2HC5A

Solution nmr structure of protein yvyc from bacillus subtilis. northeast structural genomics consortium target sr482.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
b'LNIERLTTLQPVWDRYDTQIHNQKDNDNEVPVHQVSYTNLAEMVGEMNKLLEPSQVHLKFELHDKLNEYYVKVIEDSTNEVIREIPPKRWLDFYAAMTEFLGLFVDEKKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yvyC
publication title NMR structure of protein YvyC from Bacillus subtilis reveals unexpected structural similarity between two PFAM families.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 33
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03646 FlaG FlaG protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.170 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain FlaG-like 2hc5A01
2HC5A
chains in the Genus database with same CATH superfamily
2ODRC 4WFTA 4JI1E 3OMLA 2I9IA 1YSAC 1HNZE 4P78A 1A1GA 2RSMA 4WX9A 2ELYA 2EMFA 2HGHA 2UXDE 2K7IA 4LF7E 1BBGA 4DKKA 4P7DA 4DR1E 4M30A 4IS1C 3AUZA 3ADGA 2VQFE 3BGHA 4R2CA 4DV2E 2B7VA 1IQSA 4DR7E 4RHBB 5CFFE 5DNYA 4BBYA 2EQ3A 5KL7A 2EPZA 3T1YE 4X9JA 3JU0A 2V83A 2EM6A 2DIXA 4KHPE 2L3CA 1N3GA 3L00A 2EN1A 4DR6E 2UUCE 4JI3E 4M2ZA 2E72A 4L8NA 4MLQA 2NUEA 4DV5E 3EPHA 4FK5C 2G7HA 4ZYGA 2NUGA 3C6MA 2M7QA 3KZYA 5LMUE 1EH6A 2EPCA 3M99B 2YSPA 2I13A 4KZSA 2ENCA 3UK3C 1SR9A 4O4KA 3BIDA 2YWQA 1YUIA 1YPNA 4DV0E 4DV3E 2ODRD 2EMXA 4JYAE 2DLQA 2B7TA 2LTSA 2YT4A 2V89A 4LF9E 2EMWA 2JYAA 3ECRA 4R2QA 2L2KB 2YRMA 2EOMA 4F9AB 2EMLA 4LFAE 2RPCA 2EOZA 4X66E 4TUGA 4LF5E 3MHSC 4YY3E 2HC5A 3IWBA 5A2QC 4O5GA 2EN8A 2EM9A 2EM2A 2JR1A 4DV7E 2EL6A 5AE3A 3J7AG 3LLHA 4LFBE 2L2NA 1EH8A 5A6AA 2EOJA 4KWYA 4DUZE 1T4NA 4Q28A 2JPAA 5KL6A 1DGCA 2PRTA 2LO3A 4F2JC 3T1HE 2UXCE 5AC5A 2EPRA 2JWOA 4M9VC 2M1SA 2EN4A 2EN6A 4N4RB 2EQ0A 3EPKA 4DR2E 2LJHA 5A6BA 1STUA 2VF1A 4IJDA 4LF6E 3HXLA 2L2MA 2F4VE 5F3WA 4LFCE 3VHTB 4B3RE 3AV0A 1SFEA 2EOEA 3HPSA 2N3GA 1IBLE 2V8QB 2EM0A 2MKNA 5AC4A 1MGTA 4GZNC 1IBME 1N36E 2LT7A 2EMCA 1RMDA 4MLVA 1HR0E 4DV6E 3J7Yp 1ZAAC 1KJKA 5A6JA 5T6JA 5TSEA 2DRPA 4HEIA 1YUJA 1P47A 2UUAE 2N3HA 2EPAA 2ENAA 2R1FA 3MSWA 2WBSA 3EPJA 2LTRA 2JY9A 4DV1E 1RC7A 2LUQA 2MKDA 4R2RA 2EOFA 2LVHA 2MDRA 4X64E 1UHZA 1X6EA 1BB8A 2EZ6A 2EOIA 1JK1A 5AE2A 2VRDA 2YPNA 1PKPA 2EOXA 4O43A 2FTXB 1GZ6A 1QU6A 4HTGA 5KL2A 1GQEA 2JVAA 4J8ZA 4BC7A 3FIGA 2EM7A 3F6GA 4BC9A 5LLQA 5A6BD 2YRKA 4JV5E 4WSPA 4WXDA 2LV2A 4I8OA 3VK6A 4WPYA 5AE1A 2V86A 4LF8E 4JI0E 1ZBQA 4BHBA 3JAMC 2JP9A 2DB2A 3QG5C 4F9CB 4F9BB 4R2SA 5KL5A 1A1JA 2YTGA 4LF4E 3DJWA 4DUYE 4JI8E 1A1HA 2LCEA 2YTOA 2E1MA 1XNQE 1X48A 2CPNA 4JI2E 1X6FA 2NABA 4JI7E 1ZBTA 1WRJA 1PJTA 1IBKE 2FGGA 3HPZA 4F6NA 3IWCA 2JOBA 2EL5A 2KOUA 3RMPA 4B3SE 1ZU1A 2EMAA 3KWRA 1T39A 4NXME 2YU5A 3VYYA 2KONA 2GLIA 4RH8A 4R2DA 2EPMX 2HHHE 2EMGA 2EN2A 4M0VA 1A1KA 2YRHA 4R8OA 4O24A 5IT9C 1UN6B 2E5LE 5FLXC 1AAYA 2EPLX 3H09A 2M4IA 4BS9A 1WXRA 2WZOA 5IXMB 2ELZA 1HNXE 1HNWE 4F54A 1Z1BA 4DR4E 1O0WA 2YSOA 1PDAA 2EJ4A 3HQ1A 3MHHC 2F8BA 2EMBA 2LE2A 1NEIA 2DMYA 2LBSB 2YTEA 2LRSA 1JK2A 1RQ0A 4BHCA 2EOYA 3EPLA 2M9AA 4NXNE 2L92A 2EPPA 3THOB 2UU9E 3DF6A 4B3TE 1J5EE 4WXCA 1XMQE 1T38A 2YTJA 2L6MA 5AASA 2FV4B 4YHHE 4GKKE 1UILA 1T4OA 2EMHA 2YTIA 2RQLA 1I94E 2RS6A 2V87A 2L3JA 1NCSA 2ENHA 2HJJA 2EOOA 3ADJA 2LUPB 2EM4A 4F6MA 2EPNA 3ADIA 2NUFA 1J26A 3C6KA 1WJPA 4JI6E 1X3CA 2EM8A 4OX9E 2R76A 2LMZA 2Q8UA 4R2PA 4AQYE 1YYOA 1FKAE 2V88A 2EN7A 2RTXA 2UUBE 4X62E 5IV8B 4ZYHA 2DLKA 2EPOA 1DI2A 3ADLA 1TF6A 4GEQB 2JXPA 4DV4E 2V85A 4X65E 2EN3A 3IWDA 2YU8A 2D9HA 4DR5E 2EQ1A 2EMIA 1G2FC 1YYWA 1A1LA 3ZOQB 3TQMA 3C4BA 2WBUA 3F6HA 1KYQA 2EOQA 3J80C 2EOHA 2VQEE 4R2EA 2DSYA 5A69A 2EE8A 4DR3E 5IWAE 4ZYDA 2L33A 2JOXA 3KZZA 2EM5A 2EPUA 2MC6A 2BB8A 3THNA 2EPXA 4WYQB 2EMZA 4LU9A 1A1IA 1PJQA 2KHXA 1XMOE 1AH5A 5LL6R 2K4VA 2RS7A 4BCAA 3VYXA 2CSHA 1WHQA 1L4SA 3LMLA 1X6HA 1WHNA 1QNTA 1YFHA 2YTNA 4NZVA 2YTQA 2WCC3 3J81C 1LLMC 4BMJA 3HTXA 3P1XA 4TUIA 1IQOA 2UXBE 2EWLA 4L5NC 4R03A 2EL4A 1T4LB 2EP3A 2GPIA 2EORA 1PJSA 2H36X 4OOGC 3BBGA 4JI5E 1TF3A 1N33E 4WSGA 1EKZA 1GTKA 4LTYA 1IMUA 2WBTA 1A1FA 2MDGA 2GHFA 2DMIA 2NA2A 3K6QA 2A25A 3JTZA 1BBOA 2EOSA 3C4TA 2IHR1 1DQ3A 2YTPA 2DGCA 1FJGE 5ADZA 1N32E 5KL3A 4ZYEA 2ZM6E 1UBDC 1X47A 2EM3A 2YTDA 5KL4A 1G2DC 4B3ME 2BBGA 1MEYC 1N34E 4K0KE 1ZR9A 2EMYA 3BF2A 2CTDA 2VE7C 1YYKA 2L8TA 1X5WA 2LJUA 3EQ1A 5A6KA 4NHRA 1YZ9A 1EH7A 1XNRE 2EPKX 2CT1A 2J7JA 2RSIA 2MC5A 2YZTA 1X49A 4GKJE 4X8WA 4R2AA 4JI4E 2YTFA 1B69A 2B3TB 2B9DA 2N8XA 1F2IG 4Q35B 5LMNE 4DMIA 5BR8E 3OTOE 1TN9A 2ADRA 2EMKA
chains in the Genus database with same CATH topology
2HC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HC5 A; 
#chains in the Genus database with same CATH topology
 2ODR C;  4WFT A;  4JI1 E;  3OML A;  2I9I A;  1YSA C;  1HNZ E;  4P78 A;  1A1G A;  2RSM A;  4WX9 A;  2ELY A;  2EMF A;  2HGH A;  2UXD E;  2K7I A;  4LF7 E;  1BBG A;  4DKK A;  4P7D A;  4DR1 E;  4M30 A;  4IS1 C;  3AUZ A;  3ADG A;  2VQF E;  3BGH A;  4R2C A;  4DV2 E;  2B7V A;  1IQS A;  4DR7 E;  4RHB B;  5CFF E;  5DNY A;  4BBY A;  2EQ3 A;  5KL7 A;  2EPZ A;  3T1Y E;  4X9J A;  3JU0 A;  2V83 A;  2EM6 A;  2DIX A;  4KHP E;  2L3C A;  1N3G A;  3L00 A;  2EN1 A;  4DR6 E;  2UUC E;  4JI3 E;  4M2Z A;  2E72 A;  4L8N A;  4MLQ A;  2NUE A;  4DV5 E;  3EPH A;  4FK5 C;  2G7H A;  4ZYG A;  2NUG A;  3C6M A;  2M7Q A;  3KZY A;  5LMU E;  1EH6 A;  2EPC A;  3M99 B;  2YSP A;  2I13 A;  4KZS A;  2ENC A;  3UK3 C;  1SR9 A;  4O4K A;  3BID A;  2YWQ A;  1YUI A;  1YPN A;  4DV0 E;  4DV3 E;  2ODR D;  2EMX A;  4JYA E;  2DLQ A;  2B7T A;  2LTS A;  2YT4 A;  2V89 A;  4LF9 E;  2EMW A;  2JYA A;  3ECR A;  4R2Q A;  2L2K B;  2YRM A;  2EOM A;  4F9A B;  2EML A;  4LFA E;  2RPC A;  2EOZ A;  4X66 E;  4TUG A;  4LF5 E;  3MHS C;  4YY3 E;  2HC5 A;  3IWB A;  5A2Q C;  4O5G A;  2EN8 A;  2EM9 A;  2EM2 A;  2JR1 A;  4DV7 E;  2EL6 A;  5AE3 A;  3J7A G;  3LLH A;  4LFB E;  2L2N A;  1EH8 A;  5A6A A;  2EOJ A;  4KWY A;  4DUZ E;  1T4N A;  4Q28 A;  2JPA A;  5KL6 A;  1DGC A;  2PRT A;  2LO3 A;  4F2J C;  3T1H E;  2UXC E;  5AC5 A;  2EPR A;  2JWO A;  4M9V C;  2M1S A;  2EN4 A;  2EN6 A;  4N4R B;  2EQ0 A;  3EPK A;  4DR2 E;  2LJH A;  5A6B A;  1STU A;  2VF1 A;  4IJD A;  4LF6 E;  3HXL A;  2L2M A;  2F4V E;  5F3W A;  4LFC E;  3VHT B;  4B3R E;  3AV0 A;  1SFE A;  2EOE A;  3HPS A;  2N3G A;  1IBL E;  2V8Q B;  2EM0 A;  2MKN A;  5AC4 A;  1MGT A;  4GZN C;  1IBM E;  1N36 E;  2LT7 A;  2EMC A;  1RMD A;  4MLV A;  1HR0 E;  4DV6 E;  3J7Y p;  1ZAA C;  1KJK A;  5A6J A;  5T6J A;  5TSE A;  2DRP A;  4HEI A;  1YUJ A;  1P47 A;  2UUA E;  2N3H A;  2EPA A;  2ENA A;  2R1F A;  3MSW A;  2WBS A;  3EPJ A;  2LTR A;  2JY9 A;  4DV1 E;  1RC7 A;  2LUQ A;  2MKD A;  4R2R A;  2EOF A;  2LVH A;  2MDR A;  4X64 E;  1UHZ A;  1X6E A;  1BB8 A;  2EZ6 A;  2EOI A;  1JK1 A;  5AE2 A;  2VRD A;  2YPN A;  1PKP A;  2EOX A;  4O43 A;  2FTX B;  1GZ6 A;  1QU6 A;  4HTG A;  5KL2 A;  1GQE A;  2JVA A;  4J8Z A;  4BC7 A;  3FIG A;  2EM7 A;  3F6G A;  4BC9 A;  5LLQ A;  5A6B D;  2YRK A;  4JV5 E;  4WSP A;  4WXD A;  2LV2 A;  4I8O A;  3VK6 A;  4WPY A;  5AE1 A;  2V86 A;  4LF8 E;  4JI0 E;  1ZBQ A;  4BHB A;  3JAM C;  2JP9 A;  2DB2 A;  3QG5 C;  4F9C B;  4F9B B;  4R2S A;  5KL5 A;  1A1J A;  2YTG A;  4LF4 E;  3DJW A;  4DUY E;  4JI8 E;  1A1H A;  2LCE A;  2YTO A;  2E1M A;  1XNQ E;  1X48 A;  2CPN A;  4JI2 E;  1X6F A;  2NAB A;  4JI7 E;  1ZBT A;  1WRJ A;  1PJT A;  1IBK E;  2FGG A;  3HPZ A;  4F6N A;  3IWC A;  2JOB A;  2EL5 A;  2KOU A;  3RMP A;  4B3S E;  1ZU1 A;  2EMA A;  3KWR A;  1T39 A;  4NXM E;  2YU5 A;  3VYY A;  2KON A;  2GLI A;  4RH8 A;  4R2D A;  2EPM X;  2HHH E;  2EMG A;  2EN2 A;  4M0V A;  1A1K A;  2YRH A;  4R8O A;  4O24 A;  5IT9 C;  1UN6 B;  2E5L E;  5FLX C;  1AAY A;  2EPL X;  3H09 A;  2M4I A;  4BS9 A;  1WXR A;  2WZO A;  5IXM B;  2ELZ A;  1HNX E;  1HNW E;  4F54 A;  1Z1B A;  4DR4 E;  1O0W A;  2YSO A;  1PDA A;  2EJ4 A;  3HQ1 A;  3MHH C;  2F8B A;  2EMB A;  2LE2 A;  1NEI A;  2DMY A;  2LBS B;  2YTE A;  2LRS A;  1JK2 A;  1RQ0 A;  4BHC A;  2EOY A;  3EPL A;  2M9A A;  4NXN E;  2L92 A;  2EPP A;  3THO B;  2UU9 E;  3DF6 A;  4B3T E;  1J5E E;  4WXC A;  1XMQ E;  1T38 A;  2YTJ A;  2L6M A;  5AAS A;  2FV4 B;  4YHH E;  4GKK E;  1UIL A;  1T4O A;  2EMH A;  2YTI A;  2RQL A;  1I94 E;  2RS6 A;  2V87 A;  2L3J A;  1NCS A;  2ENH A;  2HJJ A;  2EOO A;  3ADJ A;  2LUP B;  2EM4 A;  4F6M A;  2EPN A;  3ADI A;  2NUF A;  1J26 A;  3C6K A;  1WJP A;  4JI6 E;  1X3C A;  2EM8 A;  4OX9 E;  2R76 A;  2LMZ A;  2Q8U A;  4R2P A;  4AQY E;  1YYO A;  1FKA E;  2V88 A;  2EN7 A;  2RTX A;  2UUB E;  4X62 E;  5IV8 B;  4ZYH A;  2DLK A;  2EPO A;  1DI2 A;  3ADL A;  1TF6 A;  4GEQ B;  2JXP A;  4DV4 E;  2V85 A;  4X65 E;  2EN3 A;  3IWD A;  2YU8 A;  2D9H A;  4DR5 E;  2EQ1 A;  2EMI A;  1G2F C;  1YYW A;  1A1L A;  3ZOQ B;  3TQM A;  3C4B A;  2WBU A;  3F6H A;  1KYQ A;  2EOQ A;  3J80 C;  2EOH A;  2VQE E;  4R2E A;  2DSY A;  5A69 A;  2EE8 A;  4DR3 E;  5IWA E;  4ZYD A;  2L33 A;  2JOX A;  3KZZ A;  2EM5 A;  2EPU A;  2MC6 A;  2BB8 A;  3THN A;  2EPX A;  4WYQ B;  2EMZ A;  4LU9 A;  1A1I A;  1PJQ A;  2KHX A;  1XMO E;  1AH5 A;  5LL6 R;  2K4V A;  2RS7 A;  4BCA A;  3VYX A;  2CSH A;  1WHQ A;  1L4S A;  3LML A;  1X6H A;  1WHN A;  1QNT A;  1YFH A;  2YTN A;  4NZV A;  2YTQ A;  2WCC 3;  3J81 C;  1LLM C;  4BMJ A;  3HTX A;  3P1X A;  4TUI A;  1IQO A;  2UXB E;  2EWL A;  4L5N C;  4R03 A;  2EL4 A;  1T4L B;  2EP3 A;  2GPI A;  2EOR A;  1PJS A;  2H36 X;  4OOG C;  3BBG A;  4JI5 E;  1TF3 A;  1N33 E;  4WSG A;  1EKZ A;  1GTK A;  4LTY A;  1IMU A;  2WBT A;  1A1F A;  2MDG A;  2GHF A;  2DMI A;  2NA2 A;  3K6Q A;  2A25 A;  3JTZ A;  1BBO A;  2EOS A;  3C4T A;  2IHR 1;  1DQ3 A;  2YTP A;  2DGC A;  1FJG E;  5ADZ A;  1N32 E;  5KL3 A;  4ZYE A;  2ZM6 E;  1UBD C;  1X47 A;  2EM3 A;  2YTD A;  5KL4 A;  1G2D C;  4B3M E;  2BBG A;  1MEY C;  1N34 E;  4K0K E;  1ZR9 A;  2EMY A;  3BF2 A;  2CTD A;  2VE7 C;  1YYK A;  2L8T A;  1X5W A;  2LJU A;  3EQ1 A;  5A6K A;  4NHR A;  1YZ9 A;  1EH7 A;  1XNR E;  2EPK X;  2CT1 A;  2J7J A;  2RSI A;  2MC5 A;  2YZT A;  1X49 A;  4GKJ E;  4X8W A;  4R2A A;  4JI4 E;  2YTF A;  1B69 A;  2B3T B;  2B9D A;  2N8X A;  1F2I G;  4Q35 B;  5LMN E;  4DMI A;  5BR8 E;  3OTO E;  1TN9 A;  2ADR A;  2EMK A; 
#chains in the Genus database with same CATH homology
 2HC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...