2HC5A

Solution nmr structure of protein yvyc from bacillus subtilis. northeast structural genomics consortium target sr482.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
LNIERLTTLQPVWDRYDTQIHNQKDNDNEVPVHQVSYTNLAEMVGEMNKLLEPSQVHLKFELHDKLNEYYVKVIEDSTNEVIREIPPKRWLDFYAAMTEFLGLFVDEKKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of protein YvyC from Bacillus subtilis reveals unexpected structural similarity between two PFAM families.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yvyC
total genus 33
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03646 FlaG FlaG protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.170 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain FlaG-like 2hc5A01
2HC5A
chains in the Genus database with same CATH superfamily
2ODRD 1KJKA 1XMOE 5A2QC 1T4NA 1X49A 1A1JA 2EPCA 4NHRA 4F6MA 1EH8A 1FJGE 2YTOA 1XNQE 2EN6A 5TSEA 1N33E 2UXCE 2EN3A 2CSHA 2EL4A 2EN7A 2YU8A 3C4BA 1GZ6A 1GTKA 2UUAE 2EJ4A 5LMNE 4DR1E 4GKKE 2EMXA 4DV1E 2EOSA 4GKJE 3MSWA 2EOMA 2JOXA 2LJHA 5KL3A 5T6JA 4JI2E 4DUZE 3THNA 2LE2A 2HC5A 2ELZA 1JK1A 4OOGC 1RC7A 4WX9A 2FV4B 4R2QA 2YRKA 2CT1A 4I8OA 3ADJA 1HR0E 3JTZA 2H36X 4OX9E 3ZOQB 1EKZA 4O5GA 4LF5E 2MC6A 2CTDA 5IV8B 2YTEA 2EPPA 4L5NC 2I13A 5AE2A 2LT7A 4LF8E 2GLIA 2ENHA 2EPAA 4X8WA 5AE1A 1AAYA 2V88A 4X62E 1PKPA 5LMUE 4DV5E 2LTSA 2UUBE 2EOIA 3BIDA 2F4VE 5KL6A 1BBOA 5A6BD 3JU0A 2VE7C 2WCC3 3VK6A 2N3GA 4JI1E 1PJQA 1RMDA 1X3CA 4NXME 3VYXA 2V87A 2UXDE 4O43A 4LF4E 2K7IA 3C6MA 1A1FA 4LFBE 2EMFA 1JK2A 2LRSA 1X48A 1IBLE 4Q35B 2EN8A 2RSMA 2L3CA 2CPNA 4KZSA 1YSAC 1IMUA 2HHHE 5KL2A 1GQEA 2EM2A 4R2RA 2EL5A 3FIGA 2GPIA 5KL5A 1XMQE 4LF6E 1YUIA 4TUGA 2N8XA 4BMJA 2ODRC 1QU6A 5A6KA 3J80C 5ADZA 3JAMC 3ECRA 2VRDA 1T4OA 1YFHA 3BF2A 2EPUA 3DF6A 2NUFA 2B7VA 4B3RE 4JI4E 4JYAE 1IBKE 2MDRA 2JVAA 2EWLA 3IWDA 4R2EA 4L8NA 4B3TE 1LLMC 2A25A 2EM8A 4DR3E 1YPNA 2EOEA 2RTXA 4M2ZA 3ADLA 2VF1A 1J5EE 1IQSA 3HPZA 1HNZE 2RQLA 3T1HE 1BB8A 2BBGA 2ZM6E 2LO3A 2NABA 4WSGA 3RMPA 3C6KA 2J7JA 2R1FA 1YUJA 2DGCA 2UU9E 2HGHA 2K4VA 2EPNA 2RS6A 4HTGA 2JY9A 3HPSA 1WJPA 2WBTA 2VQFE 2YSOA 2DB2A 1N3GA 1B69A 4WYQB 3KZZA 3UK3C 4M30A 2JR1A 3J81C 1RQ0A 4F9BB 2M1SA 2RS7A 5DNYA 4F54A 2L33A 4WPYA 2EN2A 4X65E 1ZAAC 4X64E 2IHR1 4BS9A 4IS1C 1TF6A 4WXDA 3ADIA 5IXMB 2EMZA 3MHHC 2B9DA 2I9IA 4LF9E 4JI7E 1ZBQA 2V89A 1O0WA 1UBDC 5A6BA 4JI5E 4DV7E 2EQ0A 2M7QA 2DMIA 3F6HA 2FGGA 4N4RB 4DV0E 4MLQA 5IWAE 1YYOA 3M99B 4DKKA 4P7DA 2DIXA 2Q8UA 3BGHA 2PRTA 5A6AA 2YTJA 3T1YE 5AC5A 3HQ1A 4B3SE 1WHNA 1MGTA 4WSPA 5CFFE 2HJJA 2EMHA 4R2DA 5AASA 4K0KE 2YTNA 3H09A 4BHBA 2EMIA 2YTIA 2N3HA 2YZTA 4BHCA 2EP3A 3OMLA 1A1IA 1STUA 4LTYA 4M0VA 2YTPA 4F2JC 1YZ9A 1ZU1A 2YSPA 3ADGA 2BB8A 4R2AA 2EPXA 1F2IG 1X5WA 1PJTA 5LLQA 2GHFA 4R03A 2ENCA 1G2FC 5FLXC 2YTGA 2KONA 2L2NA 1HNWE 3C4TA 4R8OA 4DR5E 1A1KA 4JV5E 2DLKA 1PJSA 2ENAA 5LL6R 1UN6B 2L6MA 2DMYA 4DR4E 1UHZA 1X6EA 2EM6A 5BR8E 1YYWA 4JI8E 2V85A 2L8TA 3LMLA 4JI6E 2G7HA 4LFAE 1NEIA 2V86A 2M9AA 3IWBA 2EPZA 1T39A 1EH6A 3EQ1A 3BBGA 4LU9A 2YT4A 2EPRA 2EMGA 4F9CB 2WBUA 4O4KA 1IQOA 3EPLA 4DV4E 1EH7A 2EOFA 2LCEA 2VQEE 2E72A 2NUEA 3IWCA 5F3WA 4DR7E 1NCSA 1MEYC 2MKDA 2YPNA 1DGCA 4JI0E 3LLHA 3EPJA 1IBME 1KYQA 2EL6A 2EM3A 3L00A 3VHTB 4GZNC 1TF3A 2MKNA 3EPKA 5AE3A 2EPLX 1L4SA 3KZYA 1FKAE 2L3JA 4DV2E 2V8QB 2DRPA 2EPOA 1TN9A 4R2CA 2UUCE 2JP9A 2EOXA 4R2PA 4GEQB 1N32E 2EM9A 2EOOA 2EMLA 2LMZA 3F6GA 4WXCA 1A1HA 2L2KB 4AQYE 2EOZA 5IT9C 1DQ3A 1Z1BA 1N34E 4BCAA 2EM4A 2EOHA 2WBSA 2NUGA 4MLVA 2YTDA 4KHPE 2EORA 2LBSB 4ZYHA 2L2MA 2EM7A 1X47A 2EPKX 4DUYE 2EM5A 4DMIA 2JOBA 4BC7A 4LF7E 1WXRA 3HXLA 2V83A 1ZBTA 1X6FA 4JI3E 2R76A 2YRMA 2UXBE 4DR6E 4YY3E 4BBYA 2EOYA 2EQ3A 2KOUA 3MHSC 4KWYA 3J7Yp 3AV0A 2LUPB 4HEIA 4F6NA 4IJDA 1AH5A 1PDAA 2E1MA 5KL4A 4M9VC 2EPMX 4RHBB 2E5LE 2D9HA 4X9JA 1A1GA 4RH8A 2YRHA 2EMAA 2EMCA 2EOQA 2EMBA 4O24A 1ZR9A 2B7TA 2JYAA 4J8ZA 2MC5A 2EN4A 3AUZA 2LV2A 2RPCA 2JPAA 1XNRE 3J7AG 1T38A 3KWRA 1UILA 1G2DC 2EN1A 2MDGA 2DSYA 3DJWA 1QNTA 2EOJA 2EMKA 1P47A 1WHQA 2NA2A 2EM0A 2YWQA 2YTQA 2YU5A 3EPHA 4B3ME 2ELYA 4Q28A 5AC4A 2ADRA 2EQ1A 1J26A 2EE8A 4DV6E 1T4LB 1I94E 3P1XA 4X66E 4DR2E 4ZYDA 4WFTA 4YHHE 4ZYGA 2LJUA 2M4IA 1BBGA 4NZVA 4R2SA 4LFCE 4DV3E 3K6QA 1HNXE 1SFEA 5A6JA 4NXNE 1SR9A 3THOB 5A69A 1YYKA 2F8BA 5KL7A 1X6HA 2WZOA 3VYYA 4TUIA 3HTXA 4F9AB 2JWOA 2LUQA 3TQMA 2EMWA 2RSIA 2EMYA 1WRJA 4BC9A 2FTXB 3QG5C 2YTFA 4ZYEA 2B3TB 2KHXA 3OTOE 2DLQA 4FK5C 1DI2A 2LTRA 2L92A 2LVHA 1N36E 1A1LA 4P78A 2JXPA 2EZ6A
chains in the Genus database with same CATH topology
2HC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HC5 A; 
#chains in the Genus database with same CATH topology
 2ODR D;  1KJK A;  1XMO E;  5A2Q C;  1T4N A;  1X49 A;  1A1J A;  2EPC A;  4NHR A;  4F6M A;  1EH8 A;  1FJG E;  2YTO A;  1XNQ E;  2EN6 A;  5TSE A;  1N33 E;  2UXC E;  2EN3 A;  2CSH A;  2EL4 A;  2EN7 A;  2YU8 A;  3C4B A;  1GZ6 A;  1GTK A;  2UUA E;  2EJ4 A;  5LMN E;  4DR1 E;  4GKK E;  2EMX A;  4DV1 E;  2EOS A;  4GKJ E;  3MSW A;  2EOM A;  2JOX A;  2LJH A;  5KL3 A;  5T6J A;  4JI2 E;  4DUZ E;  3THN A;  2LE2 A;  2HC5 A;  2ELZ A;  1JK1 A;  4OOG C;  1RC7 A;  4WX9 A;  2FV4 B;  4R2Q A;  2YRK A;  2CT1 A;  4I8O A;  3ADJ A;  1HR0 E;  3JTZ A;  2H36 X;  4OX9 E;  3ZOQ B;  1EKZ A;  4O5G A;  4LF5 E;  2MC6 A;  2CTD A;  5IV8 B;  2YTE A;  2EPP A;  4L5N C;  2I13 A;  5AE2 A;  2LT7 A;  4LF8 E;  2GLI A;  2ENH A;  2EPA A;  4X8W A;  5AE1 A;  1AAY A;  2V88 A;  4X62 E;  1PKP A;  5LMU E;  4DV5 E;  2LTS A;  2UUB E;  2EOI A;  3BID A;  2F4V E;  5KL6 A;  1BBO A;  5A6B D;  3JU0 A;  2VE7 C;  2WCC 3;  3VK6 A;  2N3G A;  4JI1 E;  1PJQ A;  1RMD A;  1X3C A;  4NXM E;  3VYX A;  2V87 A;  2UXD E;  4O43 A;  4LF4 E;  2K7I A;  3C6M A;  1A1F A;  4LFB E;  2EMF A;  1JK2 A;  2LRS A;  1X48 A;  1IBL E;  4Q35 B;  2EN8 A;  2RSM A;  2L3C A;  2CPN A;  4KZS A;  1YSA C;  1IMU A;  2HHH E;  5KL2 A;  1GQE A;  2EM2 A;  4R2R A;  2EL5 A;  3FIG A;  2GPI A;  5KL5 A;  1XMQ E;  4LF6 E;  1YUI A;  4TUG A;  2N8X A;  4BMJ A;  2ODR C;  1QU6 A;  5A6K A;  3J80 C;  5ADZ A;  3JAM C;  3ECR A;  2VRD A;  1T4O A;  1YFH A;  3BF2 A;  2EPU A;  3DF6 A;  2NUF A;  2B7V A;  4B3R E;  4JI4 E;  4JYA E;  1IBK E;  2MDR A;  2JVA A;  2EWL A;  3IWD A;  4R2E A;  4L8N A;  4B3T E;  1LLM C;  2A25 A;  2EM8 A;  4DR3 E;  1YPN A;  2EOE A;  2RTX A;  4M2Z A;  3ADL A;  2VF1 A;  1J5E E;  1IQS A;  3HPZ A;  1HNZ E;  2RQL A;  3T1H E;  1BB8 A;  2BBG A;  2ZM6 E;  2LO3 A;  2NAB A;  4WSG A;  3RMP A;  3C6K A;  2J7J A;  2R1F A;  1YUJ A;  2DGC A;  2UU9 E;  2HGH A;  2K4V A;  2EPN A;  2RS6 A;  4HTG A;  2JY9 A;  3HPS A;  1WJP A;  2WBT A;  2VQF E;  2YSO A;  2DB2 A;  1N3G A;  1B69 A;  4WYQ B;  3KZZ A;  3UK3 C;  4M30 A;  2JR1 A;  3J81 C;  1RQ0 A;  4F9B B;  2M1S A;  2RS7 A;  5DNY A;  4F54 A;  2L33 A;  4WPY A;  2EN2 A;  4X65 E;  1ZAA C;  4X64 E;  2IHR 1;  4BS9 A;  4IS1 C;  1TF6 A;  4WXD A;  3ADI A;  5IXM B;  2EMZ A;  3MHH C;  2B9D A;  2I9I A;  4LF9 E;  4JI7 E;  1ZBQ A;  2V89 A;  1O0W A;  1UBD C;  5A6B A;  4JI5 E;  4DV7 E;  2EQ0 A;  2M7Q A;  2DMI A;  3F6H A;  2FGG A;  4N4R B;  4DV0 E;  4MLQ A;  5IWA E;  1YYO A;  3M99 B;  4DKK A;  4P7D A;  2DIX A;  2Q8U A;  3BGH A;  2PRT A;  5A6A A;  2YTJ A;  3T1Y E;  5AC5 A;  3HQ1 A;  4B3S E;  1WHN A;  1MGT A;  4WSP A;  5CFF E;  2HJJ A;  2EMH A;  4R2D A;  5AAS A;  4K0K E;  2YTN A;  3H09 A;  4BHB A;  2EMI A;  2YTI A;  2N3H A;  2YZT A;  4BHC A;  2EP3 A;  3OML A;  1A1I A;  1STU A;  4LTY A;  4M0V A;  2YTP A;  4F2J C;  1YZ9 A;  1ZU1 A;  2YSP A;  3ADG A;  2BB8 A;  4R2A A;  2EPX A;  1F2I G;  1X5W A;  1PJT A;  5LLQ A;  2GHF A;  4R03 A;  2ENC A;  1G2F C;  5FLX C;  2YTG A;  2KON A;  2L2N A;  1HNW E;  3C4T A;  4R8O A;  4DR5 E;  1A1K A;  4JV5 E;  2DLK A;  1PJS A;  2ENA A;  5LL6 R;  1UN6 B;  2L6M A;  2DMY A;  4DR4 E;  1UHZ A;  1X6E A;  2EM6 A;  5BR8 E;  1YYW A;  4JI8 E;  2V85 A;  2L8T A;  3LML A;  4JI6 E;  2G7H A;  4LFA E;  1NEI A;  2V86 A;  2M9A A;  3IWB A;  2EPZ A;  1T39 A;  1EH6 A;  3EQ1 A;  3BBG A;  4LU9 A;  2YT4 A;  2EPR A;  2EMG A;  4F9C B;  2WBU A;  4O4K A;  1IQO A;  3EPL A;  4DV4 E;  1EH7 A;  2EOF A;  2LCE A;  2VQE E;  2E72 A;  2NUE A;  3IWC A;  5F3W A;  4DR7 E;  1NCS A;  1MEY C;  2MKD A;  2YPN A;  1DGC A;  4JI0 E;  3LLH A;  3EPJ A;  1IBM E;  1KYQ A;  2EL6 A;  2EM3 A;  3L00 A;  3VHT B;  4GZN C;  1TF3 A;  2MKN A;  3EPK A;  5AE3 A;  2EPL X;  1L4S A;  3KZY A;  1FKA E;  2L3J A;  4DV2 E;  2V8Q B;  2DRP A;  2EPO A;  1TN9 A;  4R2C A;  2UUC E;  2JP9 A;  2EOX A;  4R2P A;  4GEQ B;  1N32 E;  2EM9 A;  2EOO A;  2EML A;  2LMZ A;  3F6G A;  4WXC A;  1A1H A;  2L2K B;  4AQY E;  2EOZ A;  5IT9 C;  1DQ3 A;  1Z1B A;  1N34 E;  4BCA A;  2EM4 A;  2EOH A;  2WBS A;  2NUG A;  4MLV A;  2YTD A;  4KHP E;  2EOR A;  2LBS B;  4ZYH A;  2L2M A;  2EM7 A;  1X47 A;  2EPK X;  4DUY E;  2EM5 A;  4DMI A;  2JOB A;  4BC7 A;  4LF7 E;  1WXR A;  3HXL A;  2V83 A;  1ZBT A;  1X6F A;  4JI3 E;  2R76 A;  2YRM A;  2UXB E;  4DR6 E;  4YY3 E;  4BBY A;  2EOY A;  2EQ3 A;  2KOU A;  3MHS C;  4KWY A;  3J7Y p;  3AV0 A;  2LUP B;  4HEI A;  4F6N A;  4IJD A;  1AH5 A;  1PDA A;  2E1M A;  5KL4 A;  4M9V C;  2EPM X;  4RHB B;  2E5L E;  2D9H A;  4X9J A;  1A1G A;  4RH8 A;  2YRH A;  2EMA A;  2EMC A;  2EOQ A;  2EMB A;  4O24 A;  1ZR9 A;  2B7T A;  2JYA A;  4J8Z A;  2MC5 A;  2EN4 A;  3AUZ A;  2LV2 A;  2RPC A;  2JPA A;  1XNR E;  3J7A G;  1T38 A;  3KWR A;  1UIL A;  1G2D C;  2EN1 A;  2MDG A;  2DSY A;  3DJW A;  1QNT A;  2EOJ A;  2EMK A;  1P47 A;  1WHQ A;  2NA2 A;  2EM0 A;  2YWQ A;  2YTQ A;  2YU5 A;  3EPH A;  4B3M E;  2ELY A;  4Q28 A;  5AC4 A;  2ADR A;  2EQ1 A;  1J26 A;  2EE8 A;  4DV6 E;  1T4L B;  1I94 E;  3P1X A;  4X66 E;  4DR2 E;  4ZYD A;  4WFT A;  4YHH E;  4ZYG A;  2LJU A;  2M4I A;  1BBG A;  4NZV A;  4R2S A;  4LFC E;  4DV3 E;  3K6Q A;  1HNX E;  1SFE A;  5A6J A;  4NXN E;  1SR9 A;  3THO B;  5A69 A;  1YYK A;  2F8B A;  5KL7 A;  1X6H A;  2WZO A;  3VYY A;  4TUI A;  3HTX A;  4F9A B;  2JWO A;  2LUQ A;  3TQM A;  2EMW A;  2RSI A;  2EMY A;  1WRJ A;  4BC9 A;  2FTX B;  3QG5 C;  2YTF A;  4ZYE A;  2B3T B;  2KHX A;  3OTO E;  2DLQ A;  4FK5 C;  1DI2 A;  2LTR A;  2L92 A;  2LVH A;  1N36 E;  1A1L A;  4P78 A;  2JXP A;  2EZ6 A; 
#chains in the Genus database with same CATH homology
 2HC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...