2EOJA

Solution structure of the c2h2 type zinc finger (region 355-385) of human zinc finger protein 268
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTGENPYECCECGKVFSRKDQLVSHQKTHSGQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 355-385) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eojA01
4R2PA 2EM3A 1YUIA 2LT7A 1KJKA 2JPAA 1A1IA 2YU8A 2MKNA 4F6MA 1A1FA 2WBTA 2EMXA 4R2CA 2J7JA 1ZAAC 2ENHA 2EM5A 2EM0A 2EPAA 2DGCA 2EMLA 2ENCA 1MEYC 2DLQA 2EOZA 2PRTA 2CSHA 2R1FA 2YSOA 2YTJA 1JK1A 5KL2A 1X5WA 2EL6A 2EMZA 2EN3A 2YTEA 2EN1A 1G2DC 2YSPA 2BB8A 2EMYA 1X6HA 2EMBA 2MKDA 2D9HA 2YTOA 3EPKA 2VRDA 2YU5A 1UBDC 2YRHA 3MHHC 4X9JA 1BBOA 2CT1A 2EPUA 3VHTB 4IJDA 4WSGA 2EE8A 4GZNC 2EM2A 5KL5A 2MDGA 2YTPA 1A1LA 2YTDA 1RMDA 2E72A 1A1KA 2HGHA 2EN6A 2YRMA 3EPHA 1BB8A 1YUJA 2EOJA 1A1HA 2ENAA 2EOSA 2EMCA 2DLKA 2WBSA 2DRPA 2YTNA 2YTIA 3UK3C 1LLMC 2JP9A 2YTQA 2EL4A 2EORA 2EMHA 2EQ1A 1X6EA 2RSIA 1NCSA 2EM7A 2EOYA 2EOIA 2EOHA 1WJPA 2EOOA 1JK2A 2EL5A 2EQ0A 2CTDA 2YTGA 2EJ4A 3EPJA 1TF3A 2EM6A 2EPXA 4R2DA 4IS1C 2EOMA 4M9VC 3MHSC 1ZU1A 2EMGA 2EMAA 2ELZA 2LCEA 2EMFA 2EN7A 1A1GA 5KL7A 4F2JC 2EN4A 2YTFA 1UN6B 2ELYA 2EOEA 1P47A 5KL6A 2EMKA 2EM9A 4FK5C 2LV2A 2WBUA 1TF6A 2EM8A 4R2RA 2EQ3A 2YRKA 1X3CA 2NABA 4R2SA 2I13A 1YSAC 1ZR9A 4R2QA 5KL3A 1A1JA 2EOFA 2GLIA 1X6FA 4R2AA 2EPRA 2A25A 2LVHA 1Z1BA 2EM4A 2EOXA 1TN9A 4F6NA 1F2IG 1AAYA 2EOQA 2EMIA 2ADRA 2M9AA 3M99B 2LO3A 1G2FC 2EPPA 1DGCA 2EPZA 2DMIA 2RPCA 2WCC3 2EN8A 4R2EA 2EN2A 2EMWA 3EPLA 1B69A 2EPCA 5KL4A 2GHFA 2EP3A
chains in the Genus database with same CATH superfamily
4R2PA 2V85A 2LT7A 1KJKA 4B3TE 4O24A 4DV5E 4F9AB 2EZ6A 2JXPA 3J7AG 1A1FA 2L2NA 2WBTA 3C4BA 2EMXA 2J7JA 2K7IA 2UXBE 2BBGA 1IBME 4DR1E 2NA2A 2EM5A 4BCAA 2B7TA 2DGCA 4F9CB 1PDAA 1MGTA 2EOZA 2CSHA 4WXCA 2R1FA 4Q35B 4O43A 1AH5A 3ECRA 4LFAE 2F4VE 2V8QB 1X6HA 4JI0E 2VE7C 2V88A 2N3HA 3L00A 3THNA 2YZTA 2D9HA 2YTOA 3EPKA 2VRDA 2YRHA 1WHQA 2JOBA 2FTXB 4F9BB 1PJSA 3HPSA 2MDGA 4L5NC 4DR4E 2V89A 5A6AA 2Q8UA 1L4SA 2E72A 4BBYA 1A1KA 2YRMA 1BB8A 4NXME 1DI2A 1STUA 2DRPA 5TSEA 3UK3C 1LLMC 2EL4A 2EMHA 2DIXA 5A69A 2RSIA 1IMUA 2EM7A 2L92A 2EOOA 2EL5A 2EQ0A 4YHHE 4DR2E 2YTGA 4DR3E 4RHBB 2K4VA 4X62E 3JU0A 4DR6E 2EMAA 2EMFA 1A1GA 1HNZE 2KOUA 1XNQE 3BGHA 4TUIA 4LTYA 2YT4A 2UXDE 2LJHA 2ELYA 2KONA 3HXLA 2WBUA 5LLQA 2DMYA 5AE3A 1TF6A 2YRKA 4KZSA 2EPNA 2I13A 4DV1E 1GQEA 1N3GA 1A1JA 4LF7E 2EPRA 1GTKA 2NUFA 3OTOE 5AE1A 1F2IG 1G2FC 1DGCA 2EPZA 2RPCA 3RMPA 3BIDA 3IWBA 4X8WA 3H09A 2EPCA 5KL4A 4R2AA 2VQEE 2EORA 4L8NA 2MC6A 2FGGA 4X66E 3BF2A 2JVAA 3HPZA 2L8TA 5A6BD 4DUZE 4WX9A 3F6GA 2VF1A 2EPAA 2EPLX 4TUGA 1MEYC 1EH7A 2YSOA 4GKKE 1JK1A 5KL2A 1X5WA 4LF4E 2EN1A 1G2DC 2YSPA 5AASA 2EMYA 2I9IA 2M1SA 1IQOA 5ADZA 4B3SE 2MKDA 4K0KE 2L33A 1N33E 2YU5A 1UBDC 3MHHC 4NXNE 4LF8E 4DV2E 4X9JA 4B3RE 2RTXA 4JI7E 4JI3E 5LL6R 1YPNA 2EE8A 1RC7A 4GZNC 2B3TB 5F3WA 3OMLA 5A2QC 4B3ME 1EH8A 3JTZA 2M4IA 5LMUE 2YTDA 1A1LA 1RMDA 1T4NA 4WPYA 1ZBTA 5IV8B 2UXCE 4JI8E 2EOJA 1YYOA 2ENAA 2H36X 1YZ9A 2EMCA 2YTNA 2YTIA 5AE2A 2LMZA 5CFFE 2KHXA 1X6EA 1SFEA 2EOIA 4N4RB 2ODRD 1WJPA 2EPOA 4JI1E 5IT9C 1TF3A 3EPJA 3T1HE 2EM6A 1X48A 1N32E 4GKJE 2L2MA 4LU9A 2LCEA 5KL7A 4X65E 4LF5E 1FJGE 2G7HA 1O0WA 2V87A 1XNRE 2MC5A 5KL6A 2JWOA 3QG5C 4FK5C 3HQ1A 5BR8E 1T4LB 3J7Yp 4MLVA 2NABA 3ADGA 2LTSA 1HNWE 1ZR9A 2EOFA 3LMLA 1X6FA 2L6MA 4NZVA 2LVHA 4F6NA 4WFTA 4WXDA 4OOGC 2ADRA 3ADLA 1YYKA 2EN8A 2EMWA 3EPLA 3VYYA 4LF9E 4BHBA 1PJQA 2EP3A 1EKZA 2UUBE 1XMQE 4WYQB 2EM3A 1YUIA 4DR7E 3KZYA 4J8ZA 2JPAA 3LLHA 2YU8A 4R2CA 4ZYHA 4BC7A 1ZAAC 2ENHA 1J5EE 4BS9A 2EPKX 2EM0A 2RSMA 1X47A 4R8OA 2DLQA 2PRTA 2VQFE 4JI5E 1YFHA 2EL6A 2EMZA 1HR0E 4LFBE 1UHZA 2EN3A 4HEIA 2JY9A 4MLQA 2CPNA 2UUAE 4Q28A 4F54A 2EMBA 4YY3E 3AV0A 4BHCA 4X64E 3IWDA 2CT1A 3VHTB 5LMNE 4JYAE 2JYAA 2EM2A 5KL5A 2YTPA 1I94E 3IWCA 5DNYA 2HJJA 4DV0E 3EPHA 4ZYGA 1A1HA 3C6MA 2EOSA 2WBSA 2DLKA 3MSWA 4DUYE 4AQYE 4DV7E 2EQ1A 1T39A 3BBGA 1NCSA 4JV5E 1NEIA 3F6HA 1JK2A 2ODRC 3JAMC 2HC5A 2LE2A 2DSYA 1GZ6A 4IS1C 4DKKA 4M9VC 3MHSC 4LF6E 2B9DA 1BBGA 1ZU1A 2EMGA 3TQMA 2NUEA 2EN4A 1SR9A 2YTFA 3J81C 4BC9A 1FKAE 4DV6E 4M0VA 2RS6A 3DJWA 4HTGA 2ZM6E 2EOEA 3VK6A 2EMKA 2LV2A 2EM8A 4R2RA 1DQ3A 2EQ3A 2LUPB 5A6BA 2LRSA 1X3CA 1N36E 1IBKE 1YSAC 3J80C 2GLIA 4JI4E 1Z1BA 2JOXA 5IWAE 1WRJA 2UU9E 4JI2E 1AAYA 2IHR1 4I8OA 3M99B 4WSPA 2E5LE 2EPPA 4LFCE 2HHHE 2DMIA 2EPMX 2GPIA 4M2ZA 5AC4A 3C4TA 2EWLA 5A6KA 2FV4B 3ADJA 2GHFA 2RQLA 4F6MA 2M7QA 4P78A 3ZOQB 4KHPE 5T6JA 1A1IA 5FLXC 2MKNA 4DMIA 2E1MA 1EH6A 2LJUA 1UILA 2L3CA 1QNTA 2WZOA 3ADIA 2B7VA 2EMLA 2ENCA 3KZZA 4BMJA 2YTJA 1IBLE 2YTEA 2YWQA 2BB8A 3FIGA 3HTXA 2V86A 1BBOA 2EPUA 1X49A 2LUQA 2NUGA 1ZBQA 4IJDA 4WSGA 1WXRA 1J26A 4RH8A 4KWYA 3C6KA 4O4KA 4NHRA 2YPNA 1N34E 1WHNA 1RQ0A 2HGHA 2EN6A 1KYQA 1YUJA 3EQ1A 1XMOE 4R03A 1IQSA 1T4OA 2JP9A 3T1YE 2YTQA 4OX9E 1HNXE 4DV3E 2EOYA 2EOHA 2JR1A 2CTDA 3DF6A 2EJ4A 2R76A 2N3GA 2EPXA 4R2DA 2EOMA 3KWRA 4O5GA 4DR5E 2UUCE 2ELZA 2EN7A 4F2JC 4ZYDA 2L2KB 2MDRA 2L3JA 2F8BA 1UN6B 3THOB 1P47A 2LTRA 2EM9A 2N8XA 1T38A 4DV4E 1YYWA 5IXMB 4R2SA 4R2QA 5KL3A 3P1XA 4M30A 2A25A 2EM4A 2EOXA 1QU6A 5A6JA 5AC5A 1PKPA 1TN9A 4ZYEA 2EOQA 2RS7A 2LBSB 2EMIA 2M9AA 2LO3A 4P7DA 2WCC3 1PJTA 4R2EA 2EN2A 2V83A 1B69A 3K6QA 4GEQB 4JI6E 3VYXA 3AUZA 2DB2A
chains in the Genus database with same CATH topology
4R2PA 2EM3A 1YUIA 2LT7A 1KJKA 2JPAA 1A1IA 2YU8A 2MKNA 4F6MA 1A1FA 2WBTA 2EMXA 4R2CA 2J7JA 1ZAAC 2ENHA 2EM5A 2EM0A 2EPAA 2DGCA 2EMLA 2ENCA 1MEYC 2DLQA 2EOZA 2PRTA 2CSHA 2R1FA 2YSOA 2YTJA 1JK1A 5KL2A 1X5WA 2EL6A 2EMZA 2EN3A 2YTEA 2EN1A 1G2DC 2YSPA 2BB8A 2EMYA 1X6HA 2EMBA 2MKDA 2D9HA 2YTOA 3EPKA 2VRDA 2YU5A 1UBDC 2YRHA 3MHHC 4X9JA 1BBOA 2CT1A 2EPUA 3VHTB 4IJDA 4WSGA 2EE8A 4GZNC 2EM2A 5KL5A 2MDGA 2YTPA 1A1LA 2YTDA 1RMDA 2E72A 1A1KA 2HGHA 2EN6A 2YRMA 3EPHA 1BB8A 1YUJA 2EOJA 1A1HA 2ENAA 2EOSA 2EMCA 2DLKA 2WBSA 2DRPA 2YTNA 2YTIA 3UK3C 1LLMC 2JP9A 2YTQA 2EL4A 2EORA 2EMHA 2EQ1A 1X6EA 2RSIA 1NCSA 2EM7A 2EOYA 2EOIA 2EOHA 1WJPA 2EOOA 1JK2A 2EL5A 2EQ0A 2CTDA 2YTGA 2EJ4A 3EPJA 1TF3A 2EM6A 2EPXA 4R2DA 4IS1C 2EOMA 4M9VC 3MHSC 1ZU1A 2EMGA 2EMAA 2ELZA 2LCEA 2EMFA 2EN7A 1A1GA 5KL7A 4F2JC 2EN4A 2YTFA 1UN6B 2ELYA 2EOEA 1P47A 5KL6A 2EMKA 2EM9A 4FK5C 2LV2A 2WBUA 1TF6A 2EM8A 4R2RA 2EQ3A 2YRKA 1X3CA 2NABA 4R2SA 2I13A 1YSAC 1ZR9A 4R2QA 5KL3A 1A1JA 2EOFA 2GLIA 1X6FA 4R2AA 2EPRA 2A25A 2LVHA 1Z1BA 2EM4A 2EOXA 1TN9A 4F6NA 1F2IG 1AAYA 2EOQA 2EMIA 2ADRA 2M9AA 3M99B 2LO3A 1G2FC 2EPPA 1DGCA 2EPZA 2DMIA 2RPCA 2WCC3 2EN8A 4R2EA 2EN2A 2EMWA 3EPLA 1B69A 2EPCA 5KL4A 2GHFA 2EP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2P A;  2EM3 A;  1YUI A;  2LT7 A;  1KJK A;  2JPA A;  1A1I A;  2YU8 A;  2MKN A;  4F6M A;  1A1F A;  2WBT A;  2EMX A;  4R2C A;  2J7J A;  1ZAA C;  2ENH A;  2EM5 A;  2EM0 A;  2EPA A;  2DGC A;  2EML A;  2ENC A;  1MEY C;  2DLQ A;  2EOZ A;  2PRT A;  2CSH A;  2R1F A;  2YSO A;  2YTJ A;  1JK1 A;  5KL2 A;  1X5W A;  2EL6 A;  2EMZ A;  2EN3 A;  2YTE A;  2EN1 A;  1G2D C;  2YSP A;  2BB8 A;  2EMY A;  1X6H A;  2EMB A;  2MKD A;  2D9H A;  2YTO A;  3EPK A;  2VRD A;  2YU5 A;  1UBD C;  2YRH A;  3MHH C;  4X9J A;  1BBO A;  2CT1 A;  2EPU A;  3VHT B;  4IJD A;  4WSG A;  2EE8 A;  4GZN C;  2EM2 A;  5KL5 A;  2MDG A;  2YTP A;  1A1L A;  2YTD A;  1RMD A;  2E72 A;  1A1K A;  2HGH A;  2EN6 A;  2YRM A;  3EPH A;  1BB8 A;  1YUJ A;  2EOJ A;  1A1H A;  2ENA A;  2EOS A;  2EMC A;  2DLK A;  2WBS A;  2DRP A;  2YTN A;  2YTI A;  3UK3 C;  1LLM C;  2JP9 A;  2YTQ A;  2EL4 A;  2EOR A;  2EMH A;  2EQ1 A;  1X6E A;  2RSI A;  1NCS A;  2EM7 A;  2EOY A;  2EOI A;  2EOH A;  1WJP A;  2EOO A;  1JK2 A;  2EL5 A;  2EQ0 A;  2CTD A;  2YTG A;  2EJ4 A;  3EPJ A;  1TF3 A;  2EM6 A;  2EPX A;  4R2D A;  4IS1 C;  2EOM A;  4M9V C;  3MHS C;  1ZU1 A;  2EMG A;  2EMA A;  2ELZ A;  2LCE A;  2EMF A;  2EN7 A;  1A1G A;  5KL7 A;  4F2J C;  2EN4 A;  2YTF A;  1UN6 B;  2ELY A;  2EOE A;  1P47 A;  5KL6 A;  2EMK A;  2EM9 A;  4FK5 C;  2LV2 A;  2WBU A;  1TF6 A;  2EM8 A;  4R2R A;  2EQ3 A;  2YRK A;  1X3C A;  2NAB A;  4R2S A;  2I13 A;  1YSA C;  1ZR9 A;  4R2Q A;  5KL3 A;  1A1J A;  2EOF A;  2GLI A;  1X6F A;  4R2A A;  2EPR A;  2A25 A;  2LVH A;  1Z1B A;  2EM4 A;  2EOX A;  1TN9 A;  4F6N A;  1F2I G;  1AAY A;  2EOQ A;  2EMI A;  2ADR A;  2M9A A;  3M99 B;  2LO3 A;  1G2F C;  2EPP A;  1DGC A;  2EPZ A;  2DMI A;  2RPC A;  2WCC 3;  2EN8 A;  4R2E A;  2EN2 A;  2EMW A;  3EPL A;  1B69 A;  2EPC A;  5KL4 A;  2GHF A;  2EP3 A; 
#chains in the Genus database with same CATH topology
 4R2P A;  2V85 A;  2LT7 A;  1KJK A;  4B3T E;  4O24 A;  4DV5 E;  4F9A B;  2EZ6 A;  2JXP A;  3J7A G;  1A1F A;  2L2N A;  2WBT A;  3C4B A;  2EMX A;  2J7J A;  2K7I A;  2UXB E;  2BBG A;  1IBM E;  4DR1 E;  2NA2 A;  2EM5 A;  4BCA A;  2B7T A;  2DGC A;  4F9C B;  1PDA A;  1MGT A;  2EOZ A;  2CSH A;  4WXC A;  2R1F A;  4Q35 B;  4O43 A;  1AH5 A;  3ECR A;  4LFA E;  2F4V E;  2V8Q B;  1X6H A;  4JI0 E;  2VE7 C;  2V88 A;  2N3H A;  3L00 A;  3THN A;  2YZT A;  2D9H A;  2YTO A;  3EPK A;  2VRD A;  2YRH A;  1WHQ A;  2JOB A;  2FTX B;  4F9B B;  1PJS A;  3HPS A;  2MDG A;  4L5N C;  4DR4 E;  2V89 A;  5A6A A;  2Q8U A;  1L4S A;  2E72 A;  4BBY A;  1A1K A;  2YRM A;  1BB8 A;  4NXM E;  1DI2 A;  1STU A;  2DRP A;  5TSE A;  3UK3 C;  1LLM C;  2EL4 A;  2EMH A;  2DIX A;  5A69 A;  2RSI A;  1IMU A;  2EM7 A;  2L92 A;  2EOO A;  2EL5 A;  2EQ0 A;  4YHH E;  4DR2 E;  2YTG A;  4DR3 E;  4RHB B;  2K4V A;  4X62 E;  3JU0 A;  4DR6 E;  2EMA A;  2EMF A;  1A1G A;  1HNZ E;  2KOU A;  1XNQ E;  3BGH A;  4TUI A;  4LTY A;  2YT4 A;  2UXD E;  2LJH A;  2ELY A;  2KON A;  3HXL A;  2WBU A;  5LLQ A;  2DMY A;  5AE3 A;  1TF6 A;  2YRK A;  4KZS A;  2EPN A;  2I13 A;  4DV1 E;  1GQE A;  1N3G A;  1A1J A;  4LF7 E;  2EPR A;  1GTK A;  2NUF A;  3OTO E;  5AE1 A;  1F2I G;  1G2F C;  1DGC A;  2EPZ A;  2RPC A;  3RMP A;  3BID A;  3IWB A;  4X8W A;  3H09 A;  2EPC A;  5KL4 A;  4R2A A;  2VQE E;  2EOR A;  4L8N A;  2MC6 A;  2FGG A;  4X66 E;  3BF2 A;  2JVA A;  3HPZ A;  2L8T A;  5A6B D;  4DUZ E;  4WX9 A;  3F6G A;  2VF1 A;  2EPA A;  2EPL X;  4TUG A;  1MEY C;  1EH7 A;  2YSO A;  4GKK E;  1JK1 A;  5KL2 A;  1X5W A;  4LF4 E;  2EN1 A;  1G2D C;  2YSP A;  5AAS A;  2EMY A;  2I9I A;  2M1S A;  1IQO A;  5ADZ A;  4B3S E;  2MKD A;  4K0K E;  2L33 A;  1N33 E;  2YU5 A;  1UBD C;  3MHH C;  4NXN E;  4LF8 E;  4DV2 E;  4X9J A;  4B3R E;  2RTX A;  4JI7 E;  4JI3 E;  5LL6 R;  1YPN A;  2EE8 A;  1RC7 A;  4GZN C;  2B3T B;  5F3W A;  3OML A;  5A2Q C;  4B3M E;  1EH8 A;  3JTZ A;  2M4I A;  5LMU E;  2YTD A;  1A1L A;  1RMD A;  1T4N A;  4WPY A;  1ZBT A;  5IV8 B;  2UXC E;  4JI8 E;  2EOJ A;  1YYO A;  2ENA A;  2H36 X;  1YZ9 A;  2EMC A;  2YTN A;  2YTI A;  5AE2 A;  2LMZ A;  5CFF E;  2KHX A;  1X6E A;  1SFE A;  2EOI A;  4N4R B;  2ODR D;  1WJP A;  2EPO A;  4JI1 E;  5IT9 C;  1TF3 A;  3EPJ A;  3T1H E;  2EM6 A;  1X48 A;  1N32 E;  4GKJ E;  2L2M A;  4LU9 A;  2LCE A;  5KL7 A;  4X65 E;  4LF5 E;  1FJG E;  2G7H A;  1O0W A;  2V87 A;  1XNR E;  2MC5 A;  5KL6 A;  2JWO A;  3QG5 C;  4FK5 C;  3HQ1 A;  5BR8 E;  1T4L B;  3J7Y p;  4MLV A;  2NAB A;  3ADG A;  2LTS A;  1HNW E;  1ZR9 A;  2EOF A;  3LML A;  1X6F A;  2L6M A;  4NZV A;  2LVH A;  4F6N A;  4WFT A;  4WXD A;  4OOG C;  2ADR A;  3ADL A;  1YYK A;  2EN8 A;  2EMW A;  3EPL A;  3VYY A;  4LF9 E;  4BHB A;  1PJQ A;  2EP3 A;  1EKZ A;  2UUB E;  1XMQ E;  4WYQ B;  2EM3 A;  1YUI A;  4DR7 E;  3KZY A;  4J8Z A;  2JPA A;  3LLH A;  2YU8 A;  4R2C A;  4ZYH A;  4BC7 A;  1ZAA C;  2ENH A;  1J5E E;  4BS9 A;  2EPK X;  2EM0 A;  2RSM A;  1X47 A;  4R8O A;  2DLQ A;  2PRT A;  2VQF E;  4JI5 E;  1YFH A;  2EL6 A;  2EMZ A;  1HR0 E;  4LFB E;  1UHZ A;  2EN3 A;  4HEI A;  2JY9 A;  4MLQ A;  2CPN A;  2UUA E;  4Q28 A;  4F54 A;  2EMB A;  4YY3 E;  3AV0 A;  4BHC A;  4X64 E;  3IWD A;  2CT1 A;  3VHT B;  5LMN E;  4JYA E;  2JYA A;  2EM2 A;  5KL5 A;  2YTP A;  1I94 E;  3IWC A;  5DNY A;  2HJJ A;  4DV0 E;  3EPH A;  4ZYG A;  1A1H A;  3C6M A;  2EOS A;  2WBS A;  2DLK A;  3MSW A;  4DUY E;  4AQY E;  4DV7 E;  2EQ1 A;  1T39 A;  3BBG A;  1NCS A;  4JV5 E;  1NEI A;  3F6H A;  1JK2 A;  2ODR C;  3JAM C;  2HC5 A;  2LE2 A;  2DSY A;  1GZ6 A;  4IS1 C;  4DKK A;  4M9V C;  3MHS C;  4LF6 E;  2B9D A;  1BBG A;  1ZU1 A;  2EMG A;  3TQM A;  2NUE A;  2EN4 A;  1SR9 A;  2YTF A;  3J81 C;  4BC9 A;  1FKA E;  4DV6 E;  4M0V A;  2RS6 A;  3DJW A;  4HTG A;  2ZM6 E;  2EOE A;  3VK6 A;  2EMK A;  2LV2 A;  2EM8 A;  4R2R A;  1DQ3 A;  2EQ3 A;  2LUP B;  5A6B A;  2LRS A;  1X3C A;  1N36 E;  1IBK E;  1YSA C;  3J80 C;  2GLI A;  4JI4 E;  1Z1B A;  2JOX A;  5IWA E;  1WRJ A;  2UU9 E;  4JI2 E;  1AAY A;  2IHR 1;  4I8O A;  3M99 B;  4WSP A;  2E5L E;  2EPP A;  4LFC E;  2HHH E;  2DMI A;  2EPM X;  2GPI A;  4M2Z A;  5AC4 A;  3C4T A;  2EWL A;  5A6K A;  2FV4 B;  3ADJ A;  2GHF A;  2RQL A;  4F6M A;  2M7Q A;  4P78 A;  3ZOQ B;  4KHP E;  5T6J A;  1A1I A;  5FLX C;  2MKN A;  4DMI A;  2E1M A;  1EH6 A;  2LJU A;  1UIL A;  2L3C A;  1QNT A;  2WZO A;  3ADI A;  2B7V A;  2EML A;  2ENC A;  3KZZ A;  4BMJ A;  2YTJ A;  1IBL E;  2YTE A;  2YWQ A;  2BB8 A;  3FIG A;  3HTX A;  2V86 A;  1BBO A;  2EPU A;  1X49 A;  2LUQ A;  2NUG A;  1ZBQ A;  4IJD A;  4WSG A;  1WXR A;  1J26 A;  4RH8 A;  4KWY A;  3C6K A;  4O4K A;  4NHR A;  2YPN A;  1N34 E;  1WHN A;  1RQ0 A;  2HGH A;  2EN6 A;  1KYQ A;  1YUJ A;  3EQ1 A;  1XMO E;  4R03 A;  1IQS A;  1T4O A;  2JP9 A;  3T1Y E;  2YTQ A;  4OX9 E;  1HNX E;  4DV3 E;  2EOY A;  2EOH A;  2JR1 A;  2CTD A;  3DF6 A;  2EJ4 A;  2R76 A;  2N3G A;  2EPX A;  4R2D A;  2EOM A;  3KWR A;  4O5G A;  4DR5 E;  2UUC E;  2ELZ A;  2EN7 A;  4F2J C;  4ZYD A;  2L2K B;  2MDR A;  2L3J A;  2F8B A;  1UN6 B;  3THO B;  1P47 A;  2LTR A;  2EM9 A;  2N8X A;  1T38 A;  4DV4 E;  1YYW A;  5IXM B;  4R2S A;  4R2Q A;  5KL3 A;  3P1X A;  4M30 A;  2A25 A;  2EM4 A;  2EOX A;  1QU6 A;  5A6J A;  5AC5 A;  1PKP A;  1TN9 A;  4ZYE A;  2EOQ A;  2RS7 A;  2LBS B;  2EMI A;  2M9A A;  2LO3 A;  4P7D A;  2WCC 3;  1PJT A;  4R2E A;  2EN2 A;  2V83 A;  1B69 A;  3K6Q A;  4GEQ B;  4JI6 E;  3VYX A;  3AUZ A;  2DB2 A; 
#chains in the Genus database with same CATH homology
 4R2P A;  2EM3 A;  1YUI A;  2LT7 A;  1KJK A;  2JPA A;  1A1I A;  2YU8 A;  2MKN A;  4F6M A;  1A1F A;  2WBT A;  2EMX A;  4R2C A;  2J7J A;  1ZAA C;  2ENH A;  2EM5 A;  2EM0 A;  2EPA A;  2DGC A;  2EML A;  2ENC A;  1MEY C;  2DLQ A;  2EOZ A;  2PRT A;  2CSH A;  2R1F A;  2YSO A;  2YTJ A;  1JK1 A;  5KL2 A;  1X5W A;  2EL6 A;  2EMZ A;  2EN3 A;  2YTE A;  2EN1 A;  1G2D C;  2YSP A;  2BB8 A;  2EMY A;  1X6H A;  2EMB A;  2MKD A;  2D9H A;  2YTO A;  3EPK A;  2VRD A;  2YU5 A;  1UBD C;  2YRH A;  3MHH C;  4X9J A;  1BBO A;  2CT1 A;  2EPU A;  3VHT B;  4IJD A;  4WSG A;  2EE8 A;  4GZN C;  2EM2 A;  5KL5 A;  2MDG A;  2YTP A;  1A1L A;  2YTD A;  1RMD A;  2E72 A;  1A1K A;  2HGH A;  2EN6 A;  2YRM A;  3EPH A;  1BB8 A;  1YUJ A;  2EOJ A;  1A1H A;  2ENA A;  2EOS A;  2EMC A;  2DLK A;  2WBS A;  2DRP A;  2YTN A;  2YTI A;  3UK3 C;  1LLM C;  2JP9 A;  2YTQ A;  2EL4 A;  2EOR A;  2EMH A;  2EQ1 A;  1X6E A;  2RSI A;  1NCS A;  2EM7 A;  2EOY A;  2EOI A;  2EOH A;  1WJP A;  2EOO A;  1JK2 A;  2EL5 A;  2EQ0 A;  2CTD A;  2YTG A;  2EJ4 A;  3EPJ A;  1TF3 A;  2EM6 A;  2EPX A;  4R2D A;  4IS1 C;  2EOM A;  4M9V C;  3MHS C;  1ZU1 A;  2EMG A;  2EMA A;  2ELZ A;  2LCE A;  2EMF A;  2EN7 A;  1A1G A;  5KL7 A;  4F2J C;  2EN4 A;  2YTF A;  1UN6 B;  2ELY A;  2EOE A;  1P47 A;  5KL6 A;  2EMK A;  2EM9 A;  4FK5 C;  2LV2 A;  2WBU A;  1TF6 A;  2EM8 A;  4R2R A;  2EQ3 A;  2YRK A;  1X3C A;  2NAB A;  4R2S A;  2I13 A;  1YSA C;  1ZR9 A;  4R2Q A;  5KL3 A;  1A1J A;  2EOF A;  2GLI A;  1X6F A;  4R2A A;  2EPR A;  2A25 A;  2LVH A;  1Z1B A;  2EM4 A;  2EOX A;  1TN9 A;  4F6N A;  1F2I G;  1AAY A;  2EOQ A;  2EMI A;  2ADR A;  2M9A A;  3M99 B;  2LO3 A;  1G2F C;  2EPP A;  1DGC A;  2EPZ A;  2DMI A;  2RPC A;  2WCC 3;  2EN8 A;  4R2E A;  2EN2 A;  2EMW A;  3EPL A;  1B69 A;  2EPC A;  5KL4 A;  2GHF A;  2EP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...