2JOXA

Embryonic neural inducing factor churchill is not a dna-binding zinc finger protein: solution structure reveals a solvent-exposed beta-sheet and zinc binuclear cluster
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
CGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Embryonic Neural Inducing Factor Churchill Is not a DNA-binding Zinc Finger Protein: Solution Structure Reveals a Solvent-exposed beta-Sheet and Zinc Binuclear Cluster
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Churchill protein
total genus 21
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.500 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2joxA00
2JOXA
chains in the Genus database with same CATH superfamily
3HPZA 1HR0E 3THOB 2N3GA 5ADZA 4IS1C 1UN6B 2V85A 2LMZA 2D9HA 2EOZA 5BR8E 1DQ3A 1UILA 4JI1E 2L3CA 1T4NA 4MLVA 2LTSA 3VYXA 3H09A 2EPUA 2YWQA 2H36X 4X64E 3BIDA 4LFAE 1IMUA 1I94E 2BB8A 1X6FA 2YU8A 1XMOE 2MDRA 2N3HA 2VF1A 4BHCA 4B3ME 2A25A 2EMKA 2VRDA 5A6AA 2NA2A 1F2IG 2YZTA 4NZVA 2DSYA 1WHNA 4WYQB 1IBME 3J7Yp 3J80C 4F9CB 5AC5A 4R2SA 2L92A 5A6BA 4BHBA 4I8OA 2RSIA 2EPNA 4TUIA 1O0WA 1EH6A 2EMYA 1X3CA 2KONA 2RTXA 2EOFA 2HC5A 2EOMA 1WJPA 2I13A 3QG5C 2HGHA 3IWDA 2EN2A 2UUCE 2JWOA 2V89A 2EOEA 2EPOA 4JYAE 1X49A 2YSPA 4DV1E 4JI5E 4GZNC 4X8WA 4WFTA 4R8OA 4F9AB 4F9BB 4DV2E 2EMAA 2L8TA 4DV5E 2EPMX 5AASA 5DNYA 2E5LE 2LJHA 5AE3A 1STUA 3P1XA 4R2EA 4R2QA 3ZOQB 5LMNE 2YT4A 4JI2E 2ADRA 2YTJA 1FJGE 2JVAA 5IXMB 1N32E 2CSHA 4P78A 1N3GA 2J7JA 5A6KA 4R2PA 4DV4E 3OTOE 3HPSA 1N36E 4JI8E 1X5WA 1PJQA 3THNA 2EN7A 4GKJE 2EOHA 1DGCA 2MKNA 3K6QA 3OMLA 4M9VC 1X6HA 1XNQE 4WX9A 3LLHA 4LFCE 2YTGA 2EOIA 2B3TB 2KHXA 4N4RB 2F4VE 2I9IA 3C4BA 4WSGA 5CFFE 4FK5C 2EQ0A 2YTOA 2V87A 4JI0E 2EOOA 4JI4E 1T4LB 4R2RA 1NEIA 2ENCA 2EORA 2EMZA 1BBOA 4JI7E 1N33E 1HNXE 1T39A 2DRPA 1GQEA 3JAMC 1XNRE 3ADJA 2VE7C 2VQEE 1ZBQA 1NCSA 1YYWA 4B3RE 1IBKE 1RQ0A 2EPKX 2EN4A 2B9DA 4NHRA 4LF7E 1P47A 1WRJA 2GPIA 2DLKA 1A1KA 3FIGA 1X48A 4X62E 3RMPA 2UXDE 1IQOA 1GZ6A 3ADIA 5AE2A 1RC7A 5KL7A 2E1MA 5AC4A 4MLQA 2UUAE 4R03A 4F2JC 1XMQE 4HEIA 1EH8A 5KL6A 4IJDA 2EL6A 2YSOA 4ZYEA 1A1HA 2JPAA 2EPAA 3BF2A 2EOJA 2LUQA 2EM9A 1J5EE 1N34E 4BC9A 3IWBA 1PJSA 1UHZA 2DMIA 3TQMA 1ZBTA 4B3SE 2LO3A 4OOGC 2YTQA 1HNZE 2DLQA 4AQYE 4DMIA 2EL5A 2EMFA 2R1FA 5LLQA 2MDGA 1A1LA 4KHPE 3MHSC 4R2DA 3BGHA 2K4VA 2NABA 4JI3E 2EPLX 1YPNA 2YTEA 4DUZE 2LCEA 2VQFE 2EM4A 5IT9C 4LF8E 5KL3A 2EMBA 2EQ3A 2YRMA 2M4IA 2YRHA 2FGGA 3VK6A 1QU6A 1EH7A 1G2DC 3JTZA 4GEQB 1MGTA 2WZOA 2YTPA 3IWCA 2RQLA 1YUJA 2YTDA 1JK1A 2V8QB 2DMYA 2PRTA 4DKKA 4X9JA 3ADGA 1YYOA 2LVHA 2HHHE 3VHTB 1MEYC 4LF9E 4F6NA 2JOBA 4M0VA 2CT1A 1YSAC 4GKKE 2EPPA 1BBGA 3KZZA 2UUBE 3L00A 4JI6E 1SFEA 4B3TE 4Q35B 1LLMC 3VYYA 2IHR1 2EM2A 1IQSA 4RH8A 2NUGA 1YFHA 1A1JA 4F54A 2EN8A 4DR6E 1ZAAC 1EKZA 3C6KA 2JOXA 3ADLA 2UXBE 2EMIA 1Z1BA 2EMLA 2F8BA 5KL2A 1YZ9A 2CTDA 2LE2A 2DIXA 2ZM6E 4K0KE 4HTGA 4NXNE 2EN6A 1FKAE 4DR1E 4O4KA 1B69A 3AV0A 4KWYA 1ZR9A 1JK2A 2YPNA 2EQ1A 2LV2A 2LJUA 5F3WA 4BBYA 4NXME 2RS6A 4DV0E 5A6BD 4LF4E 2WBSA 3BBGA 4ZYHA 3MHHC 4LF5E 5A69A 2EMCA 4F6MA 2YTIA 2JXPA 2RPCA 2YTFA 1QNTA 4DV6E 1TN9A 4R2CA 2BBGA 2EPZA 2FV4B 2ENAA 3EQ1A 4BS9A 4DR4E 2EZ6A 2EL4A 1SR9A 2R76A 2DGCA 2L33A 2V86A 5KL5A 2L2MA 2CPNA 4ZYGA 2EMXA 5IWAE 4DR2E 2V83A 4DR7E 2DB2A 1GTKA 1A1FA 2EPXA 4M2ZA 1WHQA 1PDAA 4OX9E 5IV8B 2LRSA 4TUGA 2V88A 3KWRA 2EMWA 2EMGA 5LMUE 1G2FC 4M30A 5FLXC 4O24A 4DR3E 4DV3E 1PKPA 2EOXA 4WPYA 2MC6A 2GHFA 3HQ1A 4WXDA 4BMJA 1RMDA 4YHHE 3EPHA 1KYQA 4RHBB 4X65E 4WXCA 2EN3A 2YTNA 2EM5A 4LTYA 1T38A 3J7AG 4DV7E 1UBDC 2NUEA 2EMHA 3HTXA 2HJJA 2UXCE 2MC5A 2N8XA 3F6GA 2B7TA 3C4TA 4LFBE 3C6MA 1J26A 2JR1A 5LL6R 2FTXB 1HNWE 4BC7A 3F6HA 4DUYE 2JP9A 5TSEA 3T1HE 4Q28A 2ODRD 1TF6A 2M7QA 1YUIA 3EPLA 1X47A 2ELYA 2EN1A 2MKDA 3ECRA 2B7VA 2EOSA 3AUZA 2EM0A 2M9AA 2RS7A 2YRKA 2EPRA 2EPCA 3LMLA 2EM3A 3EPKA 2LBSB 2K7IA 1WXRA 1A1IA 5T6JA 1A1GA 1YYKA 2ENHA 2L6MA 3KZYA 4O5GA 2EP3A 4X66E 2E72A 2EM6A 2WBTA 2YU5A 4R2AA 2L2KB 2WBUA 4BCAA 2EWLA 2L2NA 1TF3A 4O43A 2JY9A 3HXLA 4LU9A 2KOUA 4P7DA 2RSMA 2GLIA 1DI2A 1L4SA 2EE8A 2M1SA 2ODRC 2EM8A 5A2QC 4ZYDA 5A6JA 3EPJA 1BB8A 2G7HA 2EOQA 3UK3C 2UU9E 2EOYA 1KJKA 1X6EA 4L5NC 1ZU1A 2LT7A 2L3JA 2EJ4A 4L8NA 3M99B 2JYAA 2WCC3 2NUFA 1AAYA 3MSWA 1IBLE 4JV5E 2Q8UA 5KL4A 1PJTA 4KZSA 1AH5A 3JU0A 4DR5E 3T1YE 3DJWA 5AE1A 2LTRA 1T4OA 2LUPB 2EM7A 4LF6E 2ELZA 3J81C 4YY3E 4WSPA 3DF6A 4J8ZA
chains in the Genus database with same CATH topology
3HPZA 1HR0E 3C4BA 5CFFE 2N3GA 5ADZA 4LTYA 3J7AG 4DV7E 2NUEA 2V87A 4JI0E 4JI4E 4GKKE 2V85A 2LMZA 1T4LB 2UUBE 3HTXA 5BR8E 1DQ3A 4JI6E 1UILA 4JI1E 2MC5A 2UXCE 3F6GA 2L3CA 1T4NA 4B3TE 4JI7E 2LTSA 3VYXA 1N33E 3H09A 1HNXE 1GQEA 2H36X 2B7TA 3C4TA 2IHR1 3JAMC 4X64E 3VYYA 4LFAE 1XNRE 2NUGA 3ADJA 4LFBE 2VE7C 2VQEE 2JR1A 5LL6R 1I94E 1ZBQA 1J26A 2FTXB 4F54A 1YYWA 1XMOE 4BC7A 2MDRA 2N3HA 3F6HA 1HNWE 4B3RE 1XNQE 4DUYE 4DR6E 3T1HE 2VF1A 1IBKE 1EKZA 1RQ0A 2JOXA 2B9DA 4Q28A 4B3ME 4LF7E 2ODRD 3ADLA 2UXBE 2M7QA 3FIGA 1X48A 2NA2A 4X62E 3RMPA 2UXDE 2YZTA 1GZ6A 1X47A 2F8BA 3ADIA 5AE2A 2DSYA 1RC7A 1YZ9A 2LE2A 1WHNA 4WYQB 1IBME 3J7Yp 3J80C 2DIXA 2E1MA 4F9CB 2B7VA 2ZM6E 4K0KE 2UUAE 4R03A 2L92A 1XMQE 4NXNE 1FKAE 4DR1E 4I8OA 3AUZA 2RS7A 1O0WA 3AV0A 4TUIA 2KONA 2RTXA 2LUQA 1J5EE 1N34E 3LMLA 2LBSB 4BC9A 3IWBA 5F3WA 4BBYA 4NXME 1UHZA 2RS6A 3IWDA 4DV0E 2UUCE 2JWOA 1ZBTA 2V89A 4LF4E 4B3SE 1X49A 4OOGC 1HNZE 4JYAE 1WXRA 4DV1E 5T6JA 4JI5E 1YYKA 4AQYE 2L6MA 4LF5E 4DMIA 4X66E 4X8WA 4DV6E 4WFTA 4R8OA 4F9AB 4KHPE 4F9BB 4DV2E 2L8TA 4DV5E 2L2KB 4BCAA 2K4VA 2EWLA 2FV4B 2L2NA 2LJHA 5AASA 5DNYA 2E5LE 5AE3A 1STUA 2JY9A 3HXLA 4JI3E 4LU9A 3P1XA 4BS9A 2KOUA 4P7DA 4DR4E 2EZ6A 2RSMA 1SR9A 4DUZE 1DI2A 3ZOQB 5LMNE 2L33A 2V86A 2VQFE 2L2MA 2CPNA 5IT9C 4LF8E 2YT4A 5IWAE 2M1SA 2V83A 4DR2E 2ODRC 2M4IA 4JI2E 4DR7E 2DB2A 5A2QC 1FJGE 2FGGA 2JVAA 3VK6A 2G7HA 4M2ZA 1QU6A 2UU9E 3JTZA 4GEQB 1N32E 1WHQA 2WZOA 4P78A 3IWCA 4L5NC 4OX9E 2LRSA 4TUGA 2L3JA 2V88A 3KWRA 4DV4E 5LMUE 4L8NA 2V8QB 3OTOE 3HPSA 2DMYA 4M30A 5FLXC 1N36E 4DR3E 4DV3E 4JI8E 3MSWA 1IBLE 4DKKA 2NUFA 1PKPA 4GKJE 4JV5E 3ADGA 4WPYA 4KZSA 1YYOA 2MC6A 3JU0A 3K6QA 2HHHE 3OMLA 3HQ1A 4DR5E 3DJWA 3T1YE 4BMJA 3LLHA 5AE1A 2LTRA 1T4OA 4YHHE 2LUPB 4LF9E 4LFCE 4LF6E 3J81C 4X65E 2B3TB 2F4VE 2KHXA 4YY3E 4WSPA 2JOBA 4M0VA 3DF6A 4J8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOX A; 
#chains in the Genus database with same CATH topology
 3HPZ A;  1HR0 E;  3THO B;  2N3G A;  5ADZ A;  4IS1 C;  1UN6 B;  2V85 A;  2LMZ A;  2D9H A;  2EOZ A;  5BR8 E;  1DQ3 A;  1UIL A;  4JI1 E;  2L3C A;  1T4N A;  4MLV A;  2LTS A;  3VYX A;  3H09 A;  2EPU A;  2YWQ A;  2H36 X;  4X64 E;  3BID A;  4LFA E;  1IMU A;  1I94 E;  2BB8 A;  1X6F A;  2YU8 A;  1XMO E;  2MDR A;  2N3H A;  2VF1 A;  4BHC A;  4B3M E;  2A25 A;  2EMK A;  2VRD A;  5A6A A;  2NA2 A;  1F2I G;  2YZT A;  4NZV A;  2DSY A;  1WHN A;  4WYQ B;  1IBM E;  3J7Y p;  3J80 C;  4F9C B;  5AC5 A;  4R2S A;  2L92 A;  5A6B A;  4BHB A;  4I8O A;  2RSI A;  2EPN A;  4TUI A;  1O0W A;  1EH6 A;  2EMY A;  1X3C A;  2KON A;  2RTX A;  2EOF A;  2HC5 A;  2EOM A;  1WJP A;  2I13 A;  3QG5 C;  2HGH A;  3IWD A;  2EN2 A;  2UUC E;  2JWO A;  2V89 A;  2EOE A;  2EPO A;  4JYA E;  1X49 A;  2YSP A;  4DV1 E;  4JI5 E;  4GZN C;  4X8W A;  4WFT A;  4R8O A;  4F9A B;  4F9B B;  4DV2 E;  2EMA A;  2L8T A;  4DV5 E;  2EPM X;  5AAS A;  5DNY A;  2E5L E;  2LJH A;  5AE3 A;  1STU A;  3P1X A;  4R2E A;  4R2Q A;  3ZOQ B;  5LMN E;  2YT4 A;  4JI2 E;  2ADR A;  2YTJ A;  1FJG E;  2JVA A;  5IXM B;  1N32 E;  2CSH A;  4P78 A;  1N3G A;  2J7J A;  5A6K A;  4R2P A;  4DV4 E;  3OTO E;  3HPS A;  1N36 E;  4JI8 E;  1X5W A;  1PJQ A;  3THN A;  2EN7 A;  4GKJ E;  2EOH A;  1DGC A;  2MKN A;  3K6Q A;  3OML A;  4M9V C;  1X6H A;  1XNQ E;  4WX9 A;  3LLH A;  4LFC E;  2YTG A;  2EOI A;  2B3T B;  2KHX A;  4N4R B;  2F4V E;  2I9I A;  3C4B A;  4WSG A;  5CFF E;  4FK5 C;  2EQ0 A;  2YTO A;  2V87 A;  4JI0 E;  2EOO A;  4JI4 E;  1T4L B;  4R2R A;  1NEI A;  2ENC A;  2EOR A;  2EMZ A;  1BBO A;  4JI7 E;  1N33 E;  1HNX E;  1T39 A;  2DRP A;  1GQE A;  3JAM C;  1XNR E;  3ADJ A;  2VE7 C;  2VQE E;  1ZBQ A;  1NCS A;  1YYW A;  4B3R E;  1IBK E;  1RQ0 A;  2EPK X;  2EN4 A;  2B9D A;  4NHR A;  4LF7 E;  1P47 A;  1WRJ A;  2GPI A;  2DLK A;  1A1K A;  3FIG A;  1X48 A;  4X62 E;  3RMP A;  2UXD E;  1IQO A;  1GZ6 A;  3ADI A;  5AE2 A;  1RC7 A;  5KL7 A;  2E1M A;  5AC4 A;  4MLQ A;  2UUA E;  4R03 A;  4F2J C;  1XMQ E;  4HEI A;  1EH8 A;  5KL6 A;  4IJD A;  2EL6 A;  2YSO A;  4ZYE A;  1A1H A;  2JPA A;  2EPA A;  3BF2 A;  2EOJ A;  2LUQ A;  2EM9 A;  1J5E E;  1N34 E;  4BC9 A;  3IWB A;  1PJS A;  1UHZ A;  2DMI A;  3TQM A;  1ZBT A;  4B3S E;  2LO3 A;  4OOG C;  2YTQ A;  1HNZ E;  2DLQ A;  4AQY E;  4DMI A;  2EL5 A;  2EMF A;  2R1F A;  5LLQ A;  2MDG A;  1A1L A;  4KHP E;  3MHS C;  4R2D A;  3BGH A;  2K4V A;  2NAB A;  4JI3 E;  2EPL X;  1YPN A;  2YTE A;  4DUZ E;  2LCE A;  2VQF E;  2EM4 A;  5IT9 C;  4LF8 E;  5KL3 A;  2EMB A;  2EQ3 A;  2YRM A;  2M4I A;  2YRH A;  2FGG A;  3VK6 A;  1QU6 A;  1EH7 A;  1G2D C;  3JTZ A;  4GEQ B;  1MGT A;  2WZO A;  2YTP A;  3IWC A;  2RQL A;  1YUJ A;  2YTD A;  1JK1 A;  2V8Q B;  2DMY A;  2PRT A;  4DKK A;  4X9J A;  3ADG A;  1YYO A;  2LVH A;  2HHH E;  3VHT B;  1MEY C;  4LF9 E;  4F6N A;  2JOB A;  4M0V A;  2CT1 A;  1YSA C;  4GKK E;  2EPP A;  1BBG A;  3KZZ A;  2UUB E;  3L00 A;  4JI6 E;  1SFE A;  4B3T E;  4Q35 B;  1LLM C;  3VYY A;  2IHR 1;  2EM2 A;  1IQS A;  4RH8 A;  2NUG A;  1YFH A;  1A1J A;  4F54 A;  2EN8 A;  4DR6 E;  1ZAA C;  1EKZ A;  3C6K A;  2JOX A;  3ADL A;  2UXB E;  2EMI A;  1Z1B A;  2EML A;  2F8B A;  5KL2 A;  1YZ9 A;  2CTD A;  2LE2 A;  2DIX A;  2ZM6 E;  4K0K E;  4HTG A;  4NXN E;  2EN6 A;  1FKA E;  4DR1 E;  4O4K A;  1B69 A;  3AV0 A;  4KWY A;  1ZR9 A;  1JK2 A;  2YPN A;  2EQ1 A;  2LV2 A;  2LJU A;  5F3W A;  4BBY A;  4NXM E;  2RS6 A;  4DV0 E;  5A6B D;  4LF4 E;  2WBS A;  3BBG A;  4ZYH A;  3MHH C;  4LF5 E;  5A69 A;  2EMC A;  4F6M A;  2YTI A;  2JXP A;  2RPC A;  2YTF A;  1QNT A;  4DV6 E;  1TN9 A;  4R2C A;  2BBG A;  2EPZ A;  2FV4 B;  2ENA A;  3EQ1 A;  4BS9 A;  4DR4 E;  2EZ6 A;  2EL4 A;  1SR9 A;  2R76 A;  2DGC A;  2L33 A;  2V86 A;  5KL5 A;  2L2M A;  2CPN A;  4ZYG A;  2EMX A;  5IWA E;  4DR2 E;  2V83 A;  4DR7 E;  2DB2 A;  1GTK A;  1A1F A;  2EPX A;  4M2Z A;  1WHQ A;  1PDA A;  4OX9 E;  5IV8 B;  2LRS A;  4TUG A;  2V88 A;  3KWR A;  2EMW A;  2EMG A;  5LMU E;  1G2F C;  4M30 A;  5FLX C;  4O24 A;  4DR3 E;  4DV3 E;  1PKP A;  2EOX A;  4WPY A;  2MC6 A;  2GHF A;  3HQ1 A;  4WXD A;  4BMJ A;  1RMD A;  4YHH E;  3EPH A;  1KYQ A;  4RHB B;  4X65 E;  4WXC A;  2EN3 A;  2YTN A;  2EM5 A;  4LTY A;  1T38 A;  3J7A G;  4DV7 E;  1UBD C;  2NUE A;  2EMH A;  3HTX A;  2HJJ A;  2UXC E;  2MC5 A;  2N8X A;  3F6G A;  2B7T A;  3C4T A;  4LFB E;  3C6M A;  1J26 A;  2JR1 A;  5LL6 R;  2FTX B;  1HNW E;  4BC7 A;  3F6H A;  4DUY E;  2JP9 A;  5TSE A;  3T1H E;  4Q28 A;  2ODR D;  1TF6 A;  2M7Q A;  1YUI A;  3EPL A;  1X47 A;  2ELY A;  2EN1 A;  2MKD A;  3ECR A;  2B7V A;  2EOS A;  3AUZ A;  2EM0 A;  2M9A A;  2RS7 A;  2YRK A;  2EPR A;  2EPC A;  3LML A;  2EM3 A;  3EPK A;  2LBS B;  2K7I A;  1WXR A;  1A1I A;  5T6J A;  1A1G A;  1YYK A;  2ENH A;  2L6M A;  3KZY A;  4O5G A;  2EP3 A;  4X66 E;  2E72 A;  2EM6 A;  2WBT A;  2YU5 A;  4R2A A;  2L2K B;  2WBU A;  4BCA A;  2EWL A;  2L2N A;  1TF3 A;  4O43 A;  2JY9 A;  3HXL A;  4LU9 A;  2KOU A;  4P7D A;  2RSM A;  2GLI A;  1DI2 A;  1L4S A;  2EE8 A;  2M1S A;  2ODR C;  2EM8 A;  5A2Q C;  4ZYD A;  5A6J A;  3EPJ A;  1BB8 A;  2G7H A;  2EOQ A;  3UK3 C;  2UU9 E;  2EOY A;  1KJK A;  1X6E A;  4L5N C;  1ZU1 A;  2LT7 A;  2L3J A;  2EJ4 A;  4L8N A;  3M99 B;  2JYA A;  2WCC 3;  2NUF A;  1AAY A;  3MSW A;  1IBL E;  4JV5 E;  2Q8U A;  5KL4 A;  1PJT A;  4KZS A;  1AH5 A;  3JU0 A;  4DR5 E;  3T1Y E;  3DJW A;  5AE1 A;  2LTR A;  1T4O A;  2LUP B;  2EM7 A;  4LF6 E;  2ELZ A;  3J81 C;  4YY3 E;  4WSP A;  3DF6 A;  4J8Z A; 
#chains in the Genus database with same CATH homology
 3HPZ A;  1HR0 E;  3C4B A;  5CFF E;  2N3G A;  5ADZ A;  4LTY A;  3J7A G;  4DV7 E;  2NUE A;  2V87 A;  4JI0 E;  4JI4 E;  4GKK E;  2V85 A;  2LMZ A;  1T4L B;  2UUB E;  3HTX A;  5BR8 E;  1DQ3 A;  4JI6 E;  1UIL A;  4JI1 E;  2MC5 A;  2UXC E;  3F6G A;  2L3C A;  1T4N A;  4B3T E;  4JI7 E;  2LTS A;  3VYX A;  1N33 E;  3H09 A;  1HNX E;  1GQE A;  2H36 X;  2B7T A;  3C4T A;  2IHR 1;  3JAM C;  4X64 E;  3VYY A;  4LFA E;  1XNR E;  2NUG A;  3ADJ A;  4LFB E;  2VE7 C;  2VQE E;  2JR1 A;  5LL6 R;  1I94 E;  1ZBQ A;  1J26 A;  2FTX B;  4F54 A;  1YYW A;  1XMO E;  4BC7 A;  2MDR A;  2N3H A;  3F6H A;  1HNW E;  4B3R E;  1XNQ E;  4DUY E;  4DR6 E;  3T1H E;  2VF1 A;  1IBK E;  1EKZ A;  1RQ0 A;  2JOX A;  2B9D A;  4Q28 A;  4B3M E;  4LF7 E;  2ODR D;  3ADL A;  2UXB E;  2M7Q A;  3FIG A;  1X48 A;  2NA2 A;  4X62 E;  3RMP A;  2UXD E;  2YZT A;  1GZ6 A;  1X47 A;  2F8B A;  3ADI A;  5AE2 A;  2DSY A;  1RC7 A;  1YZ9 A;  2LE2 A;  1WHN A;  4WYQ B;  1IBM E;  3J7Y p;  3J80 C;  2DIX A;  2E1M A;  4F9C B;  2B7V A;  2ZM6 E;  4K0K E;  2UUA E;  4R03 A;  2L92 A;  1XMQ E;  4NXN E;  1FKA E;  4DR1 E;  4I8O A;  3AUZ A;  2RS7 A;  1O0W A;  3AV0 A;  4TUI A;  2KON A;  2RTX A;  2LUQ A;  1J5E E;  1N34 E;  3LML A;  2LBS B;  4BC9 A;  3IWB A;  5F3W A;  4BBY A;  4NXM E;  1UHZ A;  2RS6 A;  3IWD A;  4DV0 E;  2UUC E;  2JWO A;  1ZBT A;  2V89 A;  4LF4 E;  4B3S E;  1X49 A;  4OOG C;  1HNZ E;  4JYA E;  1WXR A;  4DV1 E;  5T6J A;  4JI5 E;  1YYK A;  4AQY E;  2L6M A;  4LF5 E;  4DMI A;  4X66 E;  4X8W A;  4DV6 E;  4WFT A;  4R8O A;  4F9A B;  4KHP E;  4F9B B;  4DV2 E;  2L8T A;  4DV5 E;  2L2K B;  4BCA A;  2K4V A;  2EWL A;  2FV4 B;  2L2N A;  2LJH A;  5AAS A;  5DNY A;  2E5L E;  5AE3 A;  1STU A;  2JY9 A;  3HXL A;  4JI3 E;  4LU9 A;  3P1X A;  4BS9 A;  2KOU A;  4P7D A;  4DR4 E;  2EZ6 A;  2RSM A;  1SR9 A;  4DUZ E;  1DI2 A;  3ZOQ B;  5LMN E;  2L33 A;  2V86 A;  2VQF E;  2L2M A;  2CPN A;  5IT9 C;  4LF8 E;  2YT4 A;  5IWA E;  2M1S A;  2V83 A;  4DR2 E;  2ODR C;  2M4I A;  4JI2 E;  4DR7 E;  2DB2 A;  5A2Q C;  1FJG E;  2FGG A;  2JVA A;  3VK6 A;  2G7H A;  4M2Z A;  1QU6 A;  2UU9 E;  3JTZ A;  4GEQ B;  1N32 E;  1WHQ A;  2WZO A;  4P78 A;  3IWC A;  4L5N C;  4OX9 E;  2LRS A;  4TUG A;  2L3J A;  2V88 A;  3KWR A;  4DV4 E;  5LMU E;  4L8N A;  2V8Q B;  3OTO E;  3HPS A;  2DMY A;  4M30 A;  5FLX C;  1N36 E;  4DR3 E;  4DV3 E;  4JI8 E;  3MSW A;  1IBL E;  4DKK A;  2NUF A;  1PKP A;  4GKJ E;  4JV5 E;  3ADG A;  4WPY A;  4KZS A;  1YYO A;  2MC6 A;  3JU0 A;  3K6Q A;  2HHH E;  3OML A;  3HQ1 A;  4DR5 E;  3DJW A;  3T1Y E;  4BMJ A;  3LLH A;  5AE1 A;  2LTR A;  1T4O A;  4YHH E;  2LUP B;  4LF9 E;  4LFC E;  4LF6 E;  3J81 C;  4X65 E;  2B3T B;  2F4V E;  2KHX A;  4YY3 E;  4WSP A;  2JOB A;  4M0V A;  3DF6 A;  4J8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...