2EOJA

Solution structure of the c2h2 type zinc finger (region 355-385) of human zinc finger protein 268
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTGENPYECCECGKVFSRKDQLVSHQKTHSGQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 355-385) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
total genus 5
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eojA01
1A1JA 2MKDA 1BB8A 4WSGA 2EOQA 2EP3A 2EN8A 4F6NA 2I13A 2EPRA 2JP9A 2D9HA 2EL5A 1G2DC 1YUJA 1P47A 2EOXA 2ADRA 1Z1BA 2ENAA 2YSPA 2EOIA 1NCSA 2EOEA 1MEYC 4R2RA 2EOSA 2LCEA 2EOZA 2YTFA 2YTOA 2EJ4A 2J7JA 1TF6A 2EMIA 2EOYA 1BBOA 4F6MA 2EM6A 2M9AA 3EPLA 2A25A 2EM9A 2EM0A 2EMXA 2LT7A 1A1FA 1X6FA 2EMFA 2EOOA 2YTIA 4IJDA 2DLKA 3VHTB 2EMYA 1A1IA 5KL6A 4R2QA 1TN9A 2BB8A 2EORA 2YTPA 1A1KA 2CTDA 2ENCA 4R2SA 2EN6A 4GZNC 4R2PA 4FK5C 2EN4A 2EOHA 2YTGA 2CT1A 1A1LA 2YRHA 2YTNA 3EPJA 1UN6B 2WBUA 2GLIA 2JPAA 2YRKA 2CSHA 2DLQA 2EM7A 2ELZA 1UBDC 1YUIA 1WJPA 2R1FA 2EMWA 2NABA 2VRDA 1A1HA 2EMAA 1G2FC 5KL5A 5KL4A 4M9VC 1RMDA 2DRPA 2WCC3 5KL2A 4R2CA 3EPHA 1F2IG 2EN1A 2GHFA 1ZU1A 2PRTA 1LLMC 2EMLA 5KL3A 2ENHA 1X5WA 2EL4A 2EQ3A 1KJKA 1X6HA 2EL6A 3MHSC 2YU5A 1ZR9A 2RSIA 2EMHA 4R2EA 2EM5A 4R2DA 2YTQA 2MDGA 2EMCA 2EMKA 1ZAAC 2WBSA 2EOMA 2YTDA 2EN3A 2EMGA 1DGCA 2DMIA 2E72A 2LVHA 2DGCA 2EOJA 2EQ0A 2EPPA 3EPKA 2EOFA 2RPCA 2HGHA 2LV2A 2EM8A 2EMZA 2LO3A 2YTEA 2YRMA 2EPXA 1X3CA 2EPAA 1JK2A 1YSAC 2EM4A 1B69A 2YU8A 2EN2A 2WBTA 1TF3A 2EM3A 2EQ1A 2EPZA 2ELYA 2EM2A 2EPCA 5KL7A 1JK1A 3M99B 4IS1C 4X9JA 1AAYA 3UK3C 4F2JC 2MKNA 2YSOA 1A1GA 2EE8A 3MHHC 2EN7A 2EMBA 2YTJA 4R2AA 1X6EA 2EPUA
chains in the Genus database with same CATH superfamily
2K4VA 2LUQA 2L92A 4LTYA 4BS9A 4JI2E 2I13A 2EP3A 2EN8A 2EPRA 2JR1A 2JP9A 2V8QB 2N3HA 2HHHE 1G2DC 2KHXA 4DV4E 3L00A 4O5GA 1YUJA 4B3SE 4LFAE 1SFEA 1Z1BA 2ENAA 4DV1E 1MGTA 3F6HA 2L3CA 1KYQA 4M0VA 4NXME 2EOSA 2YTFA 4RH8A 2L2NA 1TF6A 1AH5A 2MC6A 1J26A 2FV4B 2L33A 2A25A 4BC7A 2EM9A 4TUGA 2LTSA 1A1FA 1SR9A 4DV6E 1A1IA 5KL6A 4R2QA 1TN9A 2BB8A 2EORA 2JVAA 1A1KA 4DKKA 1YYKA 2E1MA 2EN6A 4B3RE 4DMIA 4R2PA 4DR7E 2EN4A 1A1LA 1NEIA 2ODRD 2R76A 5A69A 2CSHA 2DLQA 4LFBE 4JI8E 1ZBTA 2VRDA 4L5NC 2EMAA 1PDAA 1RMDA 4R2CA 3EPHA 2HC5A 1ZU1A 1T4NA 1WHQA 4BMJA 2MDRA 2DSYA 1KJKA 3BBGA 2YU5A 1ZR9A 2EPLX 2RSIA 3LLHA 2FGGA 1EH8A 2YTQA 1X47A 2EMCA 3IWBA 1XMQE 4BCAA 4DUZE 1EKZA 4WYQB 2WBSA 2EOMA 1DGCA 1N36E 2L2KB 2EPOA 2LV2A 2YRMA 4B3TE 4MLVA 4WPYA 2EM4A 2L6MA 2RTXA 2V85A 3FIGA 2EM2A 1N33E 3M99B 4RHBB 3MHHC 5AASA 2EN7A 2YTJA 1QNTA 2JOXA 4KZSA 2RSMA 1A1JA 2I9IA 2YT4A 3HXLA 2UXBE 5BR8E 2EOQA 4F6NA 2DMYA 2RS7A 2B7TA 1N3GA 3IWCA 5A2QC 3ZOQB 2ADRA 2N8XA 2YSPA 3JTZA 1NCSA 4P78A 3QG5C 2ZM6E 1GTKA 1HNWE 2GPIA 5IT9C 1GQEA 2LCEA 2L8TA 1BBOA 1J5EE 1YYOA 2EPMX 3KZYA 2V86A 2BBGA 2F8BA 1WXRA 2EMXA 2RS6A 2LT7A 5AE1A 4DR2E 2EOOA 2N3GA 4BBYA 4JI0E 3VHTB 2DLKA 4OX9E 3HTXA 2EMYA 4F9AB 5A6BD 1YFHA 3ECRA 4HTGA 3HQ1A 3DF6A 2YTPA 4ZYEA 3ADGA 1WHNA 4FK5C 2HJJA 2V83A 2Q8UA 3HPZA 4F9CB 2VE7C 5AC4A 2WBUA 5LMNE 2GLIA 2JPAA 4LFCE 4K0KE 4O43A 2ELZA 1UBDC 1YUIA 1WJPA 4LF9E 1XNQE 4WXCA 1A1HA 4M2ZA 2JY9A 2DRPA 4DR1E 2UUAE 1WRJA 2EN1A 1T4LB 2DB2A 2ENHA 2E5LE 4LF8E 4JI3E 1X5WA 4F9BB 1EH7A 2JYAA 3JAMC 4BC9A 4R2EA 2H36X 2YWQA 3ADLA 3ADIA 1UHZA 5ADZA 2LUPB 1RC7A 5AE3A 2EN3A 4Q28A 2DGCA 5IV8B 4AQYE 3T1HE 4F54A 2EQ0A 1UILA 2HGHA 2RPCA 4M30A 2EM8A 2EMZA 4DR3E 2EPXA 5T6JA 1X3CA 1B69A 1X49A 2EQ1A 3C6KA 5TSEA 2EPCA 4LF6E 5KL7A 2FTXB 4X8WA 4IS1C 4NZVA 4OOGC 4F2JC 2EPNA 1IBME 2YSOA 2EE8A 4LU9A 4R2AA 2JOBA 2M1SA 4L8NA 3TQMA 2NUEA 3BF2A 5IWAE 1BB8A 1PJQA 1RQ0A 4X65E 2D9HA 2EL5A 5LL6R 1PKPA 1BBGA 2F4VE 4KWYA 5CFFE 1P47A 1HNZE 2DIXA 3DJWA 3VK6A 2UUCE 2LE2A 5F3WA 1IQOA 2EOEA 2VF1A 3IWDA 4R2RA 2VQFE 3OMLA 4I8OA 2EMIA 3KZZA 4DV7E 4F6MA 2EM6A 2CPNA 3EPLA 2UUBE 2EM0A 4ZYDA 2NUGA 2EMFA 2YTIA 4LF7E 1I94E 4ZYGA 4B3ME 5A6AA 4R03A 2CTDA 2B3TB 2V87A 3KWRA 2L2MA 1GZ6A 4GZNC 4JI4E 3ADJA 2EOHA 2YTGA 2CT1A 2YRHA 2EPKX 1UN6B 1HNXE 4DR5E 2M7QA 3T1YE 4TUIA 2EMWA 2NABA 2YZTA 1QU6A 1G2FC 5KL4A 4M9VC 4YY3E 2WCC3 4DR4E 5KL2A 2UU9E 1F2IG 1T4OA 2GHFA 2EMLA 5KL3A 4GKKE 4P7DA 2IHR1 4BHBA 2EL4A 2EL6A 2LBSB 1FKAE 3VYXA 2EWLA 2VQEE 4R2DA 4DV3E 2G7HA 2NUFA 2RQLA 1FJGE 4DV2E 4DV0E 4NHRA 2EMKA 2YTDA 4JI7E 4WFTA 4X64E 3THNA 2E72A 3EPKA 2EOFA 5FLXC 2LO3A 2YTEA 3J81C 2EPAA 1JK2A 1HR0E 1YSAC 4DV5E 4MLQA 2WBTA 1TF3A 2EM3A 3C4BA 3LMLA 1JK1A 3C4TA 4LF5E 1T38A 4X9JA 1AAYA 3OTOE 3F6GA 1IBLE 1A1GA 3J80C 3C6MA 5A6BA 2EMBA 4WX9A 4JI1E 4NXNE 4J8ZA 3VYYA 2MKDA 2B7VA 4WSGA 5LLQA 5AE2A 4BHCA 4JI5E 5A6JA 2EOXA 4X66E 1N34E 1STUA 4DUYE 3RMPA 2EOIA 4X62E 1PJTA 4O24A 1MEYC 4GEQB 2EOZA 2KOUA 2YTOA 4WSPA 2EJ4A 2J7JA 2EOYA 2ODRC 3P1XA 1XNRE 1N32E 2M9AA 4N4RB 3J7AG 4HEIA 1XMOE 1X6FA 4IJDA 5IXMB 3K6QA 5AC5A 3AUZA 2ENCA 4R2SA 2WZOA 3BGHA 2LTRA 2B9DA 1PJSA 3HPSA 2YTNA 3EPJA 1YPNA 1YYWA 2YRKA 1IBKE 2EM7A 2K7IA 2V88A 2LJUA 2R1FA 4Q35B 4ZYHA 5KL5A 4O4KA 3THOB 4LF4E 2PRTA 1LLMC 1EH6A 2EZ6A 3J7Yp 2EQ3A 4DR6E 5A6KA 1X48A 1X6HA 1T39A 3MHSC 4JV5E 2EMHA 1O0WA 2KONA 2EM5A 3JU0A 2MDGA 1DQ3A 3BIDA 2JWOA 4R8OA 4JYAE 1ZAAC 3MSWA 4GKJE 3AV0A 2NA2A 2EMGA 2LMZA 2DMIA 2LVHA 2MC5A 4WXDA 5LMUE 2EOJA 2EPPA 4YHHE 1YZ9A 4JI6E 2LRSA 3H09A 2JXPA 2YU8A 2EN2A 2EPZA 1IQSA 2YPNA 2ELYA 3UK3C 2L3JA 2MKNA 1DI2A 5DNYA 4KHPE 2M4IA 1IMUA 1ZBQA 3EQ1A 1X6EA 2V89A 1L4SA 2LJHA 2UXDE 2UXCE 2EPUA
chains in the Genus database with same CATH topology
1A1JA 2MKDA 1BB8A 4WSGA 2EOQA 2EP3A 2EN8A 4F6NA 2I13A 2EPRA 2JP9A 2D9HA 2EL5A 1G2DC 1YUJA 1P47A 2EOXA 2ADRA 1Z1BA 2ENAA 2YSPA 2EOIA 1NCSA 2EOEA 1MEYC 4R2RA 2EOSA 2LCEA 2EOZA 2YTFA 2YTOA 2EJ4A 2J7JA 1TF6A 2EMIA 2EOYA 1BBOA 4F6MA 2EM6A 2M9AA 3EPLA 2A25A 2EM9A 2EM0A 2EMXA 2LT7A 1A1FA 1X6FA 2EMFA 2EOOA 2YTIA 4IJDA 2DLKA 3VHTB 2EMYA 1A1IA 5KL6A 4R2QA 1TN9A 2BB8A 2EORA 2YTPA 1A1KA 2CTDA 2ENCA 4R2SA 2EN6A 4GZNC 4R2PA 4FK5C 2EN4A 2EOHA 2YTGA 2CT1A 1A1LA 2YRHA 2YTNA 3EPJA 1UN6B 2WBUA 2GLIA 2JPAA 2YRKA 2CSHA 2DLQA 2EM7A 2ELZA 1UBDC 1YUIA 1WJPA 2R1FA 2EMWA 2NABA 2VRDA 1A1HA 2EMAA 1G2FC 5KL5A 5KL4A 4M9VC 1RMDA 2DRPA 2WCC3 5KL2A 4R2CA 3EPHA 1F2IG 2EN1A 2GHFA 1ZU1A 2PRTA 1LLMC 2EMLA 5KL3A 2ENHA 1X5WA 2EL4A 2EQ3A 1KJKA 1X6HA 2EL6A 3MHSC 2YU5A 1ZR9A 2RSIA 2EMHA 4R2EA 2EM5A 4R2DA 2YTQA 2MDGA 2EMCA 2EMKA 1ZAAC 2WBSA 2EOMA 2YTDA 2EN3A 2EMGA 1DGCA 2DMIA 2E72A 2LVHA 2DGCA 2EOJA 2EQ0A 2EPPA 3EPKA 2EOFA 2RPCA 2HGHA 2LV2A 2EM8A 2EMZA 2LO3A 2YTEA 2YRMA 2EPXA 1X3CA 2EPAA 1JK2A 1YSAC 2EM4A 1B69A 2YU8A 2EN2A 2WBTA 1TF3A 2EM3A 2EQ1A 2EPZA 2ELYA 2EM2A 2EPCA 5KL7A 1JK1A 3M99B 4IS1C 4X9JA 1AAYA 3UK3C 4F2JC 2MKNA 2YSOA 1A1GA 2EE8A 3MHHC 2EN7A 2EMBA 2YTJA 4R2AA 1X6EA 2EPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1J A;  2MKD A;  1BB8 A;  4WSG A;  2EOQ A;  2EP3 A;  2EN8 A;  4F6N A;  2I13 A;  2EPR A;  2JP9 A;  2D9H A;  2EL5 A;  1G2D C;  1YUJ A;  1P47 A;  2EOX A;  2ADR A;  1Z1B A;  2ENA A;  2YSP A;  2EOI A;  1NCS A;  2EOE A;  1MEY C;  4R2R A;  2EOS A;  2LCE A;  2EOZ A;  2YTF A;  2YTO A;  2EJ4 A;  2J7J A;  1TF6 A;  2EMI A;  2EOY A;  1BBO A;  4F6M A;  2EM6 A;  2M9A A;  3EPL A;  2A25 A;  2EM9 A;  2EM0 A;  2EMX A;  2LT7 A;  1A1F A;  1X6F A;  2EMF A;  2EOO A;  2YTI A;  4IJD A;  2DLK A;  3VHT B;  2EMY A;  1A1I A;  5KL6 A;  4R2Q A;  1TN9 A;  2BB8 A;  2EOR A;  2YTP A;  1A1K A;  2CTD A;  2ENC A;  4R2S A;  2EN6 A;  4GZN C;  4R2P A;  4FK5 C;  2EN4 A;  2EOH A;  2YTG A;  2CT1 A;  1A1L A;  2YRH A;  2YTN A;  3EPJ A;  1UN6 B;  2WBU A;  2GLI A;  2JPA A;  2YRK A;  2CSH A;  2DLQ A;  2EM7 A;  2ELZ A;  1UBD C;  1YUI A;  1WJP A;  2R1F A;  2EMW A;  2NAB A;  2VRD A;  1A1H A;  2EMA A;  1G2F C;  5KL5 A;  5KL4 A;  4M9V C;  1RMD A;  2DRP A;  2WCC 3;  5KL2 A;  4R2C A;  3EPH A;  1F2I G;  2EN1 A;  2GHF A;  1ZU1 A;  2PRT A;  1LLM C;  2EML A;  5KL3 A;  2ENH A;  1X5W A;  2EL4 A;  2EQ3 A;  1KJK A;  1X6H A;  2EL6 A;  3MHS C;  2YU5 A;  1ZR9 A;  2RSI A;  2EMH A;  4R2E A;  2EM5 A;  4R2D A;  2YTQ A;  2MDG A;  2EMC A;  2EMK A;  1ZAA C;  2WBS A;  2EOM A;  2YTD A;  2EN3 A;  2EMG A;  1DGC A;  2DMI A;  2E72 A;  2LVH A;  2DGC A;  2EOJ A;  2EQ0 A;  2EPP A;  3EPK A;  2EOF A;  2RPC A;  2HGH A;  2LV2 A;  2EM8 A;  2EMZ A;  2LO3 A;  2YTE A;  2YRM A;  2EPX A;  1X3C A;  2EPA A;  1JK2 A;  1YSA C;  2EM4 A;  1B69 A;  2YU8 A;  2EN2 A;  2WBT A;  1TF3 A;  2EM3 A;  2EQ1 A;  2EPZ A;  2ELY A;  2EM2 A;  2EPC A;  5KL7 A;  1JK1 A;  3M99 B;  4IS1 C;  4X9J A;  1AAY A;  3UK3 C;  4F2J C;  2MKN A;  2YSO A;  1A1G A;  2EE8 A;  3MHH C;  2EN7 A;  2EMB A;  2YTJ A;  4R2A A;  1X6E A;  2EPU A; 
#chains in the Genus database with same CATH topology
 2K4V A;  2LUQ A;  2L92 A;  4LTY A;  4BS9 A;  4JI2 E;  2I13 A;  2EP3 A;  2EN8 A;  2EPR A;  2JR1 A;  2JP9 A;  2V8Q B;  2N3H A;  2HHH E;  1G2D C;  2KHX A;  4DV4 E;  3L00 A;  4O5G A;  1YUJ A;  4B3S E;  4LFA E;  1SFE A;  1Z1B A;  2ENA A;  4DV1 E;  1MGT A;  3F6H A;  2L3C A;  1KYQ A;  4M0V A;  4NXM E;  2EOS A;  2YTF A;  4RH8 A;  2L2N A;  1TF6 A;  1AH5 A;  2MC6 A;  1J26 A;  2FV4 B;  2L33 A;  2A25 A;  4BC7 A;  2EM9 A;  4TUG A;  2LTS A;  1A1F A;  1SR9 A;  4DV6 E;  1A1I A;  5KL6 A;  4R2Q A;  1TN9 A;  2BB8 A;  2EOR A;  2JVA A;  1A1K A;  4DKK A;  1YYK A;  2E1M A;  2EN6 A;  4B3R E;  4DMI A;  4R2P A;  4DR7 E;  2EN4 A;  1A1L A;  1NEI A;  2ODR D;  2R76 A;  5A69 A;  2CSH A;  2DLQ A;  4LFB E;  4JI8 E;  1ZBT A;  2VRD A;  4L5N C;  2EMA A;  1PDA A;  1RMD A;  4R2C A;  3EPH A;  2HC5 A;  1ZU1 A;  1T4N A;  1WHQ A;  4BMJ A;  2MDR A;  2DSY A;  1KJK A;  3BBG A;  2YU5 A;  1ZR9 A;  2EPL X;  2RSI A;  3LLH A;  2FGG A;  1EH8 A;  2YTQ A;  1X47 A;  2EMC A;  3IWB A;  1XMQ E;  4BCA A;  4DUZ E;  1EKZ A;  4WYQ B;  2WBS A;  2EOM A;  1DGC A;  1N36 E;  2L2K B;  2EPO A;  2LV2 A;  2YRM A;  4B3T E;  4MLV A;  4WPY A;  2EM4 A;  2L6M A;  2RTX A;  2V85 A;  3FIG A;  2EM2 A;  1N33 E;  3M99 B;  4RHB B;  3MHH C;  5AAS A;  2EN7 A;  2YTJ A;  1QNT A;  2JOX A;  4KZS A;  2RSM A;  1A1J A;  2I9I A;  2YT4 A;  3HXL A;  2UXB E;  5BR8 E;  2EOQ A;  4F6N A;  2DMY A;  2RS7 A;  2B7T A;  1N3G A;  3IWC A;  5A2Q C;  3ZOQ B;  2ADR A;  2N8X A;  2YSP A;  3JTZ A;  1NCS A;  4P78 A;  3QG5 C;  2ZM6 E;  1GTK A;  1HNW E;  2GPI A;  5IT9 C;  1GQE A;  2LCE A;  2L8T A;  1BBO A;  1J5E E;  1YYO A;  2EPM X;  3KZY A;  2V86 A;  2BBG A;  2F8B A;  1WXR A;  2EMX A;  2RS6 A;  2LT7 A;  5AE1 A;  4DR2 E;  2EOO A;  2N3G A;  4BBY A;  4JI0 E;  3VHT B;  2DLK A;  4OX9 E;  3HTX A;  2EMY A;  4F9A B;  5A6B D;  1YFH A;  3ECR A;  4HTG A;  3HQ1 A;  3DF6 A;  2YTP A;  4ZYE A;  3ADG A;  1WHN A;  4FK5 C;  2HJJ A;  2V83 A;  2Q8U A;  3HPZ A;  4F9C B;  2VE7 C;  5AC4 A;  2WBU A;  5LMN E;  2GLI A;  2JPA A;  4LFC E;  4K0K E;  4O43 A;  2ELZ A;  1UBD C;  1YUI A;  1WJP A;  4LF9 E;  1XNQ E;  4WXC A;  1A1H A;  4M2Z A;  2JY9 A;  2DRP A;  4DR1 E;  2UUA E;  1WRJ A;  2EN1 A;  1T4L B;  2DB2 A;  2ENH A;  2E5L E;  4LF8 E;  4JI3 E;  1X5W A;  4F9B B;  1EH7 A;  2JYA A;  3JAM C;  4BC9 A;  4R2E A;  2H36 X;  2YWQ A;  3ADL A;  3ADI A;  1UHZ A;  5ADZ A;  2LUP B;  1RC7 A;  5AE3 A;  2EN3 A;  4Q28 A;  2DGC A;  5IV8 B;  4AQY E;  3T1H E;  4F54 A;  2EQ0 A;  1UIL A;  2HGH A;  2RPC A;  4M30 A;  2EM8 A;  2EMZ A;  4DR3 E;  2EPX A;  5T6J A;  1X3C A;  1B69 A;  1X49 A;  2EQ1 A;  3C6K A;  5TSE A;  2EPC A;  4LF6 E;  5KL7 A;  2FTX B;  4X8W A;  4IS1 C;  4NZV A;  4OOG C;  4F2J C;  2EPN A;  1IBM E;  2YSO A;  2EE8 A;  4LU9 A;  4R2A A;  2JOB A;  2M1S A;  4L8N A;  3TQM A;  2NUE A;  3BF2 A;  5IWA E;  1BB8 A;  1PJQ A;  1RQ0 A;  4X65 E;  2D9H A;  2EL5 A;  5LL6 R;  1PKP A;  1BBG A;  2F4V E;  4KWY A;  5CFF E;  1P47 A;  1HNZ E;  2DIX A;  3DJW A;  3VK6 A;  2UUC E;  2LE2 A;  5F3W A;  1IQO A;  2EOE A;  2VF1 A;  3IWD A;  4R2R A;  2VQF E;  3OML A;  4I8O A;  2EMI A;  3KZZ A;  4DV7 E;  4F6M A;  2EM6 A;  2CPN A;  3EPL A;  2UUB E;  2EM0 A;  4ZYD A;  2NUG A;  2EMF A;  2YTI A;  4LF7 E;  1I94 E;  4ZYG A;  4B3M E;  5A6A A;  4R03 A;  2CTD A;  2B3T B;  2V87 A;  3KWR A;  2L2M A;  1GZ6 A;  4GZN C;  4JI4 E;  3ADJ A;  2EOH A;  2YTG A;  2CT1 A;  2YRH A;  2EPK X;  1UN6 B;  1HNX E;  4DR5 E;  2M7Q A;  3T1Y E;  4TUI A;  2EMW A;  2NAB A;  2YZT A;  1QU6 A;  1G2F C;  5KL4 A;  4M9V C;  4YY3 E;  2WCC 3;  4DR4 E;  5KL2 A;  2UU9 E;  1F2I G;  1T4O A;  2GHF A;  2EML A;  5KL3 A;  4GKK E;  4P7D A;  2IHR 1;  4BHB A;  2EL4 A;  2EL6 A;  2LBS B;  1FKA E;  3VYX A;  2EWL A;  2VQE E;  4R2D A;  4DV3 E;  2G7H A;  2NUF A;  2RQL A;  1FJG E;  4DV2 E;  4DV0 E;  4NHR A;  2EMK A;  2YTD A;  4JI7 E;  4WFT A;  4X64 E;  3THN A;  2E72 A;  3EPK A;  2EOF A;  5FLX C;  2LO3 A;  2YTE A;  3J81 C;  2EPA A;  1JK2 A;  1HR0 E;  1YSA C;  4DV5 E;  4MLQ A;  2WBT A;  1TF3 A;  2EM3 A;  3C4B A;  3LML A;  1JK1 A;  3C4T A;  4LF5 E;  1T38 A;  4X9J A;  1AAY A;  3OTO E;  3F6G A;  1IBL E;  1A1G A;  3J80 C;  3C6M A;  5A6B A;  2EMB A;  4WX9 A;  4JI1 E;  4NXN E;  4J8Z A;  3VYY A;  2MKD A;  2B7V A;  4WSG A;  5LLQ A;  5AE2 A;  4BHC A;  4JI5 E;  5A6J A;  2EOX A;  4X66 E;  1N34 E;  1STU A;  4DUY E;  3RMP A;  2EOI A;  4X62 E;  1PJT A;  4O24 A;  1MEY C;  4GEQ B;  2EOZ A;  2KOU A;  2YTO A;  4WSP A;  2EJ4 A;  2J7J A;  2EOY A;  2ODR C;  3P1X A;  1XNR E;  1N32 E;  2M9A A;  4N4R B;  3J7A G;  4HEI A;  1XMO E;  1X6F A;  4IJD A;  5IXM B;  3K6Q A;  5AC5 A;  3AUZ A;  2ENC A;  4R2S A;  2WZO A;  3BGH A;  2LTR A;  2B9D A;  1PJS A;  3HPS A;  2YTN A;  3EPJ A;  1YPN A;  1YYW A;  2YRK A;  1IBK E;  2EM7 A;  2K7I A;  2V88 A;  2LJU A;  2R1F A;  4Q35 B;  4ZYH A;  5KL5 A;  4O4K A;  3THO B;  4LF4 E;  2PRT A;  1LLM C;  1EH6 A;  2EZ6 A;  3J7Y p;  2EQ3 A;  4DR6 E;  5A6K A;  1X48 A;  1X6H A;  1T39 A;  3MHS C;  4JV5 E;  2EMH A;  1O0W A;  2KON A;  2EM5 A;  3JU0 A;  2MDG A;  1DQ3 A;  3BID A;  2JWO A;  4R8O A;  4JYA E;  1ZAA C;  3MSW A;  4GKJ E;  3AV0 A;  2NA2 A;  2EMG A;  2LMZ A;  2DMI A;  2LVH A;  2MC5 A;  4WXD A;  5LMU E;  2EOJ A;  2EPP A;  4YHH E;  1YZ9 A;  4JI6 E;  2LRS A;  3H09 A;  2JXP A;  2YU8 A;  2EN2 A;  2EPZ A;  1IQS A;  2YPN A;  2ELY A;  3UK3 C;  2L3J A;  2MKN A;  1DI2 A;  5DNY A;  4KHP E;  2M4I A;  1IMU A;  1ZBQ A;  3EQ1 A;  1X6E A;  2V89 A;  1L4S A;  2LJH A;  2UXD E;  2UXC E;  2EPU A; 
#chains in the Genus database with same CATH homology
 1A1J A;  2MKD A;  1BB8 A;  4WSG A;  2EOQ A;  2EP3 A;  2EN8 A;  4F6N A;  2I13 A;  2EPR A;  2JP9 A;  2D9H A;  2EL5 A;  1G2D C;  1YUJ A;  1P47 A;  2EOX A;  2ADR A;  1Z1B A;  2ENA A;  2YSP A;  2EOI A;  1NCS A;  2EOE A;  1MEY C;  4R2R A;  2EOS A;  2LCE A;  2EOZ A;  2YTF A;  2YTO A;  2EJ4 A;  2J7J A;  1TF6 A;  2EMI A;  2EOY A;  1BBO A;  4F6M A;  2EM6 A;  2M9A A;  3EPL A;  2A25 A;  2EM9 A;  2EM0 A;  2EMX A;  2LT7 A;  1A1F A;  1X6F A;  2EMF A;  2EOO A;  2YTI A;  4IJD A;  2DLK A;  3VHT B;  2EMY A;  1A1I A;  5KL6 A;  4R2Q A;  1TN9 A;  2BB8 A;  2EOR A;  2YTP A;  1A1K A;  2CTD A;  2ENC A;  4R2S A;  2EN6 A;  4GZN C;  4R2P A;  4FK5 C;  2EN4 A;  2EOH A;  2YTG A;  2CT1 A;  1A1L A;  2YRH A;  2YTN A;  3EPJ A;  1UN6 B;  2WBU A;  2GLI A;  2JPA A;  2YRK A;  2CSH A;  2DLQ A;  2EM7 A;  2ELZ A;  1UBD C;  1YUI A;  1WJP A;  2R1F A;  2EMW A;  2NAB A;  2VRD A;  1A1H A;  2EMA A;  1G2F C;  5KL5 A;  5KL4 A;  4M9V C;  1RMD A;  2DRP A;  2WCC 3;  5KL2 A;  4R2C A;  3EPH A;  1F2I G;  2EN1 A;  2GHF A;  1ZU1 A;  2PRT A;  1LLM C;  2EML A;  5KL3 A;  2ENH A;  1X5W A;  2EL4 A;  2EQ3 A;  1KJK A;  1X6H A;  2EL6 A;  3MHS C;  2YU5 A;  1ZR9 A;  2RSI A;  2EMH A;  4R2E A;  2EM5 A;  4R2D A;  2YTQ A;  2MDG A;  2EMC A;  2EMK A;  1ZAA C;  2WBS A;  2EOM A;  2YTD A;  2EN3 A;  2EMG A;  1DGC A;  2DMI A;  2E72 A;  2LVH A;  2DGC A;  2EOJ A;  2EQ0 A;  2EPP A;  3EPK A;  2EOF A;  2RPC A;  2HGH A;  2LV2 A;  2EM8 A;  2EMZ A;  2LO3 A;  2YTE A;  2YRM A;  2EPX A;  1X3C A;  2EPA A;  1JK2 A;  1YSA C;  2EM4 A;  1B69 A;  2YU8 A;  2EN2 A;  2WBT A;  1TF3 A;  2EM3 A;  2EQ1 A;  2EPZ A;  2ELY A;  2EM2 A;  2EPC A;  5KL7 A;  1JK1 A;  3M99 B;  4IS1 C;  4X9J A;  1AAY A;  3UK3 C;  4F2J C;  2MKN A;  2YSO A;  1A1G A;  2EE8 A;  3MHH C;  2EN7 A;  2EMB A;  2YTJ A;  4R2A A;  1X6E A;  2EPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...