2JOXA

Embryonic neural inducing factor churchill is not a dna-binding zinc finger protein: solution structure reveals a solvent-exposed beta-sheet and zinc binuclear cluster
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
CGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Churchill protein
publication title Embryonic Neural Inducing Factor Churchill Is not a DNA-binding Zinc Finger Protein: Solution Structure Reveals a Solvent-exposed beta-Sheet and Zinc Binuclear Cluster
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.500 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2joxA00
2JOXA
chains in the Genus database with same CATH superfamily
3THOB 2HGHA 4LF8E 1Z1BA 2L2MA 2HJJA 1RMDA 2VE7C 1N3GA 2EOEA 3MHSC 4R2QA 4JI1E 4LF6E 4LF7E 4NXME 3EPHA 4Q28A 2EMHA 3K6QA 2EOJA 2V83A 5TSEA 1DI2A 2EP3A 4BS9A 3ADLA 4X65E 2LRSA 4FK5C 4DV5E 3T1YE 2UXBE 2DRPA 2HHHE 1AH5A 2DSYA 2JOXA 2EN2A 4RHBB 2V88A 4WXDA 5AASA 1PKPA 2E1MA 2EM3A 2EORA 4LF5E 2V85A 2V8QB 4YY3E 2F4VE 2EOYA 3IWCA 4L8NA 5IT9C 2WBTA 2EM6A 2ENAA 5AE1A 2EL4A 3JTZA 2VRDA 2EPZA 3DF6A 2K7IA 2EM8A 5KL4A 3J7AG 3BBGA 3T1HE 2YU8A 4BMJA 2I13A 4R2SA 1JK1A 1GQEA 2YWQA 4WSGA 2WCC3 4MLVA 5A2QC 4IS1C 5DNYA 3FIGA 2VQEE 1N33E 2L2KB 1J5EE 4GZNC 2YTJA 2EZ6A 2ENCA 1A1JA 5IV8B 2M9AA 4ZYHA 4LFCE 2E5LE 2D9HA 1YYKA 1NCSA 2KONA 2EMLA 3HXLA 2JPAA 2YZTA 1I94E 3ADIA 2RTXA 1PJTA 3KZZA 4M9VC 5LL6R 2L92A 5IXMB 2EN4A 4LF4E 1YUJA 4JI7E 1EH7A 2GHFA 2L33A 2VF1A 2UUBE 2EM0A 5BR8E 3C6MA 4B3ME 2N3HA 2EE8A 5KL5A 4P78A 5A6JA 2UXCE 1T39A 4F54A 4LU9A 2JR1A 4X64E 1A1LA 2KOUA 2YRMA 2VQFE 2YTQA 3ECRA 4DKKA 4P7DA 1NEIA 2JOBA 5ADZA 2EPRA 4R2DA 1X3CA 2EMIA 3VHTB 4MLQA 2EMBA 2L6MA 2L3CA 1G2DC 2LTSA 2EN1A 2EPCA 1TN9A 2FGGA 3HQ1A 1UN6B 4BBYA 4AQYE 2B7VA 4LF9E 1XNRE 4WXCA 4IJDA 3EQ1A 2RSMA 2JY9A 5AC5A 3THNA 1YSAC 1WJPA 2KHXA 1GTKA 1IBKE 2B9DA 1A1GA 2LE2A 1ZAAC 1T4LB 5IWAE 4JI6E 2UUAE 2YRHA 4M30A 3J7Yp 1A1HA 3JAMC 4F6MA 4F2JC 2EOHA 2YSOA 2EOFA 4RH8A 3HPSA 4BHCA 2WZOA 3TQMA 4F9AB 2EOXA 2M1SA 4X66E 2CT1A 2LTRA 4LFAE 2EPNA 1IQOA 1SR9A 2E72A 2M7QA 2LJHA 2I9IA 2V87A 2EM7A 1O0WA 3H09A 2H36X 2LT7A 3OTOE 4DUZE 4M0VA 2LBSB 4GKJE 4HTGA 3J80C 1MEYC 3EPJA 5KL6A 1RQ0A 2LCEA 2HC5A 1IQSA 3AV0A 1XNQE 2EOZA 4JI8E 2F8BA 1HNZE 2LVHA 1T4NA 1N36E 1IBME 4JI0E 1WXRA 2EM5A 5AE3A 3KZYA 3M99B 2UXDE 4DR6E 3MSWA 2WBUA 2EMAA 2R76A 4J8ZA 3BF2A 2UUCE 2JYAA 2V89A 2LV2A 2JXPA 2MKNA 1A1FA 4R2EA 1X48A 2DMYA 4B3TE 1YPNA 1ZBTA 1ZBQA 1BBOA 1WHNA 5A6BA 1TF3A 4KHPE 2EMXA 2YPNA 4DR7E 5A6BD 5A69A 5LMUE 2NUFA 4ZYGA 2LUQA 1UILA 1J26A 1YYOA 5KL3A 1KJKA 1JK2A 1DQ3A 2EMFA 4JI3E 2EQ3A 4WX9A 2JVAA 1PJQA 2EM9A 2MKDA 4BHBA 1HR0E 1EKZA 2CTDA 4GKKE 2B7TA 2EQ1A 1X5WA 2FTXB 3IWBA 3VK6A 2YTIA 2EN8A 3OMLA 1ZR9A 1IBLE 1N32E 1HNWE 4I8OA 2GPIA 2EL6A 2EN3A 4WFTA 4DR4E 3F6GA 2EMCA 2NABA 2CPNA 4K0KE 1MGTA 2MC5A 3LLHA 1TF6A 3F6HA 3AUZA 4O4KA 5LLQA 2M4IA 2ADRA 5A6AA 1A1KA 1WRJA 1YYWA 4OX9E 3BGHA 2YTGA 5KL2A 2EPMX 2EPXA 4B3SE 1P47A 1YZ9A 1XMOE 4DV7E 2GLIA 2YTNA 4L5NC 2L8TA 4X9JA 1PDAA 2EMWA 2MDGA 4NZVA 4GEQB 3ADJA 2EPUA 5A6KA 4DR3E 2Q8UA 2NUEA 3EPKA 2J7JA 1AAYA 2EM4A 2RSIA 1FJGE 2RPCA 5CFFE 2N3GA 4JYAE 4ZYEA 1X6FA 4JI2E 1X49A 4WPYA 2V86A 2EOIA 2JP9A 2BB8A 2DMIA 4R2CA 3C6KA 4X8WA 2YTEA 3J81C 2UU9E 1SFEA 4DV4E 1IMUA 2ZM6E 3MHHC 4F9CB 4JI4E 2WBSA 4F6NA 2YU5A 2LUPB 2LJUA 2EL5A 2EQ0A 2DIXA 2R1FA 3VYYA 2EOMA 1X47A 1X6EA 2DLQA 3QG5C 4DMIA 4R2AA 2IHR1 1BBGA 3ZOQB 2DB2A 2PRTA 2YTOA 3C4BA 4HEIA 5T6JA 4LTYA 4BC9A 4O43A 1EH6A 1N34E 4R03A 2EPOA 4OOGC 2NUGA 4ZYDA 4WYQB 1F2IG 2EN6A 4TUGA 3C4TA 1UBDC 3LMLA 4R8OA 5KL7A 1A1IA 2ELYA 5AE2A 2EMZA 4WSPA 1QU6A 2MC6A 1RC7A 2EOOA 2YT4A 1DGCA 2N8XA 2L2NA 2EJ4A 3JU0A 4X62E 1B69A 1HNXE 5F3WA 4LFBE 2LMZA 2DGCA 1GZ6A 2ODRC 4R2PA 2ODRD 1KYQA 1YUIA 2ELZA 3KWRA 1ZU1A 4DV1E 2FV4B 2EMKA 2YTPA 2EOQA 2B3TB 3UK3C 3EPLA 2EN7A 4NXNE 1L4SA 4TUIA 4DV0E 3HTXA 4N4RB 2YTDA 2EMGA 2ENHA 4O24A 1FKAE 3ADGA 3BIDA 1YFHA 1T38A 2YSPA 1WHQA 1LLMC 1QNTA 4M2ZA 2MDRA 4DV2E 4JV5E 4DV6E 1EH8A 2EPPA 4F9BB 2CSHA 3RMPA 1T4OA 3IWDA 1X6HA 2RS7A 2EM2A 4BCAA 2NA2A 5AC4A 3DJWA 4B3RE 2L3JA 2YRKA 3HPZA 2G7HA 2RQLA 2LO3A 4DUYE 4BC7A 2EPAA 4DV3E 1G2FC 5FLXC 4JI5E 2EPKX 1BB8A 4DR1E 3L00A 1PJSA 2YTFA 3P1XA 3VYXA 1XMQE 2BBGA 4NHRA 4Q35B 5LMNE 2EOSA 2RS6A 4DR5E 2EWLA 2EMYA 2K4VA 2DLKA 1UHZA 2JWOA 4YHHE 4DR2E 2A25A 4R2RA 1STUA 4O5GA 4KWYA 4KZSA 2EPLX
chains in the Genus database with same CATH topology
4DKKA 3C4BA 4P7DA 5LMUE 2JOBA 2NUFA 4LF8E 5T6JA 4LTYA 4BC9A 2L2MA 1N34E 5ADZA 2LUQA 1UILA 4R03A 1J26A 4OOGC 1YYOA 2VE7C 2NUGA 4WYQB 2L6MA 2L3CA 1DQ3A 2LTSA 4LF6E 4LF7E 4NXME 4JI1E 4JI3E 4TUGA 4Q28A 3C4TA 2JVAA 2FGGA 3HQ1A 2V83A 3K6QA 4BBYA 3LMLA 1DI2A 4AQYE 2B7VA 4R8OA 1EKZA 1HR0E 4LF9E 1XNRE 4KZSA 4GKKE 2B7TA 4BS9A 3ADLA 4X65E 2FTXB 3IWBA 2LRSA 5AE2A 3VK6A 2RSMA 2JY9A 4DV5E 3T1YE 3OMLA 2UXBE 2HHHE 1IBLE 2DSYA 4WSPA 2JOXA 1N32E 2KHXA 2V88A 1HNWE 5AASA 1PKPA 1QU6A 2MC6A 2B9DA 1RC7A 1IBKE 2E1MA 2YT4A 4I8OA 2LE2A 4LF5E 2V85A 2L2NA 3JU0A 4X62E 1HNXE 2V8QB 1T4LB 4YY3E 5IWAE 5F3WA 4WFTA 2F4VE 4JI6E 4DR4E 4LFBE 2LMZA 2UUAE 3F6GA 4M30A 3J7Yp 4L8NA 3IWCA 5IT9C 3JAMC 2CPNA 4K0KE 1GZ6A 2MC5A 3LLHA 2ODRC 2ODRD 5AE1A 3HPSA 2WZOA 3F6HA 3AUZA 3JTZA 3KWRA 4F9AB 4DV1E 2FV4B 2M1SA 4X66E 3DF6A 2LTRA 3J7AG 2M4IA 2B3TB 3T1HE 4LFAE 4BMJA 4NXNE 4TUIA 1YYWA 1SR9A 4OX9E 1GQEA 2M7QA 2LJHA 2V87A 4DV0E 3HTXA 1O0WA 3H09A 2H36X 5A2QC 4B3SE 1YZ9A 5DNYA 4DV7E 1XMOE 3OTOE 4DUZE 4L5NC 3FIGA 2L8TA 4M0VA 2VQEE 2LBSB 3J80C 4GKJE 2L2KB 1J5EE 1FKAE 3ADGA 4GEQB 1N33E 1RQ0A 1WHQA 3ADJA 2EZ6A 3AV0A 4M2ZA 2MDRA 1XNQE 3ZOQB 4DV2E 4JV5E 4DV6E 4DR3E 4F9BB 2NUEA 4JI8E 3RMPA 1T4OA 3IWDA 2F8BA 1HNZE 4LFCE 2RS7A 1T4NA 2E5LE 1N36E 1IBME 1FJGE 4BCAA 2NA2A 4JI0E 5CFFE 2N3GA 1WXRA 1YYKA 3DJWA 4JYAE 2KONA 5AE3A 4JI2E 1X49A 4WPYA 4B3RE 2V86A 3HXLA 2L3JA 2YZTA 1I94E 3ADIA 2UXDE 2RTXA 3HPZA 2G7HA 4X8WA 5LL6R 2L92A 4DR6E 4DUYE 4BC7A 3MSWA 4DV3E 5FLXC 4LF4E 4JI5E 3J81C 2UU9E 4J8ZA 4DR1E 2UUCE 4DV4E 3P1XA 4JI7E 2ZM6E 3VYXA 1XMQE 2L33A 2V89A 2VF1A 2UUBE 5LMNE 4F9CB 4JI4E 5BR8E 2RS6A 2LUPB 4B3ME 4DR5E 2N3HA 2EWLA 4P78A 2DIXA 1X48A 2DMYA 2K4VA 3VYYA 1X47A 4DR2E 1UHZA 1ZBTA 2JWOA 4YHHE 4B3TE 2UXCE 1ZBQA 1STUA 4F54A 4LU9A 2JR1A 1WHNA 4DMIA 2KOUA 4X64E 4KHPE 2VQFE 4DR7E 2IHR1 2DB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOX A; 
#chains in the Genus database with same CATH topology
 3THO B;  2HGH A;  4LF8 E;  1Z1B A;  2L2M A;  2HJJ A;  1RMD A;  2VE7 C;  1N3G A;  2EOE A;  3MHS C;  4R2Q A;  4JI1 E;  4LF6 E;  4LF7 E;  4NXM E;  3EPH A;  4Q28 A;  2EMH A;  3K6Q A;  2EOJ A;  2V83 A;  5TSE A;  1DI2 A;  2EP3 A;  4BS9 A;  3ADL A;  4X65 E;  2LRS A;  4FK5 C;  4DV5 E;  3T1Y E;  2UXB E;  2DRP A;  2HHH E;  1AH5 A;  2DSY A;  2JOX A;  2EN2 A;  4RHB B;  2V88 A;  4WXD A;  5AAS A;  1PKP A;  2E1M A;  2EM3 A;  2EOR A;  4LF5 E;  2V85 A;  2V8Q B;  4YY3 E;  2F4V E;  2EOY A;  3IWC A;  4L8N A;  5IT9 C;  2WBT A;  2EM6 A;  2ENA A;  5AE1 A;  2EL4 A;  3JTZ A;  2VRD A;  2EPZ A;  3DF6 A;  2K7I A;  2EM8 A;  5KL4 A;  3J7A G;  3BBG A;  3T1H E;  2YU8 A;  4BMJ A;  2I13 A;  4R2S A;  1JK1 A;  1GQE A;  2YWQ A;  4WSG A;  2WCC 3;  4MLV A;  5A2Q C;  4IS1 C;  5DNY A;  3FIG A;  2VQE E;  1N33 E;  2L2K B;  1J5E E;  4GZN C;  2YTJ A;  2EZ6 A;  2ENC A;  1A1J A;  5IV8 B;  2M9A A;  4ZYH A;  4LFC E;  2E5L E;  2D9H A;  1YYK A;  1NCS A;  2KON A;  2EML A;  3HXL A;  2JPA A;  2YZT A;  1I94 E;  3ADI A;  2RTX A;  1PJT A;  3KZZ A;  4M9V C;  5LL6 R;  2L92 A;  5IXM B;  2EN4 A;  4LF4 E;  1YUJ A;  4JI7 E;  1EH7 A;  2GHF A;  2L33 A;  2VF1 A;  2UUB E;  2EM0 A;  5BR8 E;  3C6M A;  4B3M E;  2N3H A;  2EE8 A;  5KL5 A;  4P78 A;  5A6J A;  2UXC E;  1T39 A;  4F54 A;  4LU9 A;  2JR1 A;  4X64 E;  1A1L A;  2KOU A;  2YRM A;  2VQF E;  2YTQ A;  3ECR A;  4DKK A;  4P7D A;  1NEI A;  2JOB A;  5ADZ A;  2EPR A;  4R2D A;  1X3C A;  2EMI A;  3VHT B;  4MLQ A;  2EMB A;  2L6M A;  2L3C A;  1G2D C;  2LTS A;  2EN1 A;  2EPC A;  1TN9 A;  2FGG A;  3HQ1 A;  1UN6 B;  4BBY A;  4AQY E;  2B7V A;  4LF9 E;  1XNR E;  4WXC A;  4IJD A;  3EQ1 A;  2RSM A;  2JY9 A;  5AC5 A;  3THN A;  1YSA C;  1WJP A;  2KHX A;  1GTK A;  1IBK E;  2B9D A;  1A1G A;  2LE2 A;  1ZAA C;  1T4L B;  5IWA E;  4JI6 E;  2UUA E;  2YRH A;  4M30 A;  3J7Y p;  1A1H A;  3JAM C;  4F6M A;  4F2J C;  2EOH A;  2YSO A;  2EOF A;  4RH8 A;  3HPS A;  4BHC A;  2WZO A;  3TQM A;  4F9A B;  2EOX A;  2M1S A;  4X66 E;  2CT1 A;  2LTR A;  4LFA E;  2EPN A;  1IQO A;  1SR9 A;  2E72 A;  2M7Q A;  2LJH A;  2I9I A;  2V87 A;  2EM7 A;  1O0W A;  3H09 A;  2H36 X;  2LT7 A;  3OTO E;  4DUZ E;  4M0V A;  2LBS B;  4GKJ E;  4HTG A;  3J80 C;  1MEY C;  3EPJ A;  5KL6 A;  1RQ0 A;  2LCE A;  2HC5 A;  1IQS A;  3AV0 A;  1XNQ E;  2EOZ A;  4JI8 E;  2F8B A;  1HNZ E;  2LVH A;  1T4N A;  1N36 E;  1IBM E;  4JI0 E;  1WXR A;  2EM5 A;  5AE3 A;  3KZY A;  3M99 B;  2UXD E;  4DR6 E;  3MSW A;  2WBU A;  2EMA A;  2R76 A;  4J8Z A;  3BF2 A;  2UUC E;  2JYA A;  2V89 A;  2LV2 A;  2JXP A;  2MKN A;  1A1F A;  4R2E A;  1X48 A;  2DMY A;  4B3T E;  1YPN A;  1ZBT A;  1ZBQ A;  1BBO A;  1WHN A;  5A6B A;  1TF3 A;  4KHP E;  2EMX A;  2YPN A;  4DR7 E;  5A6B D;  5A69 A;  5LMU E;  2NUF A;  4ZYG A;  2LUQ A;  1UIL A;  1J26 A;  1YYO A;  5KL3 A;  1KJK A;  1JK2 A;  1DQ3 A;  2EMF A;  4JI3 E;  2EQ3 A;  4WX9 A;  2JVA A;  1PJQ A;  2EM9 A;  2MKD A;  4BHB A;  1HR0 E;  1EKZ A;  2CTD A;  4GKK E;  2B7T A;  2EQ1 A;  1X5W A;  2FTX B;  3IWB A;  3VK6 A;  2YTI A;  2EN8 A;  3OML A;  1ZR9 A;  1IBL E;  1N32 E;  1HNW E;  4I8O A;  2GPI A;  2EL6 A;  2EN3 A;  4WFT A;  4DR4 E;  3F6G A;  2EMC A;  2NAB A;  2CPN A;  4K0K E;  1MGT A;  2MC5 A;  3LLH A;  1TF6 A;  3F6H A;  3AUZ A;  4O4K A;  5LLQ A;  2M4I A;  2ADR A;  5A6A A;  1A1K A;  1WRJ A;  1YYW A;  4OX9 E;  3BGH A;  2YTG A;  5KL2 A;  2EPM X;  2EPX A;  4B3S E;  1P47 A;  1YZ9 A;  1XMO E;  4DV7 E;  2GLI A;  2YTN A;  4L5N C;  2L8T A;  4X9J A;  1PDA A;  2EMW A;  2MDG A;  4NZV A;  4GEQ B;  3ADJ A;  2EPU A;  5A6K A;  4DR3 E;  2Q8U A;  2NUE A;  3EPK A;  2J7J A;  1AAY A;  2EM4 A;  2RSI A;  1FJG E;  2RPC A;  5CFF E;  2N3G A;  4JYA E;  4ZYE A;  1X6F A;  4JI2 E;  1X49 A;  4WPY A;  2V86 A;  2EOI A;  2JP9 A;  2BB8 A;  2DMI A;  4R2C A;  3C6K A;  4X8W A;  2YTE A;  3J81 C;  2UU9 E;  1SFE A;  4DV4 E;  1IMU A;  2ZM6 E;  3MHH C;  4F9C B;  4JI4 E;  2WBS A;  4F6N A;  2YU5 A;  2LUP B;  2LJU A;  2EL5 A;  2EQ0 A;  2DIX A;  2R1F A;  3VYY A;  2EOM A;  1X47 A;  1X6E A;  2DLQ A;  3QG5 C;  4DMI A;  4R2A A;  2IHR 1;  1BBG A;  3ZOQ B;  2DB2 A;  2PRT A;  2YTO A;  3C4B A;  4HEI A;  5T6J A;  4LTY A;  4BC9 A;  4O43 A;  1EH6 A;  1N34 E;  4R03 A;  2EPO A;  4OOG C;  2NUG A;  4ZYD A;  4WYQ B;  1F2I G;  2EN6 A;  4TUG A;  3C4T A;  1UBD C;  3LML A;  4R8O A;  5KL7 A;  1A1I A;  2ELY A;  5AE2 A;  2EMZ A;  4WSP A;  1QU6 A;  2MC6 A;  1RC7 A;  2EOO A;  2YT4 A;  1DGC A;  2N8X A;  2L2N A;  2EJ4 A;  3JU0 A;  4X62 E;  1B69 A;  1HNX E;  5F3W A;  4LFB E;  2LMZ A;  2DGC A;  1GZ6 A;  2ODR C;  4R2P A;  2ODR D;  1KYQ A;  1YUI A;  2ELZ A;  3KWR A;  1ZU1 A;  4DV1 E;  2FV4 B;  2EMK A;  2YTP A;  2EOQ A;  2B3T B;  3UK3 C;  3EPL A;  2EN7 A;  4NXN E;  1L4S A;  4TUI A;  4DV0 E;  3HTX A;  4N4R B;  2YTD A;  2EMG A;  2ENH A;  4O24 A;  1FKA E;  3ADG A;  3BID A;  1YFH A;  1T38 A;  2YSP A;  1WHQ A;  1LLM C;  1QNT A;  4M2Z A;  2MDR A;  4DV2 E;  4JV5 E;  4DV6 E;  1EH8 A;  2EPP A;  4F9B B;  2CSH A;  3RMP A;  1T4O A;  3IWD A;  1X6H A;  2RS7 A;  2EM2 A;  4BCA A;  2NA2 A;  5AC4 A;  3DJW A;  4B3R E;  2L3J A;  2YRK A;  3HPZ A;  2G7H A;  2RQL A;  2LO3 A;  4DUY E;  4BC7 A;  2EPA A;  4DV3 E;  1G2F C;  5FLX C;  4JI5 E;  2EPK X;  1BB8 A;  4DR1 E;  3L00 A;  1PJS A;  2YTF A;  3P1X A;  3VYX A;  1XMQ E;  2BBG A;  4NHR A;  4Q35 B;  5LMN E;  2EOS A;  2RS6 A;  4DR5 E;  2EWL A;  2EMY A;  2K4V A;  2DLK A;  1UHZ A;  2JWO A;  4YHH E;  4DR2 E;  2A25 A;  4R2R A;  1STU A;  4O5G A;  4KWY A;  4KZS A;  2EPL X; 
#chains in the Genus database with same CATH homology
 4DKK A;  3C4B A;  4P7D A;  5LMU E;  2JOB A;  2NUF A;  4LF8 E;  5T6J A;  4LTY A;  4BC9 A;  2L2M A;  1N34 E;  5ADZ A;  2LUQ A;  1UIL A;  4R03 A;  1J26 A;  4OOG C;  1YYO A;  2VE7 C;  2NUG A;  4WYQ B;  2L6M A;  2L3C A;  1DQ3 A;  2LTS A;  4LF6 E;  4LF7 E;  4NXM E;  4JI1 E;  4JI3 E;  4TUG A;  4Q28 A;  3C4T A;  2JVA A;  2FGG A;  3HQ1 A;  2V83 A;  3K6Q A;  4BBY A;  3LML A;  1DI2 A;  4AQY E;  2B7V A;  4R8O A;  1EKZ A;  1HR0 E;  4LF9 E;  1XNR E;  4KZS A;  4GKK E;  2B7T A;  4BS9 A;  3ADL A;  4X65 E;  2FTX B;  3IWB A;  2LRS A;  5AE2 A;  3VK6 A;  2RSM A;  2JY9 A;  4DV5 E;  3T1Y E;  3OML A;  2UXB E;  2HHH E;  1IBL E;  2DSY A;  4WSP A;  2JOX A;  1N32 E;  2KHX A;  2V88 A;  1HNW E;  5AAS A;  1PKP A;  1QU6 A;  2MC6 A;  2B9D A;  1RC7 A;  1IBK E;  2E1M A;  2YT4 A;  4I8O A;  2LE2 A;  4LF5 E;  2V85 A;  2L2N A;  3JU0 A;  4X62 E;  1HNX E;  2V8Q B;  1T4L B;  4YY3 E;  5IWA E;  5F3W A;  4WFT A;  2F4V E;  4JI6 E;  4DR4 E;  4LFB E;  2LMZ A;  2UUA E;  3F6G A;  4M30 A;  3J7Y p;  4L8N A;  3IWC A;  5IT9 C;  3JAM C;  2CPN A;  4K0K E;  1GZ6 A;  2MC5 A;  3LLH A;  2ODR C;  2ODR D;  5AE1 A;  3HPS A;  2WZO A;  3F6H A;  3AUZ A;  3JTZ A;  3KWR A;  4F9A B;  4DV1 E;  2FV4 B;  2M1S A;  4X66 E;  3DF6 A;  2LTR A;  3J7A G;  2M4I A;  2B3T B;  3T1H E;  4LFA E;  4BMJ A;  4NXN E;  4TUI A;  1YYW A;  1SR9 A;  4OX9 E;  1GQE A;  2M7Q A;  2LJH A;  2V87 A;  4DV0 E;  3HTX A;  1O0W A;  3H09 A;  2H36 X;  5A2Q C;  4B3S E;  1YZ9 A;  5DNY A;  4DV7 E;  1XMO E;  3OTO E;  4DUZ E;  4L5N C;  3FIG A;  2L8T A;  4M0V A;  2VQE E;  2LBS B;  3J80 C;  4GKJ E;  2L2K B;  1J5E E;  1FKA E;  3ADG A;  4GEQ B;  1N33 E;  1RQ0 A;  1WHQ A;  3ADJ A;  2EZ6 A;  3AV0 A;  4M2Z A;  2MDR A;  1XNQ E;  3ZOQ B;  4DV2 E;  4JV5 E;  4DV6 E;  4DR3 E;  4F9B B;  2NUE A;  4JI8 E;  3RMP A;  1T4O A;  3IWD A;  2F8B A;  1HNZ E;  4LFC E;  2RS7 A;  1T4N A;  2E5L E;  1N36 E;  1IBM E;  1FJG E;  4BCA A;  2NA2 A;  4JI0 E;  5CFF E;  2N3G A;  1WXR A;  1YYK A;  3DJW A;  4JYA E;  2KON A;  5AE3 A;  4JI2 E;  1X49 A;  4WPY A;  4B3R E;  2V86 A;  3HXL A;  2L3J A;  2YZT A;  1I94 E;  3ADI A;  2UXD E;  2RTX A;  3HPZ A;  2G7H A;  4X8W A;  5LL6 R;  2L92 A;  4DR6 E;  4DUY E;  4BC7 A;  3MSW A;  4DV3 E;  5FLX C;  4LF4 E;  4JI5 E;  3J81 C;  2UU9 E;  4J8Z A;  4DR1 E;  2UUC E;  4DV4 E;  3P1X A;  4JI7 E;  2ZM6 E;  3VYX A;  1XMQ E;  2L33 A;  2V89 A;  2VF1 A;  2UUB E;  5LMN E;  4F9C B;  4JI4 E;  5BR8 E;  2RS6 A;  2LUP B;  4B3M E;  4DR5 E;  2N3H A;  2EWL A;  4P78 A;  2DIX A;  1X48 A;  2DMY A;  2K4V A;  3VYY A;  1X47 A;  4DR2 E;  1UHZ A;  1ZBT A;  2JWO A;  4YHH E;  4B3T E;  2UXC E;  1ZBQ A;  1STU A;  4F54 A;  4LU9 A;  2JR1 A;  1WHN A;  4DMI A;  2KOU A;  4X64 E;  4KHP E;  2VQF E;  4DR7 E;  2IHR 1;  2DB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...