2HC5A

Solution nmr structure of protein yvyc from bacillus subtilis. northeast structural genomics consortium target sr482.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
LNIERLTTLQPVWDRYDTQIHNQKDNDNEVPVHQVSYTNLAEMVGEMNKLLEPSQVHLKFELHDKLNEYYVKVIEDSTNEVIREIPPKRWLDFYAAMTEFLGLFVDEKKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yvyC
publication title NMR structure of protein YvyC from Bacillus subtilis reveals unexpected structural similarity between two PFAM families.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 33
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03646 FlaG FlaG protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.170 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain FlaG-like 2hc5A01
2HC5A
chains in the Genus database with same CATH superfamily
2EPRA 4O43A 2KOUA 2EQ3A 2LJHA 2M1SA 2EMCA 2ENHA 2FTXB 4O24A 4WYQB 2YTEA 2EPUA 3HXLA 4DMIA 2EMGA 2NA2A 1N33E 3C6KA 1YFHA 3HPSA 3BBGA 2EMHA 2JR1A 2HGHA 2V8QB 2CTDA 1HNXE 3EPJA 1YPNA 1A1LA 1UILA 4DR1E 1PJTA 1QNTA 4JI2E 5F3WA 4DR5E 4X65E 2UUAE 4NXNE 2EOYA 2V87A 5IWAE 2WCC3 1MEYC 1XMQE 4KHPE 4WXDA 1UBDC 5AC4A 4WSPA 2JVAA 2EPCA 5KL7A 4JI0E 4J8ZA 4LF6E 2UXBE 4M9VC 4R2DA 3P1XA 2EMFA 3IWDA 2HC5A 2JPAA 3KWRA 4X66E 1IBME 4NXME 3HTXA 5A6BD 4L8NA 2GLIA 2EMLA 2DRPA 2K4VA 2Q8UA 4LFBE 1YZ9A 1X49A 4DUYE 3F6HA 1GQEA 5DNYA 2NUFA 4X9JA 1JK2A 1TN9A 1YSAC 2EN3A 3BIDA 4P7DA 1HNZE 2EM2A 2B9DA 2GPIA 1GZ6A 4X8WA 2EN4A 2EOMA 2KHXA 2E72A 4P78A 1BBGA 4F2JC 1T4LB 1T4NA 1J26A 2F8BA 4BC7A 2MDRA 1KYQA 1N34E 2EMZA 4WSGA 2VQFE 4DV5E 2DB2A 2YTNA 2BB8A 4R2SA 4JI5E 4OX9E 1HNWE 4MLVA 2EOEA 2B7TA 2EPZA 2M4IA 2L3JA 2EOOA 3FIGA 2EMYA 2L2KB 1DGCA 2MDGA 4LF8E 2UU9E 5A6BA 2YTIA 1EH6A 3J7AG 4F6NA 2LV2A 2D9HA 3MHSC 4M0VA 1IMUA 2L2NA 3OMLA 4TUIA 4R2PA 3J80C 4ZYEA 4DV4E 2EMBA 2L92A 3BGHA 2RSMA 1X3CA 1ZAAC 4BS9A 2YTJA 2LUPB 4LF4E 3ADIA 2EL4A 2LRSA 1IQOA 1PJQA 2RPCA 5T6JA 2V85A 4BMJA 5A2QC 1IBLE 2EMIA 2EM9A 1ZBQA 2UUCE 2EMAA 2RTXA 2K7IA 1AH5A 5A6KA 3DF6A 5AE2A 2WZOA 3JAMC 2LMZA 3JU0A 2EL6A 4IJDA 2YTGA 1KJKA 1FKAE 3L00A 3THNA 4TUGA 5AASA 3LLHA 2KONA 4GZNC 4ZYHA 2CPNA 2DLKA 4YHHE 4JI8E 2LVHA 3KZYA 1GTKA 4N4RB 1JK1A 2YTOA 4RHBB 3ECRA 2NABA 4LF5E 2EM0A 2WBUA 1XMOE 2ENCA 2EPOA 4R2QA 4OOGC 2WBTA 2NUGA 1NEIA 4Q35B 2UXDE 2LCEA 2HJJA 5FLXC 1TF3A 1RQ0A 2L3CA 4GEQB 2JXPA 2L8TA 5AE3A 5LLQA 2YZTA 4MLQA 3VYYA 2HHHE 2RS6A 2EE8A 2UXCE 4R2CA 3F6GA 2LO3A 5IXMB 4F9AB 4O5GA 2V89A 4X62E 3H09A 4DV2E 1WHQA 2I13A 2EOFA 3AUZA 4F6MA 4DKKA 4JI7E 3HPZA 1UHZA 1PJSA 2V83A 2L2MA 3TQMA 2DLQA 5A6JA 5A6AA 5LL6R 1XNRE 2YU5A 3M99B 2EOIA 2E1MA 2YRHA 1A1HA 2ELZA 1T39A 4BBYA 5ADZA 3IWCA 2EPXA 4ZYDA 4R03A 3VHTB 2EOJA 2EQ1A 1G2DC 4DV6E 1HR0E 2EM8A 4AQYE 2EN7A 1A1JA 2R76A 2ELYA 1X6FA 2G7HA 2YTQA 2EN1A 3THOB 5KL5A 2LE2A 4DV0E 2JOBA 4WXCA 2CT1A 1RC7A 4JI3E 5AE1A 4GKJE 1LLMC 1N3GA 4K0KE 3K6QA 2YTPA 5BR8E 4JI1E 2F4VE 2E5LE 2EOSA 2JY9A 4BC9A 4F9BB 4M2ZA 4JI4E 1X6HA 1XNQE 2EJ4A 4LF7E 3EPKA 2A25A 4DR7E 1DI2A 1WXRA 2LBSB 1N36E 1BB8A 4WPYA 4X64E 3J7Yp 2EM4A 2DIXA 3MHHC 2B7VA 1Z1BA 2V88A 1X48A 2I9IA 3ADLA 1MGTA 2EM7A 2EOXA 4GKKE 2ENAA 2YPNA 1AAYA 3KZZA 2DSYA 2MC5A 4I8OA 1L4SA 1A1FA 1YUIA 4IS1C 2EPLX 3LMLA 2EM5A 3T1YE 1BBOA 2GHFA 3ZOQB 4BHCA 1O0WA 3UK3C 1TF6A 1YYKA 1STUA 3C4BA 3HQ1A 4R2RA 3VYXA 4R2EA 1ZR9A 1PDAA 4LFCE 4DV3E 2MKDA 4BHBA 2LT7A 1YYWA 2EP3A 4B3TE 2VRDA 1F2IG 2RS7A 4RH8A 2YWQA 1ZBTA 3VK6A 4Q28A 1I94E 2DGCA 4LF9E 4WFTA 5CFFE 1SFEA 5AC5A 5IT9C 4F9CB 2EMKA 5KL3A 2N3HA 4LU9A 2EM3A 5KL2A 2UUBE 2EZ6A 3AV0A 2MKNA 4KWYA 2VF1A 1DQ3A 3BF2A 4B3ME 1SR9A 2B3TB 4M30A 2M7QA 3QG5C 4R8OA 5KL4A 2MC6A 4HEIA 3JTZA 2YSPA 4DR2E 4FK5C 4HTGA 2EORA 2DMIA 1FJGE 4DV1E 1YYOA 1IQSA 4ZYGA 1WRJA 4LTYA 2EOZA 2DMYA 4JYAE 4DR3E 5LMNE 2YRMA 1G2FC 1A1KA 2YTFA 1A1IA 2ODRD 2R1FA 1WJPA 1B69A 2M9AA 4NHRA 4DR4E 2RQLA 3C4TA 3T1HE 3MSWA 4L5NC 2ODRC 4DUZE 2L6MA 4JI6E 2LTSA 5TSEA 5KL6A 2EOQA 2IHR1 2LJUA 4B3SE 2JOXA 2EWLA 2BBGA 1X6EA 1UN6B 2EL5A 2EPKX 2YU8A 1QU6A 2EN6A 2PRTA 1X47A 2EMXA 3J81C 2LUQA 4NZVA 4DR6E 2EN2A 4F54A 2FGGA 2V86A 4DV7E 2ZM6E 2EMWA 4R2AA 1EH8A 2CSHA 1X5WA 5A69A 1T4OA 2N8XA 2EQ0A 2YRKA 4WX9A 2RSIA 3RMPA 5LMUE 3DJWA 2LTRA 2EPPA 1PKPA 2YTDA 4BCAA 2JYAA 2EPMX 2WBSA 3EPLA 2EM6A 2L33A 3ADGA 3ADJA 4B3RE 2NUEA 1NCSA 3IWBA 1RMDA 2JWOA 2J7JA 4LFAE 3OTOE 2ADRA 2FV4B 1YUJA 2H36X 2N3GA 2EOHA 2VQEE 2EPAA 1WHNA 3C6MA 1A1GA 2JP9A 3EQ1A 4JV5E 1IBKE 4KZSA 5IV8B 4O4KA 1N32E 1EKZA 1T38A 1P47A 2VE7C 2YSOA 4YY3E 3EPHA 2EPNA 1EH7A 2YT4A 1ZU1A 2EN8A 1J5EE
chains in the Genus database with same CATH topology
2HC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HC5 A; 
#chains in the Genus database with same CATH topology
 2EPR A;  4O43 A;  2KOU A;  2EQ3 A;  2LJH A;  2M1S A;  2EMC A;  2ENH A;  2FTX B;  4O24 A;  4WYQ B;  2YTE A;  2EPU A;  3HXL A;  4DMI A;  2EMG A;  2NA2 A;  1N33 E;  3C6K A;  1YFH A;  3HPS A;  3BBG A;  2EMH A;  2JR1 A;  2HGH A;  2V8Q B;  2CTD A;  1HNX E;  3EPJ A;  1YPN A;  1A1L A;  1UIL A;  4DR1 E;  1PJT A;  1QNT A;  4JI2 E;  5F3W A;  4DR5 E;  4X65 E;  2UUA E;  4NXN E;  2EOY A;  2V87 A;  5IWA E;  2WCC 3;  1MEY C;  1XMQ E;  4KHP E;  4WXD A;  1UBD C;  5AC4 A;  4WSP A;  2JVA A;  2EPC A;  5KL7 A;  4JI0 E;  4J8Z A;  4LF6 E;  2UXB E;  4M9V C;  4R2D A;  3P1X A;  2EMF A;  3IWD A;  2HC5 A;  2JPA A;  3KWR A;  4X66 E;  1IBM E;  4NXM E;  3HTX A;  5A6B D;  4L8N A;  2GLI A;  2EML A;  2DRP A;  2K4V A;  2Q8U A;  4LFB E;  1YZ9 A;  1X49 A;  4DUY E;  3F6H A;  1GQE A;  5DNY A;  2NUF A;  4X9J A;  1JK2 A;  1TN9 A;  1YSA C;  2EN3 A;  3BID A;  4P7D A;  1HNZ E;  2EM2 A;  2B9D A;  2GPI A;  1GZ6 A;  4X8W A;  2EN4 A;  2EOM A;  2KHX A;  2E72 A;  4P78 A;  1BBG A;  4F2J C;  1T4L B;  1T4N A;  1J26 A;  2F8B A;  4BC7 A;  2MDR A;  1KYQ A;  1N34 E;  2EMZ A;  4WSG A;  2VQF E;  4DV5 E;  2DB2 A;  2YTN A;  2BB8 A;  4R2S A;  4JI5 E;  4OX9 E;  1HNW E;  4MLV A;  2EOE A;  2B7T A;  2EPZ A;  2M4I A;  2L3J A;  2EOO A;  3FIG A;  2EMY A;  2L2K B;  1DGC A;  2MDG A;  4LF8 E;  2UU9 E;  5A6B A;  2YTI A;  1EH6 A;  3J7A G;  4F6N A;  2LV2 A;  2D9H A;  3MHS C;  4M0V A;  1IMU A;  2L2N A;  3OML A;  4TUI A;  4R2P A;  3J80 C;  4ZYE A;  4DV4 E;  2EMB A;  2L92 A;  3BGH A;  2RSM A;  1X3C A;  1ZAA C;  4BS9 A;  2YTJ A;  2LUP B;  4LF4 E;  3ADI A;  2EL4 A;  2LRS A;  1IQO A;  1PJQ A;  2RPC A;  5T6J A;  2V85 A;  4BMJ A;  5A2Q C;  1IBL E;  2EMI A;  2EM9 A;  1ZBQ A;  2UUC E;  2EMA A;  2RTX A;  2K7I A;  1AH5 A;  5A6K A;  3DF6 A;  5AE2 A;  2WZO A;  3JAM C;  2LMZ A;  3JU0 A;  2EL6 A;  4IJD A;  2YTG A;  1KJK A;  1FKA E;  3L00 A;  3THN A;  4TUG A;  5AAS A;  3LLH A;  2KON A;  4GZN C;  4ZYH A;  2CPN A;  2DLK A;  4YHH E;  4JI8 E;  2LVH A;  3KZY A;  1GTK A;  4N4R B;  1JK1 A;  2YTO A;  4RHB B;  3ECR A;  2NAB A;  4LF5 E;  2EM0 A;  2WBU A;  1XMO E;  2ENC A;  2EPO A;  4R2Q A;  4OOG C;  2WBT A;  2NUG A;  1NEI A;  4Q35 B;  2UXD E;  2LCE A;  2HJJ A;  5FLX C;  1TF3 A;  1RQ0 A;  2L3C A;  4GEQ B;  2JXP A;  2L8T A;  5AE3 A;  5LLQ A;  2YZT A;  4MLQ A;  3VYY A;  2HHH E;  2RS6 A;  2EE8 A;  2UXC E;  4R2C A;  3F6G A;  2LO3 A;  5IXM B;  4F9A B;  4O5G A;  2V89 A;  4X62 E;  3H09 A;  4DV2 E;  1WHQ A;  2I13 A;  2EOF A;  3AUZ A;  4F6M A;  4DKK A;  4JI7 E;  3HPZ A;  1UHZ A;  1PJS A;  2V83 A;  2L2M A;  3TQM A;  2DLQ A;  5A6J A;  5A6A A;  5LL6 R;  1XNR E;  2YU5 A;  3M99 B;  2EOI A;  2E1M A;  2YRH A;  1A1H A;  2ELZ A;  1T39 A;  4BBY A;  5ADZ A;  3IWC A;  2EPX A;  4ZYD A;  4R03 A;  3VHT B;  2EOJ A;  2EQ1 A;  1G2D C;  4DV6 E;  1HR0 E;  2EM8 A;  4AQY E;  2EN7 A;  1A1J A;  2R76 A;  2ELY A;  1X6F A;  2G7H A;  2YTQ A;  2EN1 A;  3THO B;  5KL5 A;  2LE2 A;  4DV0 E;  2JOB A;  4WXC A;  2CT1 A;  1RC7 A;  4JI3 E;  5AE1 A;  4GKJ E;  1LLM C;  1N3G A;  4K0K E;  3K6Q A;  2YTP A;  5BR8 E;  4JI1 E;  2F4V E;  2E5L E;  2EOS A;  2JY9 A;  4BC9 A;  4F9B B;  4M2Z A;  4JI4 E;  1X6H A;  1XNQ E;  2EJ4 A;  4LF7 E;  3EPK A;  2A25 A;  4DR7 E;  1DI2 A;  1WXR A;  2LBS B;  1N36 E;  1BB8 A;  4WPY A;  4X64 E;  3J7Y p;  2EM4 A;  2DIX A;  3MHH C;  2B7V A;  1Z1B A;  2V88 A;  1X48 A;  2I9I A;  3ADL A;  1MGT A;  2EM7 A;  2EOX A;  4GKK E;  2ENA A;  2YPN A;  1AAY A;  3KZZ A;  2DSY A;  2MC5 A;  4I8O A;  1L4S A;  1A1F A;  1YUI A;  4IS1 C;  2EPL X;  3LML A;  2EM5 A;  3T1Y E;  1BBO A;  2GHF A;  3ZOQ B;  4BHC A;  1O0W A;  3UK3 C;  1TF6 A;  1YYK A;  1STU A;  3C4B A;  3HQ1 A;  4R2R A;  3VYX A;  4R2E A;  1ZR9 A;  1PDA A;  4LFC E;  4DV3 E;  2MKD A;  4BHB A;  2LT7 A;  1YYW A;  2EP3 A;  4B3T E;  2VRD A;  1F2I G;  2RS7 A;  4RH8 A;  2YWQ A;  1ZBT A;  3VK6 A;  4Q28 A;  1I94 E;  2DGC A;  4LF9 E;  4WFT A;  5CFF E;  1SFE A;  5AC5 A;  5IT9 C;  4F9C B;  2EMK A;  5KL3 A;  2N3H A;  4LU9 A;  2EM3 A;  5KL2 A;  2UUB E;  2EZ6 A;  3AV0 A;  2MKN A;  4KWY A;  2VF1 A;  1DQ3 A;  3BF2 A;  4B3M E;  1SR9 A;  2B3T B;  4M30 A;  2M7Q A;  3QG5 C;  4R8O A;  5KL4 A;  2MC6 A;  4HEI A;  3JTZ A;  2YSP A;  4DR2 E;  4FK5 C;  4HTG A;  2EOR A;  2DMI A;  1FJG E;  4DV1 E;  1YYO A;  1IQS A;  4ZYG A;  1WRJ A;  4LTY A;  2EOZ A;  2DMY A;  4JYA E;  4DR3 E;  5LMN E;  2YRM A;  1G2F C;  1A1K A;  2YTF A;  1A1I A;  2ODR D;  2R1F A;  1WJP A;  1B69 A;  2M9A A;  4NHR A;  4DR4 E;  2RQL A;  3C4T A;  3T1H E;  3MSW A;  4L5N C;  2ODR C;  4DUZ E;  2L6M A;  4JI6 E;  2LTS A;  5TSE A;  5KL6 A;  2EOQ A;  2IHR 1;  2LJU A;  4B3S E;  2JOX A;  2EWL A;  2BBG A;  1X6E A;  1UN6 B;  2EL5 A;  2EPK X;  2YU8 A;  1QU6 A;  2EN6 A;  2PRT A;  1X47 A;  2EMX A;  3J81 C;  2LUQ A;  4NZV A;  4DR6 E;  2EN2 A;  4F54 A;  2FGG A;  2V86 A;  4DV7 E;  2ZM6 E;  2EMW A;  4R2A A;  1EH8 A;  2CSH A;  1X5W A;  5A69 A;  1T4O A;  2N8X A;  2EQ0 A;  2YRK A;  4WX9 A;  2RSI A;  3RMP A;  5LMU E;  3DJW A;  2LTR A;  2EPP A;  1PKP A;  2YTD A;  4BCA A;  2JYA A;  2EPM X;  2WBS A;  3EPL A;  2EM6 A;  2L33 A;  3ADG A;  3ADJ A;  4B3R E;  2NUE A;  1NCS A;  3IWB A;  1RMD A;  2JWO A;  2J7J A;  4LFA E;  3OTO E;  2ADR A;  2FV4 B;  1YUJ A;  2H36 X;  2N3G A;  2EOH A;  2VQE E;  2EPA A;  1WHN A;  3C6M A;  1A1G A;  2JP9 A;  3EQ1 A;  4JV5 E;  1IBK E;  4KZS A;  5IV8 B;  4O4K A;  1N32 E;  1EKZ A;  1T38 A;  1P47 A;  2VE7 C;  2YSO A;  4YY3 E;  3EPH A;  2EPN A;  1EH7 A;  2YT4 A;  1ZU1 A;  2EN8 A;  1J5E E; 
#chains in the Genus database with same CATH homology
 2HC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...