2HC5A

Solution nmr structure of protein yvyc from bacillus subtilis. northeast structural genomics consortium target sr482.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
LNIERLTTLQPVWDRYDTQIHNQKDNDNEVPVHQVSYTNLAEMVGEMNKLLEPSQVHLKFELHDKLNEYYVKVIEDSTNEVIREIPPKRWLDFYAAMTEFLGLFVDEKKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yvyC
publication title NMR structure of protein YvyC from Bacillus subtilis reveals unexpected structural similarity between two PFAM families.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 33
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03646 FlaG FlaG protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.170 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain FlaG-like 2hc5A01
2HC5A
chains in the Genus database with same CATH superfamily
1NEIA 4BC9A 1GZ6A 1X6FA 1A1HA 1ZR9A 3BGHA 1ZBTA 4WXDA 2EL5A 4F6MA 4LFAE 2L2NA 3BIDA 4WYQB 5IXMB 4BC7A 4DKKA 1A1JA 2YU5A 2EM2A 2EPZA 4Q28A 4DR3E 1DGCA 2EN2A 2RS7A 1F2IG 4Q35B 2YT4A 1YSAC 3MHHC 4LFCE 1X3CA 1WXRA 4O24A 1N34E 4X62E 3OMLA 1N32E 2EPKX 2YWQA 2DIXA 4LF9E 1EH7A 4BCAA 2EQ0A 3T1HE 1Z1BA 1T4NA 2UXBE 4ZYDA 1O0WA 4WSGA 2EMFA 4JI6E 2FV4B 4B3ME 4DV0E 2HC5A 3VK6A 2JOBA 1AAYA 3HPZA 2KONA 4BS9A 1QU6A 4LF8E 1X6EA 3J80C 2L2KB 5F3WA 3DF6A 4TUIA 2YPNA 2UXDE 4B3SE 1WJPA 2JYAA 1X47A 2V83A 2YZTA 4JI2E 2VE7C 2DRPA 4M9VC 1MEYC 3HXLA 2L2MA 1RC7A 2UXCE 3HTXA 3ADJA 2JXPA 5A6JA 4JV5E 1X6HA 4DV5E 2EM9A 1G2DC 1JK2A 2BB8A 3KZYA 2EOYA 2FGGA 2EOFA 4LFBE 4ZYEA 3FIGA 2LV2A 2RSMA 2YRMA 4JI5E 2RQLA 3EQ1A 2V86A 4WXCA 4I8OA 3EPLA 2LTRA 2EMGA 4DR5E 2B3TB 2MKNA 4GZNC 4R2EA 5A2QC 1IBKE 3J7Yp 2EMZA 4F6NA 4WX9A 2NUGA 1T4LB 2LMZA 2A25A 5AE3A 5AE2A 5KL6A 2LCEA 3T1YE 2CSHA 2GHFA 2MKDA 4AQYE 2L3JA 4DR2E 4J8ZA 2HHHE 3EPJA 3THNA 4KWYA 2EM7A 2V85A 3AV0A 2UUCE 2YSPA 2EMBA 3IWBA 2MC6A 4YHHE 2N8XA 2YTGA 2I13A 2EN3A 2E1MA 5AC5A 4F2JC 2UUBE 2KOUA 2LJUA 4RHBB 2ZM6E 4DV1E 2B7VA 1HNXE 2EPRA 5IV8B 2ODRD 3MSWA 5LLQA 2UUAE 2N3HA 4LF6E 3MHSC 2GLIA 2EMLA 3UK3C 2EM6A 2DB2A 4BHCA 1BBOA 1UHZA 1PJTA 4X65E 2JPAA 2EPOA 2EL6A 1FJGE 1SFEA 1XMOE 4R03A 2LJHA 2EZ6A 2M9AA 4GKJE 2M1SA 2EN1A 5A6AA 2WBUA 4LF5E 4JI7E 1G2FC 5TSEA 4LF7E 4R2AA 1GTKA 2DMIA 2EM8A 5LMNE 3ECRA 4NXME 2F4VE 1X48A 2J7JA 4R2RA 3C6MA 4M2ZA 1JK1A 2CT1A 2EMKA 4F9BB 2WBSA 4HTGA 2L92A 1XNQE 2L3CA 2DMYA 4F54A 1DI2A 2EOHA 2EMYA 1LLMC 4KHPE 2EOEA 3F6GA 2VRDA 2CPNA 2DSYA 2RTXA 4P78A 2NA2A 2EMWA 3C4BA 1IBME 3HPSA 5AE1A 1XNRE 2E5LE 2EE8A 1X49A 4DV3E 4JI0E 2G7HA 2EOXA 4MLQA 2GPIA 3JTZA 2V88A 1YYKA 1J26A 1RQ0A 4IS1C 2EOOA 1L4SA 2LO3A 2KHXA 2DGCA 4JI4E 4X9JA 3L00A 2YRHA 4RH8A 3C4TA 4HEIA 3LLHA 4R2DA 1HR0E 4M30A 2EOMA 2WBTA 1GQEA 3KWRA 2BBGA 4OOGC 2EN8A 2EOZA 2ENCA 2EMAA 4DMIA 1UN6B 5LMUE 2UU9E 3ADGA 5A6BD 5KL4A 3LMLA 2YTEA 2EPLX 1A1KA 2EPUA 1ZAAC 1WRJA 2F8BA 2YTOA 2NUFA 1WHQA 2JP9A 4P7DA 2EM5A 2MDRA 3IWCA 1P47A 4O4KA 4WFTA 1N33E 4DR4E 1XMQE 1UBDC 1UILA 1WHNA 2L8TA 2I9IA 5LL6R 5KL2A 2RPCA 4WSPA 3JAMC 3VHTB 2V89A 1TF6A 2D9HA 3EPHA 2EOIA 5FLXC 5A6KA 4F9AB 1YUJA 4BMJA 2WZOA 1YYOA 4L5NC 1A1IA 2ELYA 2EN4A 2B9DA 2CTDA 4DR6E 2JVAA 5AASA 4DV7E 3TQMA 2WCC3 2EMXA 2LTSA 2EMHA 2EPMX 1QNTA 2NUEA 2NABA 4O5GA 2MDGA 1IBLE 1HNWE 5A69A 2EP3A 3J81C 3C6KA 2RSIA 3F6HA 4ZYGA 2N3GA 2EPCA 4O43A 4LU9A 2YSOA 2YTDA 2K7IA 2EORA 2IHR1 3H09A 1BB8A 2YTJA 1YUIA 5BR8E 2VF1A 1T38A 3KZZA 2LT7A 2EMCA 2V8QB 1EH6A 5KL3A 3VYXA 1N36E 2EPNA 4BBYA 2YRKA 2HGHA 1N3GA 4R2SA 1TF3A 4ZYHA 4B3RE 2LUPB 2LRSA 1X5WA 3ZOQB 2R76A 2LBSB 5ADZA 1A1GA 2JR1A 5A6BA 3JU0A 5KL7A 2H36X 2RS6A 2DLQA 4X64E 2EL4A 1KJKA 2L6MA 4TUGA 2YTIA 1PJQA 2PRTA 5T6JA 1YPNA 2JOXA 5DNYA 2FTXB 2M4IA 3THOB 4DR7E 3ADLA 5CFFE 2JY9A 2VQEE 3RMPA 1YYWA 4YY3E 2VQFE 3EPKA 2ODRC 1A1LA 1EKZA 1B69A 2LVHA 1A1FA 2LE2A 4DUYE 4NHRA 3IWDA 1J5EE 2V87A 1ZU1A 3M99B 2ADRA 2EPAA 4DV4E 1T39A 2EJ4A 2YTFA 2MC5A 2R1FA 1TN9A 3OTOE 1SR9A 2B7TA 4NZVA 5KL5A 4NXNE 1EH8A 2EM0A 4DV2E 2EWLA 2JWOA 1FKAE 3P1XA 4X8WA 2YTNA 4OX9E 4GKKE 2LUQA 1PKPA 3VYYA 4GEQB 1KYQA 4MLVA 1IQOA 4IJDA 1STUA 1HNZE 4JYAE 1BBGA 2YTQA 2EN7A 4F9CB 4K0KE 2K4VA 1T4OA 4N4RB 4R2CA 5AC4A 5IT9C 5IWAE 2EOQA 2EM3A 4B3TE 4M0VA 1PDAA 4R2PA 2EPPA 2E72A 1AH5A 3J7AG 2HJJA 1PJSA 3AUZA 3DJWA 1YFHA 4WPYA 4R2QA 4DR1E 4JI1E 4KZSA 1NCSA 2EQ3A 4LF4E 2YU8A 1RMDA 2Q8UA 2M7QA 2DLKA 2ENHA 4R8OA 2ELZA 3HQ1A 2YTPA 2EOJA 1MGTA 2EN6A 3ADIA 4DV6E 4BHBA 3BF2A 3BBGA 4JI3E 1IMUA 1I94E 1DQ3A 2EMIA 4DUZE 1YZ9A 4FK5C 2ENAA 2EM4A 4X66E 2L33A 2EPXA 1ZBQA 2EOSA 4L8NA 3QG5C 2EQ1A 4LTYA 1IQSA 4JI8E 3K6QA
chains in the Genus database with same CATH topology
2HC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HC5 A; 
#chains in the Genus database with same CATH topology
 1NEI A;  4BC9 A;  1GZ6 A;  1X6F A;  1A1H A;  1ZR9 A;  3BGH A;  1ZBT A;  4WXD A;  2EL5 A;  4F6M A;  4LFA E;  2L2N A;  3BID A;  4WYQ B;  5IXM B;  4BC7 A;  4DKK A;  1A1J A;  2YU5 A;  2EM2 A;  2EPZ A;  4Q28 A;  4DR3 E;  1DGC A;  2EN2 A;  2RS7 A;  1F2I G;  4Q35 B;  2YT4 A;  1YSA C;  3MHH C;  4LFC E;  1X3C A;  1WXR A;  4O24 A;  1N34 E;  4X62 E;  3OML A;  1N32 E;  2EPK X;  2YWQ A;  2DIX A;  4LF9 E;  1EH7 A;  4BCA A;  2EQ0 A;  3T1H E;  1Z1B A;  1T4N A;  2UXB E;  4ZYD A;  1O0W A;  4WSG A;  2EMF A;  4JI6 E;  2FV4 B;  4B3M E;  4DV0 E;  2HC5 A;  3VK6 A;  2JOB A;  1AAY A;  3HPZ A;  2KON A;  4BS9 A;  1QU6 A;  4LF8 E;  1X6E A;  3J80 C;  2L2K B;  5F3W A;  3DF6 A;  4TUI A;  2YPN A;  2UXD E;  4B3S E;  1WJP A;  2JYA A;  1X47 A;  2V83 A;  2YZT A;  4JI2 E;  2VE7 C;  2DRP A;  4M9V C;  1MEY C;  3HXL A;  2L2M A;  1RC7 A;  2UXC E;  3HTX A;  3ADJ A;  2JXP A;  5A6J A;  4JV5 E;  1X6H A;  4DV5 E;  2EM9 A;  1G2D C;  1JK2 A;  2BB8 A;  3KZY A;  2EOY A;  2FGG A;  2EOF A;  4LFB E;  4ZYE A;  3FIG A;  2LV2 A;  2RSM A;  2YRM A;  4JI5 E;  2RQL A;  3EQ1 A;  2V86 A;  4WXC A;  4I8O A;  3EPL A;  2LTR A;  2EMG A;  4DR5 E;  2B3T B;  2MKN A;  4GZN C;  4R2E A;  5A2Q C;  1IBK E;  3J7Y p;  2EMZ A;  4F6N A;  4WX9 A;  2NUG A;  1T4L B;  2LMZ A;  2A25 A;  5AE3 A;  5AE2 A;  5KL6 A;  2LCE A;  3T1Y E;  2CSH A;  2GHF A;  2MKD A;  4AQY E;  2L3J A;  4DR2 E;  4J8Z A;  2HHH E;  3EPJ A;  3THN A;  4KWY A;  2EM7 A;  2V85 A;  3AV0 A;  2UUC E;  2YSP A;  2EMB A;  3IWB A;  2MC6 A;  4YHH E;  2N8X A;  2YTG A;  2I13 A;  2EN3 A;  2E1M A;  5AC5 A;  4F2J C;  2UUB E;  2KOU A;  2LJU A;  4RHB B;  2ZM6 E;  4DV1 E;  2B7V A;  1HNX E;  2EPR A;  5IV8 B;  2ODR D;  3MSW A;  5LLQ A;  2UUA E;  2N3H A;  4LF6 E;  3MHS C;  2GLI A;  2EML A;  3UK3 C;  2EM6 A;  2DB2 A;  4BHC A;  1BBO A;  1UHZ A;  1PJT A;  4X65 E;  2JPA A;  2EPO A;  2EL6 A;  1FJG E;  1SFE A;  1XMO E;  4R03 A;  2LJH A;  2EZ6 A;  2M9A A;  4GKJ E;  2M1S A;  2EN1 A;  5A6A A;  2WBU A;  4LF5 E;  4JI7 E;  1G2F C;  5TSE A;  4LF7 E;  4R2A A;  1GTK A;  2DMI A;  2EM8 A;  5LMN E;  3ECR A;  4NXM E;  2F4V E;  1X48 A;  2J7J A;  4R2R A;  3C6M A;  4M2Z A;  1JK1 A;  2CT1 A;  2EMK A;  4F9B B;  2WBS A;  4HTG A;  2L92 A;  1XNQ E;  2L3C A;  2DMY A;  4F54 A;  1DI2 A;  2EOH A;  2EMY A;  1LLM C;  4KHP E;  2EOE A;  3F6G A;  2VRD A;  2CPN A;  2DSY A;  2RTX A;  4P78 A;  2NA2 A;  2EMW A;  3C4B A;  1IBM E;  3HPS A;  5AE1 A;  1XNR E;  2E5L E;  2EE8 A;  1X49 A;  4DV3 E;  4JI0 E;  2G7H A;  2EOX A;  4MLQ A;  2GPI A;  3JTZ A;  2V88 A;  1YYK A;  1J26 A;  1RQ0 A;  4IS1 C;  2EOO A;  1L4S A;  2LO3 A;  2KHX A;  2DGC A;  4JI4 E;  4X9J A;  3L00 A;  2YRH A;  4RH8 A;  3C4T A;  4HEI A;  3LLH A;  4R2D A;  1HR0 E;  4M30 A;  2EOM A;  2WBT A;  1GQE A;  3KWR A;  2BBG A;  4OOG C;  2EN8 A;  2EOZ A;  2ENC A;  2EMA A;  4DMI A;  1UN6 B;  5LMU E;  2UU9 E;  3ADG A;  5A6B D;  5KL4 A;  3LML A;  2YTE A;  2EPL X;  1A1K A;  2EPU A;  1ZAA C;  1WRJ A;  2F8B A;  2YTO A;  2NUF A;  1WHQ A;  2JP9 A;  4P7D A;  2EM5 A;  2MDR A;  3IWC A;  1P47 A;  4O4K A;  4WFT A;  1N33 E;  4DR4 E;  1XMQ E;  1UBD C;  1UIL A;  1WHN A;  2L8T A;  2I9I A;  5LL6 R;  5KL2 A;  2RPC A;  4WSP A;  3JAM C;  3VHT B;  2V89 A;  1TF6 A;  2D9H A;  3EPH A;  2EOI A;  5FLX C;  5A6K A;  4F9A B;  1YUJ A;  4BMJ A;  2WZO A;  1YYO A;  4L5N C;  1A1I A;  2ELY A;  2EN4 A;  2B9D A;  2CTD A;  4DR6 E;  2JVA A;  5AAS A;  4DV7 E;  3TQM A;  2WCC 3;  2EMX A;  2LTS A;  2EMH A;  2EPM X;  1QNT A;  2NUE A;  2NAB A;  4O5G A;  2MDG A;  1IBL E;  1HNW E;  5A69 A;  2EP3 A;  3J81 C;  3C6K A;  2RSI A;  3F6H A;  4ZYG A;  2N3G A;  2EPC A;  4O43 A;  4LU9 A;  2YSO A;  2YTD A;  2K7I A;  2EOR A;  2IHR 1;  3H09 A;  1BB8 A;  2YTJ A;  1YUI A;  5BR8 E;  2VF1 A;  1T38 A;  3KZZ A;  2LT7 A;  2EMC A;  2V8Q B;  1EH6 A;  5KL3 A;  3VYX A;  1N36 E;  2EPN A;  4BBY A;  2YRK A;  2HGH A;  1N3G A;  4R2S A;  1TF3 A;  4ZYH A;  4B3R E;  2LUP B;  2LRS A;  1X5W A;  3ZOQ B;  2R76 A;  2LBS B;  5ADZ A;  1A1G A;  2JR1 A;  5A6B A;  3JU0 A;  5KL7 A;  2H36 X;  2RS6 A;  2DLQ A;  4X64 E;  2EL4 A;  1KJK A;  2L6M A;  4TUG A;  2YTI A;  1PJQ A;  2PRT A;  5T6J A;  1YPN A;  2JOX A;  5DNY A;  2FTX B;  2M4I A;  3THO B;  4DR7 E;  3ADL A;  5CFF E;  2JY9 A;  2VQE E;  3RMP A;  1YYW A;  4YY3 E;  2VQF E;  3EPK A;  2ODR C;  1A1L A;  1EKZ A;  1B69 A;  2LVH A;  1A1F A;  2LE2 A;  4DUY E;  4NHR A;  3IWD A;  1J5E E;  2V87 A;  1ZU1 A;  3M99 B;  2ADR A;  2EPA A;  4DV4 E;  1T39 A;  2EJ4 A;  2YTF A;  2MC5 A;  2R1F A;  1TN9 A;  3OTO E;  1SR9 A;  2B7T A;  4NZV A;  5KL5 A;  4NXN E;  1EH8 A;  2EM0 A;  4DV2 E;  2EWL A;  2JWO A;  1FKA E;  3P1X A;  4X8W A;  2YTN A;  4OX9 E;  4GKK E;  2LUQ A;  1PKP A;  3VYY A;  4GEQ B;  1KYQ A;  4MLV A;  1IQO A;  4IJD A;  1STU A;  1HNZ E;  4JYA E;  1BBG A;  2YTQ A;  2EN7 A;  4F9C B;  4K0K E;  2K4V A;  1T4O A;  4N4R B;  4R2C A;  5AC4 A;  5IT9 C;  5IWA E;  2EOQ A;  2EM3 A;  4B3T E;  4M0V A;  1PDA A;  4R2P A;  2EPP A;  2E72 A;  1AH5 A;  3J7A G;  2HJJ A;  1PJS A;  3AUZ A;  3DJW A;  1YFH A;  4WPY A;  4R2Q A;  4DR1 E;  4JI1 E;  4KZS A;  1NCS A;  2EQ3 A;  4LF4 E;  2YU8 A;  1RMD A;  2Q8U A;  2M7Q A;  2DLK A;  2ENH A;  4R8O A;  2ELZ A;  3HQ1 A;  2YTP A;  2EOJ A;  1MGT A;  2EN6 A;  3ADI A;  4DV6 E;  4BHB A;  3BF2 A;  3BBG A;  4JI3 E;  1IMU A;  1I94 E;  1DQ3 A;  2EMI A;  4DUZ E;  1YZ9 A;  4FK5 C;  2ENA A;  2EM4 A;  4X66 E;  2L33 A;  2EPX A;  1ZBQ A;  2EOS A;  4L8N A;  3QG5 C;  2EQ1 A;  4LTY A;  1IQS A;  4JI8 E;  3K6Q A; 
#chains in the Genus database with same CATH homology
 2HC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...