2JOXA

Embryonic neural inducing factor churchill is not a dna-binding zinc finger protein: solution structure reveals a solvent-exposed beta-sheet and zinc binuclear cluster
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
CGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Churchill protein
publication title Embryonic Neural Inducing Factor Churchill Is not a DNA-binding Zinc Finger Protein: Solution Structure Reveals a Solvent-exposed beta-Sheet and Zinc Binuclear Cluster
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.500 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2joxA00
2JOXA
chains in the Genus database with same CATH superfamily
2LUPB 1RMDA 2EMGA 2EOHA 2GHFA 2UXBE 3P1XA 1FKAE 4KZSA 4LU9A 1XNQE 1X6EA 2JVAA 2EMCA 2FGGA 4R2SA 2B7VA 2EM2A 1FJGE 5T6JA 2DLKA 3T1HE 3OMLA 2CSHA 4DR1E 2EM4A 2GLIA 4DR4E 2EE8A 3T1YE 2LO3A 2VQFE 4O5GA 2UU9E 4DV6E 3IWDA 4JI0E 3LLHA 2CT1A 4P7DA 2ELYA 2YTNA 2YPNA 4BS9A 2CTDA 3DJWA 1XNRE 3BGHA 4JI6E 2YTOA 4F9CB 4WYQB 1PDAA 3ZOQB 1X3CA 2EJ4A 1N32E 1XMOE 2EPPA 3J81C 5ADZA 4R2RA 1XMQE 1HR0E 4NZVA 4DR7E 2L6MA 2M4IA 2DSYA 2LRSA 4DV1E 2EPMX 3VYYA 5A2QC 4HEIA 4LF5E 1AAYA 1IQSA 1PKPA 4WXDA 1EKZA 2UUAE 4OX9E 2YTGA 4DUZE 1EH8A 1YZ9A 4GKKE 3VK6A 2LV2A 4N4RB 2NUEA 2VE7C 2KOUA 2NA2A 2EN7A 1I94E 2EMAA 4LF8E 5LL6R 2A25A 2YTDA 4BBYA 2L3CA 2YTJA 1LLMC 2LCEA 2EPLX 2HC5A 4KWYA 4JI4E 4M30A 1N3GA 4NHRA 2YRHA 4R2PA 4NXNE 2LT7A 1UILA 4LF9E 3UK3C 1YUIA 2G7HA 3ADJA 3FIGA 3J80C 2L2NA 4F2JC 1YFHA 1X47A 2EOOA 2M1SA 4R03A 4OOGC 4DV4E 1QNTA 1A1KA 3KZZA 4JYAE 4R8OA 2JPAA 1EH7A 1STUA 4FK5C 5KL3A 4L8NA 2ODRC 5IWAE 5KL2A 2JR1A 2VRDA 2MC6A 1WHQA 2L33A 4JI2E 5CFFE 2EL4A 2MC5A 5IXMB 4DR6E 2I13A 2VQEE 2EM0A 2I9IA 2RSIA 3DF6A 1SR9A 1IBLE 2EQ0A 1HNWE 2N3HA 1MGTA 1TF6A 5KL7A 4ZYGA 2HGHA 2EZ6A 2EOSA 3KWRA 2JY9A 2EOZA 1BBOA 3EPLA 1WJPA 1UHZA 2EPKX 3IWBA 4O24A 2YTPA 2EOJA 1GQEA 1NCSA 4M2ZA 2YT4A 1ZR9A 2DGCA 2VF1A 2YSOA 4ZYDA 2JYAA 3MHHC 4BC9A 4LFCE 1YPNA 2EOEA 1ZBTA 2E5LE 1UN6B 2B9DA 1MEYC 3VYXA 5KL5A 4GZNC 1A1LA 2EL5A 1T4OA 1JK1A 1HNXE 2CPNA 4Q35B 2J7JA 1SFEA 1A1FA 4LF7E 3THOB 2ENHA 4LF6E 3H09A 1X6HA 2EOXA 2LMZA 2LBSB 2EMKA 3C6KA 2EOMA 2JP9A 2EN6A 2YTQA 2WBUA 4R2DA 3ECRA 4BHCA 2EM7A 2MKDA 4HTGA 2N8XA 1Z1BA 2YTEA 2EOFA 4F6MA 1DGCA 2FTXB 4DMIA 4X8WA 4TUIA 1ZAAC 1T39A 2V87A 4JI3E 2BBGA 4O43A 1UBDC 4AQYE 3C4TA 3JAMC 1O0WA 1GTKA 2EPXA 2EPUA 2YU5A 2LJUA 2EPRA 3L00A 2UUBE 4LF4E 2EOYA 3JTZA 2R76A 2B3TB 1TN9A 4X64E 1PJQA 4J8ZA 1X48A 5AC4A 2JOBA 1F2IG 2EMLA 4I8OA 4BCAA 2EPNA 4LFBE 1PJSA 2NUGA 4WFTA 2EPZA 2MDRA 1DQ3A 2EM8A 3EPJA 2E72A 5BR8E 2KONA 4B3TE 2YTFA 5A6BA 5F3WA 5AE2A 1WHNA 4F9AB 2UXDE 4B3ME 4MLQA 2DIXA 3AV0A 1G2FC 2EPCA 4GEQB 4WSPA 2LJHA 2EMIA 3HPZA 2EOIA 3M99B 2V83A 1T4NA 1EH6A 4R2QA 3K6QA 3MHSC 2Q8UA 2V85A 1WRJA 2PRTA 2N3GA 4IS1C 1N33E 3MSWA 2HJJA 2EM5A 3EPHA 1QU6A 2V86A 1N34E 2NUFA 1WXRA 3THNA 2EPAA 4DR2E 1X6FA 2ODRD 1AH5A 2DRPA 4LFAE 1RQ0A 1TF3A 1ZBQA 1YUJA 2MKNA 2EMBA 4WSGA 4MLVA 2JXPA 2V88A 1YYOA 3C4BA 1A1JA 3J7Yp 1KYQA 1KJKA 2B7TA 2ELZA 4WXCA 2GPIA 1IQOA 1PJTA 4DV0E 5A69A 3BF2A 1A1GA 4RH8A 2RS7A 2WBTA 4NXME 2YRMA 3KZYA 2L3JA 1IBME 4M0VA 4GKJE 2RQLA 2L8TA 4X9JA 4TUGA 4X66E 2EN2A 2EWLA 1N36E 1X49A 3HPSA 4F54A 1JK2A 5FLXC 2YRKA 4DV3E 2EQ1A 2UXCE 3EPKA 1ZU1A 4LTYA 3QG5C 5A6JA 2EMYA 4O4KA 2EMHA 1YYKA 5AASA 4DKKA 3LMLA 4DV5E 2EMWA 2JWOA 4K0KE 4L5NC 2HHHE 1NEIA 5LLQA 4IJDA 4JI1E 2EN1A 3F6HA 1T38A 4BHBA 4JI7E 5AC5A 2FV4B 5KL4A 5DNYA 2EQ3A 1A1IA 4JI5E 2LTSA 2WBSA 1BB8A 2L2KB 5TSEA 2MDGA 3BIDA 2EP3A 2ENAA 1HNZE 2L92A 2RPCA 2LUQA 2EMZA 4R2CA 2ENCA 2WZOA 5KL6A 2BB8A 4ZYHA 5IT9C 5LMNE 2RS6A 4WPYA 1IMUA 2KHXA 2R1FA 2RTXA 2YTIA 2LTRA 3IWCA 5A6KA 4WX9A 2EM3A 2M7QA 1YSAC 5IV8B 4M9VC 5A6BD 1L4SA 3RMPA 2F4VE 2YU8A 3ADGA 2LVHA 2F8BA 4DR3E 2EOQA 2V89A 5AE1A 1X5WA 2EORA 2V8QB 1BBGA 4BC7A 2LE2A 2D9HA 4KHPE 4R2EA 2YWQA 4DR5E 4JV5E 2H36X 1YYWA 4X62E 3EQ1A 4YHHE 2K4VA 2IHR1 3VHTB 4DUYE 2EPOA 1J5EE 2ADRA 2EMXA 4DV7E 4ZYEA 4BMJA 4F9BB 5AE3A 5A6AA 1J26A 4F6NA 2WCC3 2EMFA 2ZM6E 1P47A 4B3RE 2DB2A 4P78A 2NABA 2RSMA 2UUCE 4B3SE 2E1MA 2EM9A 1DI2A 3F6GA 3ADIA 2YSPA 3AUZA 1T4LB 2EN3A 3OTOE 2EN8A 4JI8E 2YZTA 2EL6A 2K7IA 2L2MA 3HXLA 3ADLA 2DLQA 2DMYA 4YY3E 3JU0A 2EN4A 3TQMA 4R2AA 4RHBB 3J7AG 2EM6A 2DMIA 3HTXA 1GZ6A 2JOXA 4Q28A 5LMUE 4DV2E 3HQ1A 1IBKE 3C6MA 1RC7A 1B69A 3BBGA 1A1HA 1G2DC 2M9AA 4X65E
chains in the Genus database with same CATH topology
2M1SA 2LUPB 4R03A 4OOGC 4J8ZA 4JI7E 4DV4E 4JYAE 1X48A 4R8OA 2UXBE 2FV4B 3P1XA 1STUA 1FKAE 2JOBA 4KZSA 5DNYA 4I8OA 4LU9A 4BCAA 4JI5E 1XNQE 4L8NA 4LFBE 2ODRC 2JVAA 2LTSA 2FGGA 5IWAE 2JR1A 2L2KB 2B7VA 1FJGE 5T6JA 2MC6A 1WHQA 2UXDE 2L33A 2NUGA 3T1HE 4WFTA 3OMLA 2MDRA 1DQ3A 4DR1E 1HNZE 4X64E 2L92A 5CFFE 4JI2E 2LUQA 2MC5A 5BR8E 2KONA 4DR6E 4B3TE 4DR4E 3T1YE 2VQEE 3DF6A 1SR9A 5F3WA 5AE2A 4X65E 2VQFE 2WZOA 1IBLE 1WHNA 4F9AB 3IWDA 4DV6E 3LLHA 2UU9E 4B3ME 4JI0E 1HNWE 2N3HA 4P7DA 2DIXA 3AV0A 4GEQB 4WSPA 2EZ6A 2LJHA 3KWRA 2JY9A 4BS9A 3HPZA 5IT9C 2V83A 5LMNE 1UHZA 1T4NA 3IWBA 2RS6A 4WPYA 2KHXA 3DJWA 2RTXA 3K6QA 1GQEA 2LTRA 3IWCA 1XNRE 4JI6E 2M7QA 2V85A 2YT4A 4F9CB 4M2ZA 2N3GA 4WYQB 1N33E 3RMPA 3ZOQB 2VF1A 3MSWA 2F4VE 3ADGA 4LFCE 4BC9A 2F8BA 4DR3E 1N32E 2V89A 5AE1A 1XMOE 1ZBTA 1QU6A 2V8QB 2V86A 3J81C 1N34E 1WXRA 2E5LE 2NUFA 2B9DA 4BC7A 2LE2A 5ADZA 1XMQE 1HR0E 4KHPE 4JV5E 4DR5E 4DR7E 2H36X 1YYWA 4X62E 3VYXA 4DR2E 2L6MA 4YHHE 2K4VA 2ODRD 4JI1E 2IHR1 2M4IA 1HNXE 1T4OA 2DSYA 2LRSA 4DUYE 4DV1E 2CPNA 1J5EE 4LFAE 3VYYA 5A2QC 4DV7E 1RQ0A 1ZBQA 4BMJA 4LF5E 4F9BB 4LF7E 1PKPA 2V88A 5AE3A 1YYOA 1EKZA 3C4BA 4LF6E 1J26A 3J7Yp 3H09A 2UUAE 2B7TA 2LMZA 4OX9E 4DUZE 2LBSB 1YZ9A 2ZM6E 4B3RE 4GKKE 3VK6A 2NUEA 2DB2A 2VE7C 4P78A 4DV0E 2RSMA 2UUCE 4B3SE 2E1MA 2KOUA 2NA2A 1DI2A 2RS7A 1I94E 4NXME 3F6GA 3ADIA 2L3JA 3AUZA 4M0VA 1IBME 1T4LB 4GKJE 3OTOE 4LF8E 2L8TA 4TUGA 5LL6R 4JI8E 4X66E 4BBYA 2YZTA 2L3CA 2EWLA 1N36E 1X49A 2L2MA 3HPSA 3HXLA 4F54A 3ADLA 5FLXC 2DMYA 4YY3E 3JU0A 2FTXB 4DMIA 4M30A 4X8WA 4DV3E 4JI4E 3J7AG 2UXCE 4TUIA 3HTXA 4LTYA 2V87A 4JI3E 4NXNE 4AQYE 1GZ6A 3C4TA 2JOXA 1UILA 4Q28A 3JAMC 5LMUE 4DV2E 4LF9E 1YYKA 5AASA 1O0WA 3HQ1A 3LMLA 4DKKA 1IBKE 2G7HA 3ADJA 3FIGA 4DV5E 3J80C 1RC7A 2UUBE 2JWOA 4LF4E 3JTZA 4L5NC 2HHHE 4K0KE 2B3TB 2L2NA 1X47A 3F6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOX A; 
#chains in the Genus database with same CATH topology
 2LUP B;  1RMD A;  2EMG A;  2EOH A;  2GHF A;  2UXB E;  3P1X A;  1FKA E;  4KZS A;  4LU9 A;  1XNQ E;  1X6E A;  2JVA A;  2EMC A;  2FGG A;  4R2S A;  2B7V A;  2EM2 A;  1FJG E;  5T6J A;  2DLK A;  3T1H E;  3OML A;  2CSH A;  4DR1 E;  2EM4 A;  2GLI A;  4DR4 E;  2EE8 A;  3T1Y E;  2LO3 A;  2VQF E;  4O5G A;  2UU9 E;  4DV6 E;  3IWD A;  4JI0 E;  3LLH A;  2CT1 A;  4P7D A;  2ELY A;  2YTN A;  2YPN A;  4BS9 A;  2CTD A;  3DJW A;  1XNR E;  3BGH A;  4JI6 E;  2YTO A;  4F9C B;  4WYQ B;  1PDA A;  3ZOQ B;  1X3C A;  2EJ4 A;  1N32 E;  1XMO E;  2EPP A;  3J81 C;  5ADZ A;  4R2R A;  1XMQ E;  1HR0 E;  4NZV A;  4DR7 E;  2L6M A;  2M4I A;  2DSY A;  2LRS A;  4DV1 E;  2EPM X;  3VYY A;  5A2Q C;  4HEI A;  4LF5 E;  1AAY A;  1IQS A;  1PKP A;  4WXD A;  1EKZ A;  2UUA E;  4OX9 E;  2YTG A;  4DUZ E;  1EH8 A;  1YZ9 A;  4GKK E;  3VK6 A;  2LV2 A;  4N4R B;  2NUE A;  2VE7 C;  2KOU A;  2NA2 A;  2EN7 A;  1I94 E;  2EMA A;  4LF8 E;  5LL6 R;  2A25 A;  2YTD A;  4BBY A;  2L3C A;  2YTJ A;  1LLM C;  2LCE A;  2EPL X;  2HC5 A;  4KWY A;  4JI4 E;  4M30 A;  1N3G A;  4NHR A;  2YRH A;  4R2P A;  4NXN E;  2LT7 A;  1UIL A;  4LF9 E;  3UK3 C;  1YUI A;  2G7H A;  3ADJ A;  3FIG A;  3J80 C;  2L2N A;  4F2J C;  1YFH A;  1X47 A;  2EOO A;  2M1S A;  4R03 A;  4OOG C;  4DV4 E;  1QNT A;  1A1K A;  3KZZ A;  4JYA E;  4R8O A;  2JPA A;  1EH7 A;  1STU A;  4FK5 C;  5KL3 A;  4L8N A;  2ODR C;  5IWA E;  5KL2 A;  2JR1 A;  2VRD A;  2MC6 A;  1WHQ A;  2L33 A;  4JI2 E;  5CFF E;  2EL4 A;  2MC5 A;  5IXM B;  4DR6 E;  2I13 A;  2VQE E;  2EM0 A;  2I9I A;  2RSI A;  3DF6 A;  1SR9 A;  1IBL E;  2EQ0 A;  1HNW E;  2N3H A;  1MGT A;  1TF6 A;  5KL7 A;  4ZYG A;  2HGH A;  2EZ6 A;  2EOS A;  3KWR A;  2JY9 A;  2EOZ A;  1BBO A;  3EPL A;  1WJP A;  1UHZ A;  2EPK X;  3IWB A;  4O24 A;  2YTP A;  2EOJ A;  1GQE A;  1NCS A;  4M2Z A;  2YT4 A;  1ZR9 A;  2DGC A;  2VF1 A;  2YSO A;  4ZYD A;  2JYA A;  3MHH C;  4BC9 A;  4LFC E;  1YPN A;  2EOE A;  1ZBT A;  2E5L E;  1UN6 B;  2B9D A;  1MEY C;  3VYX A;  5KL5 A;  4GZN C;  1A1L A;  2EL5 A;  1T4O A;  1JK1 A;  1HNX E;  2CPN A;  4Q35 B;  2J7J A;  1SFE A;  1A1F A;  4LF7 E;  3THO B;  2ENH A;  4LF6 E;  3H09 A;  1X6H A;  2EOX A;  2LMZ A;  2LBS B;  2EMK A;  3C6K A;  2EOM A;  2JP9 A;  2EN6 A;  2YTQ A;  2WBU A;  4R2D A;  3ECR A;  4BHC A;  2EM7 A;  2MKD A;  4HTG A;  2N8X A;  1Z1B A;  2YTE A;  2EOF A;  4F6M A;  1DGC A;  2FTX B;  4DMI A;  4X8W A;  4TUI A;  1ZAA C;  1T39 A;  2V87 A;  4JI3 E;  2BBG A;  4O43 A;  1UBD C;  4AQY E;  3C4T A;  3JAM C;  1O0W A;  1GTK A;  2EPX A;  2EPU A;  2YU5 A;  2LJU A;  2EPR A;  3L00 A;  2UUB E;  4LF4 E;  2EOY A;  3JTZ A;  2R76 A;  2B3T B;  1TN9 A;  4X64 E;  1PJQ A;  4J8Z A;  1X48 A;  5AC4 A;  2JOB A;  1F2I G;  2EML A;  4I8O A;  4BCA A;  2EPN A;  4LFB E;  1PJS A;  2NUG A;  4WFT A;  2EPZ A;  2MDR A;  1DQ3 A;  2EM8 A;  3EPJ A;  2E72 A;  5BR8 E;  2KON A;  4B3T E;  2YTF A;  5A6B A;  5F3W A;  5AE2 A;  1WHN A;  4F9A B;  2UXD E;  4B3M E;  4MLQ A;  2DIX A;  3AV0 A;  1G2F C;  2EPC A;  4GEQ B;  4WSP A;  2LJH A;  2EMI A;  3HPZ A;  2EOI A;  3M99 B;  2V83 A;  1T4N A;  1EH6 A;  4R2Q A;  3K6Q A;  3MHS C;  2Q8U A;  2V85 A;  1WRJ A;  2PRT A;  2N3G A;  4IS1 C;  1N33 E;  3MSW A;  2HJJ A;  2EM5 A;  3EPH A;  1QU6 A;  2V86 A;  1N34 E;  2NUF A;  1WXR A;  3THN A;  2EPA A;  4DR2 E;  1X6F A;  2ODR D;  1AH5 A;  2DRP A;  4LFA E;  1RQ0 A;  1TF3 A;  1ZBQ A;  1YUJ A;  2MKN A;  2EMB A;  4WSG A;  4MLV A;  2JXP A;  2V88 A;  1YYO A;  3C4B A;  1A1J A;  3J7Y p;  1KYQ A;  1KJK A;  2B7T A;  2ELZ A;  4WXC A;  2GPI A;  1IQO A;  1PJT A;  4DV0 E;  5A69 A;  3BF2 A;  1A1G A;  4RH8 A;  2RS7 A;  2WBT A;  4NXM E;  2YRM A;  3KZY A;  2L3J A;  1IBM E;  4M0V A;  4GKJ E;  2RQL A;  2L8T A;  4X9J A;  4TUG A;  4X66 E;  2EN2 A;  2EWL A;  1N36 E;  1X49 A;  3HPS A;  4F54 A;  1JK2 A;  5FLX C;  2YRK A;  4DV3 E;  2EQ1 A;  2UXC E;  3EPK A;  1ZU1 A;  4LTY A;  3QG5 C;  5A6J A;  2EMY A;  4O4K A;  2EMH A;  1YYK A;  5AAS A;  4DKK A;  3LML A;  4DV5 E;  2EMW A;  2JWO A;  4K0K E;  4L5N C;  2HHH E;  1NEI A;  5LLQ A;  4IJD A;  4JI1 E;  2EN1 A;  3F6H A;  1T38 A;  4BHB A;  4JI7 E;  5AC5 A;  2FV4 B;  5KL4 A;  5DNY A;  2EQ3 A;  1A1I A;  4JI5 E;  2LTS A;  2WBS A;  1BB8 A;  2L2K B;  5TSE A;  2MDG A;  3BID A;  2EP3 A;  2ENA A;  1HNZ E;  2L92 A;  2RPC A;  2LUQ A;  2EMZ A;  4R2C A;  2ENC A;  2WZO A;  5KL6 A;  2BB8 A;  4ZYH A;  5IT9 C;  5LMN E;  2RS6 A;  4WPY A;  1IMU A;  2KHX A;  2R1F A;  2RTX A;  2YTI A;  2LTR A;  3IWC A;  5A6K A;  4WX9 A;  2EM3 A;  2M7Q A;  1YSA C;  5IV8 B;  4M9V C;  5A6B D;  1L4S A;  3RMP A;  2F4V E;  2YU8 A;  3ADG A;  2LVH A;  2F8B A;  4DR3 E;  2EOQ A;  2V89 A;  5AE1 A;  1X5W A;  2EOR A;  2V8Q B;  1BBG A;  4BC7 A;  2LE2 A;  2D9H A;  4KHP E;  4R2E A;  2YWQ A;  4DR5 E;  4JV5 E;  2H36 X;  1YYW A;  4X62 E;  3EQ1 A;  4YHH E;  2K4V A;  2IHR 1;  3VHT B;  4DUY E;  2EPO A;  1J5E E;  2ADR A;  2EMX A;  4DV7 E;  4ZYE A;  4BMJ A;  4F9B B;  5AE3 A;  5A6A A;  1J26 A;  4F6N A;  2WCC 3;  2EMF A;  2ZM6 E;  1P47 A;  4B3R E;  2DB2 A;  4P78 A;  2NAB A;  2RSM A;  2UUC E;  4B3S E;  2E1M A;  2EM9 A;  1DI2 A;  3F6G A;  3ADI A;  2YSP A;  3AUZ A;  1T4L B;  2EN3 A;  3OTO E;  2EN8 A;  4JI8 E;  2YZT A;  2EL6 A;  2K7I A;  2L2M A;  3HXL A;  3ADL A;  2DLQ A;  2DMY A;  4YY3 E;  3JU0 A;  2EN4 A;  3TQM A;  4R2A A;  4RHB B;  3J7A G;  2EM6 A;  2DMI A;  3HTX A;  1GZ6 A;  2JOX A;  4Q28 A;  5LMU E;  4DV2 E;  3HQ1 A;  1IBK E;  3C6M A;  1RC7 A;  1B69 A;  3BBG A;  1A1H A;  1G2D C;  2M9A A;  4X65 E; 
#chains in the Genus database with same CATH homology
 2M1S A;  2LUP B;  4R03 A;  4OOG C;  4J8Z A;  4JI7 E;  4DV4 E;  4JYA E;  1X48 A;  4R8O A;  2UXB E;  2FV4 B;  3P1X A;  1STU A;  1FKA E;  2JOB A;  4KZS A;  5DNY A;  4I8O A;  4LU9 A;  4BCA A;  4JI5 E;  1XNQ E;  4L8N A;  4LFB E;  2ODR C;  2JVA A;  2LTS A;  2FGG A;  5IWA E;  2JR1 A;  2L2K B;  2B7V A;  1FJG E;  5T6J A;  2MC6 A;  1WHQ A;  2UXD E;  2L33 A;  2NUG A;  3T1H E;  4WFT A;  3OML A;  2MDR A;  1DQ3 A;  4DR1 E;  1HNZ E;  4X64 E;  2L92 A;  5CFF E;  4JI2 E;  2LUQ A;  2MC5 A;  5BR8 E;  2KON A;  4DR6 E;  4B3T E;  4DR4 E;  3T1Y E;  2VQE E;  3DF6 A;  1SR9 A;  5F3W A;  5AE2 A;  4X65 E;  2VQF E;  2WZO A;  1IBL E;  1WHN A;  4F9A B;  3IWD A;  4DV6 E;  3LLH A;  2UU9 E;  4B3M E;  4JI0 E;  1HNW E;  2N3H A;  4P7D A;  2DIX A;  3AV0 A;  4GEQ B;  4WSP A;  2EZ6 A;  2LJH A;  3KWR A;  2JY9 A;  4BS9 A;  3HPZ A;  5IT9 C;  2V83 A;  5LMN E;  1UHZ A;  1T4N A;  3IWB A;  2RS6 A;  4WPY A;  2KHX A;  3DJW A;  2RTX A;  3K6Q A;  1GQE A;  2LTR A;  3IWC A;  1XNR E;  4JI6 E;  2M7Q A;  2V85 A;  2YT4 A;  4F9C B;  4M2Z A;  2N3G A;  4WYQ B;  1N33 E;  3RMP A;  3ZOQ B;  2VF1 A;  3MSW A;  2F4V E;  3ADG A;  4LFC E;  4BC9 A;  2F8B A;  4DR3 E;  1N32 E;  2V89 A;  5AE1 A;  1XMO E;  1ZBT A;  1QU6 A;  2V8Q B;  2V86 A;  3J81 C;  1N34 E;  1WXR A;  2E5L E;  2NUF A;  2B9D A;  4BC7 A;  2LE2 A;  5ADZ A;  1XMQ E;  1HR0 E;  4KHP E;  4JV5 E;  4DR5 E;  4DR7 E;  2H36 X;  1YYW A;  4X62 E;  3VYX A;  4DR2 E;  2L6M A;  4YHH E;  2K4V A;  2ODR D;  4JI1 E;  2IHR 1;  2M4I A;  1HNX E;  1T4O A;  2DSY A;  2LRS A;  4DUY E;  4DV1 E;  2CPN A;  1J5E E;  4LFA E;  3VYY A;  5A2Q C;  4DV7 E;  1RQ0 A;  1ZBQ A;  4BMJ A;  4LF5 E;  4F9B B;  4LF7 E;  1PKP A;  2V88 A;  5AE3 A;  1YYO A;  1EKZ A;  3C4B A;  4LF6 E;  1J26 A;  3J7Y p;  3H09 A;  2UUA E;  2B7T A;  2LMZ A;  4OX9 E;  4DUZ E;  2LBS B;  1YZ9 A;  2ZM6 E;  4B3R E;  4GKK E;  3VK6 A;  2NUE A;  2DB2 A;  2VE7 C;  4P78 A;  4DV0 E;  2RSM A;  2UUC E;  4B3S E;  2E1M A;  2KOU A;  2NA2 A;  1DI2 A;  2RS7 A;  1I94 E;  4NXM E;  3F6G A;  3ADI A;  2L3J A;  3AUZ A;  4M0V A;  1IBM E;  1T4L B;  4GKJ E;  3OTO E;  4LF8 E;  2L8T A;  4TUG A;  5LL6 R;  4JI8 E;  4X66 E;  4BBY A;  2YZT A;  2L3C A;  2EWL A;  1N36 E;  1X49 A;  2L2M A;  3HPS A;  3HXL A;  4F54 A;  3ADL A;  5FLX C;  2DMY A;  4YY3 E;  3JU0 A;  2FTX B;  4DMI A;  4M30 A;  4X8W A;  4DV3 E;  4JI4 E;  3J7A G;  2UXC E;  4TUI A;  3HTX A;  4LTY A;  2V87 A;  4JI3 E;  4NXN E;  4AQY E;  1GZ6 A;  3C4T A;  2JOX A;  1UIL A;  4Q28 A;  3JAM C;  5LMU E;  4DV2 E;  4LF9 E;  1YYK A;  5AAS A;  1O0W A;  3HQ1 A;  3LML A;  4DKK A;  1IBK E;  2G7H A;  3ADJ A;  3FIG A;  4DV5 E;  3J80 C;  1RC7 A;  2UUB E;  2JWO A;  4LF4 E;  3JTZ A;  4L5N C;  2HHH E;  4K0K E;  2B3T B;  2L2N A;  1X47 A;  3F6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...