKA 2EZ6A 2UUCE 1IQOA 2KOUA 1A1GA 2EORA 2CPNA 2VQEE 4DR3E 4O5GA 1N33E 1X49A 2F8BA 2UU9E 3J7AG 2BBGA 4F2JC 2GLIA 2EMXA 2R1FA 4DV2E 1BBOA 2YZTA 3DF6A 2EPCA 4JI1E 2Q8UA 2EQ0A 2EPAA 1O0WA 1T39A 5BR8E 1IBLE 4TUIA 2MDGA 2WBUA 2HHHE 2DMIA 2YWQA 1STUA 3EQ1A 4DV3E 1MEYC 1AH5A 5AC4A 2G7HA 1PKPA 4LFAE 5KL5A 4JV5E 2JOBA 1X3CA 1UBDC 3HQ1A 2L2MA 2N3GA 1N36E 4MLVA 1YFHA 2IHR1 1XMQE 3VK6A 2LRSA 4O43A 1GTKA 2YSPA 1BB8A 1DQ3A 2BB8A 1I94E 2I9IA 4DV6E 1A1FA 4LU9A 3HTXA 4L5NC 2VQFE 2L3CA 4R2CA 1JK2A 2LV2A 2JPAA 1X5WA 4JI6E 4LF4E 4X8WA 4R2AA 5A69A 1WXRA 4BCAA 1QNTA 1UILA 1TF6A 2GHFA 2HGHA 2VE7C 3HPZA 2WZOA 2N3HA 2LO3A 2EMAA
chains in the Genus database with same CATH topology
3EPKA 5KL2A 1X6HA 1ZR9A 2EM7A 2EN4A 1NCSA 2EOIA 2EM6A 2LT7A 3MHSC 2EM0A 2WBSA 1G2DC 2DLQA 1F2IG 2EN7A 3UK3C 2EMCA 2EOZA 2LVHA 1P47A 2ENAA 2EMGA 1YSAC 2YTEA 4R2SA 2EPZA 2EQ3A 2EL4A 2YTIA 2YTOA 1A1JA 1YUIA 1KJKA 4GZNC 2EM9A 2EOHA 1Z1BA 2EM2A 2ELYA 2J7JA 4X9JA 2EM3A 2MKDA 2PRTA 4F6MA 2I13A 2EOXA 2EOMA 2WBTA 4IJDA 2YTFA 2EE8A 5KL6A 4M9VC 2EMBA 2YTJA 2YTGA 1A1IA 2A25A 2EMZA 2EPXA 1TN9A 1DGCA 1ZU1A 2DLKA 2WCC3 2EMIA 2EQ1A 2EOJA 4R2DA 1A1GA 3M99B 2EORA 3VHTB 1A1HA 2EMHA 2EL5A 2ADRA 2EN1A 2EN2A 2EM4A 4R2EA 4F6NA 2EM5A 2EN3A 2RSIA 4F2JC 2GLIA 1UN6B 3MHHC 2EMXA 4R2RA 2R1FA 2YRMA 1BBOA 2EL6A 3EPLA 2EPCA 1YUJA 1ZAAC 2EQ0A 2YRHA 1B69A 2EPAA 1G2FC 2EOYA 2YTDA 2RPCA 4R2QA 1JK1A 2YSOA 2MDGA 2EOOA 2WBUA 1AAYA 4IS1C 2DMIA 2LCEA 2EOSA 1MEYC 2ELZA 2DGCA 2EM8A 2D9HA 2CSHA 5KL5A 3EPJA 5KL4A 4R2PA 1X3CA 1LLMC 1UBDC 2EMFA 1TF3A 2EPRA 2NABA 2CT1A 2YTNA 4WSGA 5KL3A 2EPUA 2YSPA 2YU8A 2EOFA 2ENHA 5KL7A 1BB8A 2BB8A 2VRDA 2YTPA 2YU5A 2EP3A 1A1FA 4FK5C 1WJPA 2JP9A 2YRKA 4R2CA 1RMDA 1JK2A 2LV2A 2JPAA 2EOEA 1X5WA 3EPHA 2YTQA 2EOQA 2EJ4A 2ENCA 1X6EA 4R2AA 2CTDA 2EPPA 1X6FA 2EMKA 2DRPA 2E72A 2EN8A 1A1KA 1TF6A 2GHFA 1A1LA 2HGHA 2EN6A 2EMLA 2M9AA 2EMYA 2EMWA 2LO3A 2MKNA 2EMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPK A;  5KL2 A;  1X6H A;  1ZR9 A;  2EM7 A;  2EN4 A;  1NCS A;  2EOI A;  2EM6 A;  2LT7 A;  3MHS C;  2EM0 A;  2WBS A;  1G2D C;  2DLQ A;  1F2I G;  2EN7 A;  3UK3 C;  2EMC A;  2EOZ A;  2LVH A;  1P47 A;  2ENA A;  2EMG A;  1YSA C;  2YTE A;  4R2S A;  2EPZ A;  2EQ3 A;  2EL4 A;  2YTI A;  2YTO A;  1A1J A;  1YUI A;  1KJK A;  4GZN C;  2EM9 A;  2EOH A;  1Z1B A;  2EM2 A;  2ELY A;  2J7J A;  4X9J A;  2EM3 A;  2MKD A;  2PRT A;  4F6M A;  2I13 A;  2EOX A;  2EOM A;  2WBT A;  4IJD A;  2YTF A;  2EE8 A;  5KL6 A;  4M9V C;  2EMB A;  2YTJ A;  2YTG A;  1A1I A;  2A25 A;  2EMZ A;  2EPX A;  1TN9 A;  1DGC A;  1ZU1 A;  2DLK A;  2WCC 3;  2EMI A;  2EQ1 A;  2EOJ A;  4R2D A;  1A1G A;  3M99 B;  2EOR A;  3VHT B;  1A1H A;  2EMH A;  2EL5 A;  2ADR A;  2EN1 A;  2EN2 A;  2EM4 A;  4R2E A;  4F6N A;  2EM5 A;  2EN3 A;  2RSI A;  4F2J C;  2GLI A;  1UN6 B;  3MHH C;  2EMX A;  4R2R A;  2R1F A;  2YRM A;  1BBO A;  2EL6 A;  3EPL A;  2EPC A;  1YUJ A;  1ZAA C;  2EQ0 A;  2YRH A;  1B69 A;  2EPA A;  1G2F C;  2EOY A;  2YTD A;  2RPC A;  4R2Q A;  1JK1 A;  2YSO A;  2MDG A;  2EOO A;  2WBU A;  1AAY A;  4IS1 C;  2DMI A;  2LCE A;  2EOS A;  1MEY C;  2ELZ A;  2DGC A;  2EM8 A;  2D9H A;  2CSH A;  5KL5 A;  3EPJ A;  5KL4 A;  4R2P A;  1X3C A;  1LLM C;  1UBD C;  2EMF A;  1TF3 A;  2EPR A;  2NAB A;  2CT1 A;  2YTN A;  4WSG A;  5KL3 A;  2EPU A;  2YSP A;  2YU8 A;  2EOF A;  2ENH A;  5KL7 A;  1BB8 A;  2BB8 A;  2VRD A;  2YTP A;  2YU5 A;  2EP3 A;  1A1F A;  4FK5 C;  1WJP A;  2JP9 A;  2YRK A;  4R2C A;  1RMD A;  1JK2 A;  2LV2 A;  2JPA A;  2EOE A;  1X5W A;  3EPH A;  2YTQ A;  2EOQ A;  2EJ4 A;  2ENC A;  1X6E A;  4R2A A;  2CTD A;  2EPP A;  1X6F A;  2EMK A;  2DRP A;  2E72 A;  2EN8 A;  1A1K A;  1TF6 A;  2GHF A;  1A1L A;  2HGH A;  2EN6 A;  2EML A;  2M9A A;  2EMY A;  2EMW A;  2LO3 A;  2MKN A;  2EMA A; 
#chains in the Genus database with same CATH topology
 4DMI A;  3J81 C;  2EPO A;  2EM0 A;  4YY3 E;  2JY9 A;  2V86 A;  3T1H E;  2K7I A;  3RMP A;  1G2D C;  3VYX A;  3LML A;  4B3M E;  2EMC A;  4NXN E;  3ADI A;  3J80 C;  2ENA A;  2EMG A;  2MC6 A;  4P7D A;  2VF1 A;  4BS9 A;  4JI7 E;  1X47 A;  1YSA C;  3F6G A;  4DV1 E;  2EL4 A;  2YTO A;  1YUI A;  4Q35 B;  2EM9 A;  4X9J A;  5A6K A;  2JXP A;  5LMU E;  1PJQ A;  4F6M A;  2WBT A;  4IJD A;  4BMJ A;  4L8N A;  2EMB A;  2L6M A;  2UXB E;  1DGC A;  3IWD A;  2EMI A;  4ZYD A;  1FKA E;  2ODR C;  3KZZ A;  4BBY A;  2V89 A;  2NUE A;  3VHT B;  4O4K A;  2EMH A;  3OTO E;  2EL5 A;  3ZOQ B;  1YYO A;  1EH6 A;  2L33 A;  4F6N A;  4O24 A;  4B3S E;  2RSI A;  4GEQ B;  2GPI A;  2YRM A;  2KHX A;  2EL6 A;  1YUJ A;  2JR1 A;  1DI2 A;  2JWO A;  1N32 E;  2EPL X;  1QU6 A;  2RPC A;  4R2Q A;  2JOX A;  2EOO A;  5DNY A;  4JI4 E;  5IT9 C;  5A2Q C;  3OML A;  2EM8 A;  2LBS B;  1ZBT A;  1J5E E;  3EPJ A;  5KL4 A;  1LLM C;  2LJH A;  2NUF A;  1T4L B;  2CT1 A;  1IBK E;  1J26 A;  4M2Z A;  3BID A;  3IWC A;  2YU8 A;  5KL7 A;  3HXL A;  4TUG A;  2YTP A;  2YU5 A;  2EP3 A;  4RH8 A;  3C6K A;  4FK5 C;  3T1Y E;  1X48 A;  1RMD A;  5A6A A;  4P78 A;  3EPH A;  1X6E A;  2CTD A;  2MC5 A;  4I8O A;  2EPP A;  2DRP A;  2EMK A;  1A1K A;  4KHP E;  2M9A A;  4AQY E;  4WXC A;  4DV0 E;  4X62 E;  4DR2 E;  2EMY A;  3ADL A;  4BC7 A;  4DR1 E;  2RS6 A;  1ZR9 A;  2EN4 A;  2LTR A;  1NCS A;  3JAM C;  4JI2 E;  3DJW A;  2L2K B;  2LT7 A;  2F4V E;  4M0V A;  4BHB A;  4DR5 E;  5AE3 A;  3VYY A;  1BBG A;  4R03 A;  1IBM E;  4X64 E;  3ADJ A;  2EPZ A;  5AC5 A;  1KYQ A;  1A1J A;  2DMY A;  3AUZ A;  5TSE A;  4DUY E;  4JYA E;  2ELY A;  2J7J A;  4DV4 E;  2V87 A;  2PRT A;  3TQM A;  2YTF A;  2RS7 A;  5KL6 A;  4M9V C;  1MGT A;  2YTJ A;  1A1I A;  2EMZ A;  1N34 E;  1ZU1 A;  2N8X A;  2RSM A;  2LUP B;  4WPY A;  2EOJ A;  4NZV A;  3BF2 A;  4R2D A;  2FGG A;  1WRJ A;  4Q28 A;  2L2N A;  1A1H A;  2LE2 A;  2ADR A;  1SFE A;  2FTX B;  1FJG E;  2DIX A;  4LF9 E;  2EPM X;  3AV0 A;  1HR0 E;  2EN3 A;  4LTY A;  5T6J A;  3KWR A;  3MHH C;  4DR7 E;  2L3J A;  4J8Z A;  1L4S A;  3EPL A;  3ADG A;  1ZAA C;  1RC7 A;  2HJJ A;  2YRH A;  2B7V A;  2EOY A;  1G2F C;  2YTD A;  4KZS A;  1YYK A;  2RTX A;  4DV5 E;  2MDR A;  4LF8 E;  3BBG A;  4LF7 E;  2LCE A;  2EOS A;  2M1S A;  2D9H A;  2CSH A;  1PJT A;  4OX9 E;  4LFC E;  1TF3 A;  2NAB A;  2JVA A;  4JI5 E;  4NHR A;  3FIG A;  5IXM B;  3BGH A;  4X66 E;  4WSG A;  2UXC E;  1XNQ E;  5KL3 A;  2LTS A;  2EPU A;  2EOF A;  2ENH A;  2LMZ A;  3F6H A;  4X65 E;  2UUA E;  1HNW E;  2EWL A;  2R76 A;  1XMO E;  2JP9 A;  2EOE A;  2YTQ A;  2EOQ A;  2EJ4 A;  1UHZ A;  2ENC A;  3JTZ A;  3C4T A;  5CFF E;  4MLQ A;  5AE2 A;  2EN8 A;  4OOG C;  3THN A;  2EML A;  2EPN A;  2EMW A;  2H36 X;  3EPK A;  5KL2 A;  2EOI A;  2EM6 A;  2DB2 A;  1T4N A;  4RHB B;  2V83 A;  4HEI A;  4M30 A;  2ODR D;  1YPN A;  2NA2 A;  3UK3 C;  4ZYG A;  2B9D A;  2EOZ A;  2LVH A;  1P47 A;  2B3T B;  2YT4 A;  5IWA E;  1HNZ E;  3C4B A;  3HPS A;  5LL6 R;  1KJK A;  3C6M A;  1WHN A;  3QG5 C;  3H09 A;  4GZN C;  1Z1B A;  2NUG A;  4KWY A;  4GKK E;  4F9B B;  2L92 A;  4BHC A;  1SR9 A;  2E1M A;  2B7T A;  2I13 A;  2UUB E;  2A25 A;  1RQ0 A;  1GZ6 A;  2WCC 3;  2EQ1 A;  4F54 A;  4JI8 E;  2V85 A;  3M99 B;  1T38 A;  2K4V A;  4LF6 E;  1GQE A;  2EN2 A;  2EN1 A;  2EM4 A;  1YZ9 A;  4NXM E;  4GKJ E;  4R2E A;  2EM5 A;  3KZY A;  1UN6 B;  4YHH E;  4R2R A;  2ZM6 E;  1YYW A;  4WXD A;  1WHQ A;  1EH7 A;  1B69 A;  4LFB E;  4R8O A;  4DR4 E;  4DKK A;  1JK1 A;  2YSO A;  4JI3 E;  1XNR E;  1AAY A;  2JYA A;  4IS1 C;  5A6B A;  3LLH A;  2HC5 A;  5IV8 B;  3K6Q A;  1N3G A;  2ELZ A;  2DGC A;  4B3T E;  5AAS A;  3ECR A;  1IQS A;  5A6B D;  4WYQ B;  4R2P A;  4WFT A;  2EMF A;  2EPR A;  5ADZ A;  2YTN A;  4N4R B;  2UXD E;  5LLQ A;  5LMN E;  2VRD A;  4F9A B;  2DSY A;  2M7Q A;  4DUZ E;  5F3W A;  4LF5 E;  5A6J A;  1WJP A;  4DV7 E;  2YRK A;  3J7Y p;  1EKZ A;  2V88 A;  1T4O A;  2FV4 B;  5FLX C;  2LJU A;  1ZBQ A;  2L8T A;  1X6F A;  1EH8 A;  2E72 A;  3THO B;  1PDA A;  1A1L A;  2EN6 A;  2M4I A;  3MSW A;  4WX9 A;  4HTG A;  2E5L E;  2MKN A;  2EPK X;  1X6H A;  2EM7 A;  4ZYH A;  3MHS C;  2WBS A;  2LUQ A;  4F9C B;  2DLQ A;  1F2I G;  5AE1 A;  4ZYE A;  4K0K E;  4BC9 A;  2EN7 A;  1NEI A;  1IMU A;  1HNX E;  4B3R E;  2YTE A;  4R2S A;  3JU0 A;  2YPN A;  2EQ3 A;  2V8Q B;  2YTI A;  4JI0 E;  2EOH A;  2EM2 A;  1PJS A;  3IWB A;  2RQL A;  2EM3 A;  2MKD A;  2KON A;  3P1X A;  3L00 A;  2EOX A;  2EOM A;  2EE8 A;  4DR6 E;  4WSP A;  2YTG A;  2EPX A;  1TN9 A;  2DLK A;  2EZ6 A;  2UUC E;  1IQO A;  2KOU A;  1A1G A;  2EOR A;  2CPN A;  2VQE E;  4DR3 E;  4O5G A;  1N33 E;  1X49 A;  2F8B A;  2UU9 E;  3J7A G;  2BBG A;  4F2J C;  2GLI A;  2EMX A;  2R1F A;  4DV2 E;  1BBO A;  2YZT A;  3DF6 A;  2EPC A;  4JI1 E;  2Q8U A;  2EQ0 A;  2EPA A;  1O0W A;  1T39 A;  5BR8 E;  1IBL E;  4TUI A;  2MDG A;  2WBU A;  2HHH E;  2DMI A;  2YWQ A;  1STU A;  3EQ1 A;  4DV3 E;  1MEY C;  1AH5 A;  5AC4 A;  2G7H A;  1PKP A;  4LFA E;  5KL5 A;  4JV5 E;  2JOB A;  1X3C A;  1UBD C;  3HQ1 A;  2L2M A;  2N3G A;  1N36 E;  4MLV A;  1YFH A;  2IHR 1;  1XMQ E;  3VK6 A;  2LRS A;  4O43 A;  1GTK A;  2YSP A;  1BB8 A;  1DQ3 A;  2BB8 A;  1I94 E;  2I9I A;  4DV6 E;  1A1F A;  4LU9 A;  3HTX A;  4L5N C;  2VQF E;  2L3C A;  4R2C A;  1JK2 A;  2LV2 A;  2JPA A;  1X5W A;  4JI6 E;  4LF4 E;  4X8W A;  4R2A A;  5A69 A;  1WXR A;  4BCA A;  1QNT A;  1UIL A;  1TF6 A;  2GHF A;  2HGH A;  2VE7 C;  3HPZ A;  2WZO A;  2N3H A;  2LO3 A;  2EMA A; 
#chains in the Genus database with same CATH homology
 3EPK A;  5KL2 A;  1X6H A;  1ZR9 A;  2EM7 A;  2EN4 A;  1NCS A;  2EOI A;  2EM6 A;  2LT7 A;  3MHS C;  2EM0 A;  2WBS A;  1G2D C;  2DLQ A;  1F2I G;  2EN7 A;  3UK3 C;  2EMC A;  2EOZ A;  2LVH A;  1P47 A;  2ENA A;  2EMG A;  1YSA C;  2YTE A;  4R2S A;  2EPZ A;  2EQ3 A;  2EL4 A;  2YTI A;  2YTO A;  1A1J A;  1YUI A;  1KJK A;  4GZN C;  2EM9 A;  2EOH A;  1Z1B A;  2EM2 A;  2ELY A;  2J7J A;  4X9J A;  2EM3 A;  2MKD A;  2PRT A;  4F6M A;  2I13 A;  2EOX A;  2EOM A;  2WBT A;  4IJD A;  2YTF A;  2EE8 A;  5KL6 A;  4M9V C;  2EMB A;  2YTJ A;  2YTG A;  1A1I A;  2A25 A;  2EMZ A;  2EPX A;  1TN9 A;  1DGC A;  1ZU1 A;  2DLK A;  2WCC 3;  2EMI A;  2EQ1 A;  2EOJ A;  4R2D A;  1A1G A;  3M99 B;  2EOR A;  3VHT B;  1A1H A;  2EMH A;  2EL5 A;  2ADR A;  2EN1 A;  2EN2 A;  2EM4 A;  4R2E A;  4F6N A;  2EM5 A;  2EN3 A;  2RSI A;  4F2J C;  2GLI A;  1UN6 B;  3MHH C;  2EMX A;  4R2R A;  2R1F A;  2YRM A;  1BBO A;  2EL6 A;  3EPL A;  2EPC A;  1YUJ A;  1ZAA C;  2EQ0 A;  2YRH A;  1B69 A;  2EPA A;  1G2F C;  2EOY A;  2YTD A;  2RPC A;  4R2Q A;  1JK1 A;  2YSO A;  2MDG A;  2EOO A;  2WBU A;  1AAY A;  4IS1 C;  2DMI A;  2LCE A;  2EOS A;  1MEY C;  2ELZ A;  2DGC A;  2EM8 A;  2D9H A;  2CSH A;  5KL5 A;  3EPJ A;  5KL4 A;  4R2P A;  1X3C A;  1LLM C;  1UBD C;  2EMF A;  1TF3 A;  2EPR A;  2NAB A;  2CT1 A;  2YTN A;  4WSG A;  5KL3 A;  2EPU A;  2YSP A;  2YU8 A;  2EOF A;  2ENH A;  5KL7 A;  1BB8 A;  2BB8 A;  2VRD A;  2YTP A;  2YU5 A;  2EP3 A;  1A1F A;  4FK5 C;  1WJP A;  2JP9 A;  2YRK A;  4R2C A;  1RMD A;  1JK2 A;  2LV2 A;  2JPA A;  2EOE A;  1X5W A;  3EPH A;  2YTQ A;  2EOQ A;  2EJ4 A;  2ENC A;  1X6E A;  4R2A A;  2CTD A;  2EPP A;  1X6F A;  2EMK A;  2DRP A;  2E72 A;  2EN8 A;  1A1K A;  1TF6 A;  2GHF A;  1A1L A;  2HGH A;  2EN6 A;  2EML A;  2M9A A;  2EMY A;  2EMW A;  2LO3 A;  2MKN A;  2EMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...