2HC5A

Solution nmr structure of protein yvyc from bacillus subtilis. northeast structural genomics consortium target sr482.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
LNIERLTTLQPVWDRYDTQIHNQKDNDNEVPVHQVSYTNLAEMVGEMNKLLEPSQVHLKFELHDKLNEYYVKVIEDSTNEVIREIPPKRWLDFYAAMTEFLGLFVDEKKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of protein YvyC from Bacillus subtilis reveals unexpected structural similarity between two PFAM families.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yvyC
total genus 33
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03646 FlaG FlaG protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.170 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain FlaG-like 2hc5A01
2HC5A
chains in the Genus database with same CATH superfamily
4O43A 2MDGA 2NA2A 3HQ1A 4O24A 1EH7A 2VQEE 4MLQA 1GZ6A 1X5WA 2ELZA 4LF7E 3OTOE 4R2AA 4FK5C 2EM8A 2WCC3 2EMYA 4DR2E 2WBSA 4R2CA 1HNXE 2B9DA 4BS9A 4DMIA 2A25A 2L8TA 2E5LE 3F6GA 4NHRA 5KL5A 2L2MA 3VHTB 1YYOA 4X62E 1T4OA 2HC5A 4M2ZA 4TUGA 2EMWA 5AASA 4R2RA 2EM7A 1UN6B 3F6HA 5A6JA 1A1GA 2LUQA 4JV5E 5DNYA 1N36E 4R2EA 4GKJE 3EQ1A 2L2KB 4X65E 2YRHA 1EH6A 5IV8B 4M0VA 2GLIA 2EM2A 3KWRA 4HEIA 2DSYA 2NUFA 2EL5A 2EMBA 4LFAE 2JXPA 5KL7A 2EOSA 4LF9E 2EPRA 5FLXC 5A6BA 4GZNC 1ZBTA 4DV6E 1ZAAC 2UXCE 2I13A 2GPIA 2KHXA 4F9BB 5BR8E 2UU9E 2EQ0A 4WFTA 1IBME 2EPLX 4GEQB 4B3SE 3MSWA 2YRKA 2LTRA 1A1FA 1NCSA 2V85A 4YHHE 4F9CB 2EP3A 3FIGA 4L5NC 2EPXA 2LMZA 4GKKE 3C6KA 2DLQA 4DV1E 1NEIA 2CSHA 2JYAA 1DGCA 2M1SA 3EPJA 2EJ4A 2ELYA 4OOGC 1G2DC 2NUGA 2H36X 4BHBA 1UBDC 2LBSB 2V87A 4IS1C 4P7DA 4BC9A 4JI7E 2ODRD 4F6MA 2V88A 3LMLA 3JTZA 3IWDA 2L3JA 5IXMB 1DQ3A 2EMFA 2RSMA 2YTNA 4LU9A 1YUJA 3T1HE 1T4LB 5A69A 2UXBE 2YT4A 2I9IA 4DUZE 2EMHA 1YUIA 3M99B 4LFBE 2RS6A 4BMJA 2YTEA 5A6AA 2EN7A 5LMNE 4WPYA 1J5EE 4LFCE 1A1KA 2EMKA 4NXNE 2EPZA 4BCAA 4BHCA 4KWYA 4DUYE 4DR6E 2VF1A 1X49A 4IJDA 2B7VA 1IBLE 1N32E 4DR1E 2LT7A 2M4IA 2N3GA 1F2IG 4DV5E 4TUIA 2UUBE 1P47A 4R2QA 3P1XA 2HGHA 3BBGA 2FGGA 5ADZA 2WZOA 1ZBQA 2YZTA 2EOFA 4DV2E 3VYXA 4DR7E 2YRMA 2EOIA 1RQ0A 2CTDA 2VQFE 2EPNA 1A1LA 5TSEA 2EMGA 3J80C 2LRSA 4KHPE 2F8BA 2EN8A 2YU8A 1YFHA 1ZU1A 2EPMX 4BBYA 1O0WA 5LL6R 4WXDA 4F2JC 2YTIA 4LTYA 2EOXA 2YTDA 1A1JA 2LJUA 2L3CA 1ZR9A 3J81C 1N34E 1X6HA 5KL6A 1T4NA 1A1HA 4WSGA 2M9AA 2LUPB 2EMZA 1AH5A 2EN2A 4B3TE 5AE2A 2IHR1 3KZZA 2J7JA 3ZOQB 2JY9A 2LJHA 2EMXA 2ADRA 1X3CA 4R8OA 2K4VA 3VYYA 5AC5A 2L92A 1YZ9A 2UXDE 2EPKX 4AQYE 2DGCA 4R2DA 4ZYEA 2LTSA 4M30A 4JYAE 3J7AG 1RC7A 2RPCA 4NZVA 2FV4B 4BC7A 4X9JA 2K7IA 1JK2A 1X47A 4JI1E 4X8WA 4ZYHA 3TQMA 3ADIA 2LE2A 4F54A 2EOHA 1FJGE 3EPHA 4LF4E 5AE3A 5LLQA 5KL2A 1PJSA 2EPOA 1EKZA 2YTPA 2NUEA 4N4RB 1PKPA 2B3TB 4DR5E 4O5GA 1KJKA 4JI0E 3K6QA 1BBOA 3THNA 4Q35B 1PJQA 4NXME 2GHFA 5IT9C 3J7Yp 4R2PA 1LLMC 2MDRA 5CFFE 4WSPA 3VK6A 3IWCA 4LF8E 5A2QC 1YYWA 2WBUA 2N3HA 2V83A 2YWQA 4YY3E 1AAYA 2EPCA 2MC5A 1XMQE 2EZ6A 2YPNA 1YSAC 2EOOA 4DKKA 1DI2A 3C6MA 2ODRC 1TF3A 2EOQA 1YYKA 4B3ME 2HJJA 2EN4A 4P78A 2EMAA 3ADGA 3JU0A 2EL6A 4F9AB 2ENAA 3T1YE 2MKDA 2EQ3A 2EQ1A 2EMCA 2CPNA 5AE1A 2RQLA 2UUCE 2JP9A 3L00A 4L8NA 4O4KA 1UHZA 1QNTA 2LO3A 4JI4E 2BB8A 1WJPA 2EPUA 3HPSA 2EM3A 2YTOA 2EOJA 2YU5A 2V8QB 2EWLA 2LCEA 2YSPA 2EM5A 3QG5C 2RTXA 3KZYA 4KZSA 2YTQA 1X48A 2L6MA 1STUA 1X6FA 3OMLA 2JR1A 1MEYC 1IQSA 1IMUA 1GTKA 2VRDA 1T38A 4ZYDA 4J8ZA 3DJWA 1X6EA 2JWOA 1EH8A 1XNQE 4Q28A 2LVHA 1SR9A 2DMIA 2L2NA 2NABA 1IBKE 3AV0A 2EMIA 2MKNA 2EMLA 2YSOA 5A6KA 1Z1BA 2EPAA 2RS7A 2EM9A 4JI5E 2ENCA 2EM0A 2EOYA 1HNZE 2B7TA 2KOUA 2CT1A 1WHQA 2EM4A 5LMUE 2FTXB 2M7QA 2HHHE 4WYQB 1BBGA 2EN1A 2DRPA 1YPNA 2E1MA 1PDAA 2EORA 3BGHA 4WXCA 4DV7E 2KONA 2JVAA 4JI8E 5A6BD 4MLVA 4JI2E 5AC4A 1A1IA 2DIXA 2VE7C 1QU6A 4DR4E 3ADLA 2N8XA 2PRTA 3LLHA 2L33A 1TF6A 4ZYGA 2JOXA 2EE8A 2EL4A 1UILA 3THOB 4LF5E 4X64E 4X66E 1N3GA 1GQEA 2MC6A 2BBGA 4LF6E 4M9VC 1XNRE 3HTXA 1N33E 1WRJA 2DLKA 4DR3E 5F3WA 3AUZA 2E72A 3H09A 2DB2A 2WBTA 4R2SA 1HR0E 2EPPA 4R03A 4B3RE 5T6JA 3EPKA 3BF2A 1L4SA 3MHSC 3JAMC 4F6NA 3DF6A 2F4VE 5IWAE 5KL3A 4JI6E 1TN9A 1B69A 2D9HA 3ECRA 3HXLA 1KYQA 2EOZA 4WX9A 2R1FA 3BIDA 1MGTA 1J26A 3ADJA 4RH8A 4DV0E 1WHNA 4DV3E 2Q8UA 3C4BA 1FKAE 2YTGA 4JI3E 2DMYA 2JOBA 5KL4A 3HPZA 4I8OA 1I94E 3MHHC 1IQOA 2UUAE 3EPLA 1BB8A 1T39A 2ENHA 2YTFA 3RMPA 1PJTA 2EM6A 4OX9E 1XMOE 4HTGA 2YTJA 4RHBB 2G7HA 1WXRA 1HNWE 2JPAA 1JK1A 3C4TA 1G2FC 2EN3A 4K0KE 2ZM6E 3UK3C 2EOMA 3IWBA 2R76A 2EN6A 1RMDA 2V86A 2V89A 2EOEA 2RSIA 1SFEA 2LV2A 4DV4E
chains in the Genus database with same CATH topology
2HC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HC5 A; 
#chains in the Genus database with same CATH topology
 4O43 A;  2MDG A;  2NA2 A;  3HQ1 A;  4O24 A;  1EH7 A;  2VQE E;  4MLQ A;  1GZ6 A;  1X5W A;  2ELZ A;  4LF7 E;  3OTO E;  4R2A A;  4FK5 C;  2EM8 A;  2WCC 3;  2EMY A;  4DR2 E;  2WBS A;  4R2C A;  1HNX E;  2B9D A;  4BS9 A;  4DMI A;  2A25 A;  2L8T A;  2E5L E;  3F6G A;  4NHR A;  5KL5 A;  2L2M A;  3VHT B;  1YYO A;  4X62 E;  1T4O A;  2HC5 A;  4M2Z A;  4TUG A;  2EMW A;  5AAS A;  4R2R A;  2EM7 A;  1UN6 B;  3F6H A;  5A6J A;  1A1G A;  2LUQ A;  4JV5 E;  5DNY A;  1N36 E;  4R2E A;  4GKJ E;  3EQ1 A;  2L2K B;  4X65 E;  2YRH A;  1EH6 A;  5IV8 B;  4M0V A;  2GLI A;  2EM2 A;  3KWR A;  4HEI A;  2DSY A;  2NUF A;  2EL5 A;  2EMB A;  4LFA E;  2JXP A;  5KL7 A;  2EOS A;  4LF9 E;  2EPR A;  5FLX C;  5A6B A;  4GZN C;  1ZBT A;  4DV6 E;  1ZAA C;  2UXC E;  2I13 A;  2GPI A;  2KHX A;  4F9B B;  5BR8 E;  2UU9 E;  2EQ0 A;  4WFT A;  1IBM E;  2EPL X;  4GEQ B;  4B3S E;  3MSW A;  2YRK A;  2LTR A;  1A1F A;  1NCS A;  2V85 A;  4YHH E;  4F9C B;  2EP3 A;  3FIG A;  4L5N C;  2EPX A;  2LMZ A;  4GKK E;  3C6K A;  2DLQ A;  4DV1 E;  1NEI A;  2CSH A;  2JYA A;  1DGC A;  2M1S A;  3EPJ A;  2EJ4 A;  2ELY A;  4OOG C;  1G2D C;  2NUG A;  2H36 X;  4BHB A;  1UBD C;  2LBS B;  2V87 A;  4IS1 C;  4P7D A;  4BC9 A;  4JI7 E;  2ODR D;  4F6M A;  2V88 A;  3LML A;  3JTZ A;  3IWD A;  2L3J A;  5IXM B;  1DQ3 A;  2EMF A;  2RSM A;  2YTN A;  4LU9 A;  1YUJ A;  3T1H E;  1T4L B;  5A69 A;  2UXB E;  2YT4 A;  2I9I A;  4DUZ E;  2EMH A;  1YUI A;  3M99 B;  4LFB E;  2RS6 A;  4BMJ A;  2YTE A;  5A6A A;  2EN7 A;  5LMN E;  4WPY A;  1J5E E;  4LFC E;  1A1K A;  2EMK A;  4NXN E;  2EPZ A;  4BCA A;  4BHC A;  4KWY A;  4DUY E;  4DR6 E;  2VF1 A;  1X49 A;  4IJD A;  2B7V A;  1IBL E;  1N32 E;  4DR1 E;  2LT7 A;  2M4I A;  2N3G A;  1F2I G;  4DV5 E;  4TUI A;  2UUB E;  1P47 A;  4R2Q A;  3P1X A;  2HGH A;  3BBG A;  2FGG A;  5ADZ A;  2WZO A;  1ZBQ A;  2YZT A;  2EOF A;  4DV2 E;  3VYX A;  4DR7 E;  2YRM A;  2EOI A;  1RQ0 A;  2CTD A;  2VQF E;  2EPN A;  1A1L A;  5TSE A;  2EMG A;  3J80 C;  2LRS A;  4KHP E;  2F8B A;  2EN8 A;  2YU8 A;  1YFH A;  1ZU1 A;  2EPM X;  4BBY A;  1O0W A;  5LL6 R;  4WXD A;  4F2J C;  2YTI A;  4LTY A;  2EOX A;  2YTD A;  1A1J A;  2LJU A;  2L3C A;  1ZR9 A;  3J81 C;  1N34 E;  1X6H A;  5KL6 A;  1T4N A;  1A1H A;  4WSG A;  2M9A A;  2LUP B;  2EMZ A;  1AH5 A;  2EN2 A;  4B3T E;  5AE2 A;  2IHR 1;  3KZZ A;  2J7J A;  3ZOQ B;  2JY9 A;  2LJH A;  2EMX A;  2ADR A;  1X3C A;  4R8O A;  2K4V A;  3VYY A;  5AC5 A;  2L92 A;  1YZ9 A;  2UXD E;  2EPK X;  4AQY E;  2DGC A;  4R2D A;  4ZYE A;  2LTS A;  4M30 A;  4JYA E;  3J7A G;  1RC7 A;  2RPC A;  4NZV A;  2FV4 B;  4BC7 A;  4X9J A;  2K7I A;  1JK2 A;  1X47 A;  4JI1 E;  4X8W A;  4ZYH A;  3TQM A;  3ADI A;  2LE2 A;  4F54 A;  2EOH A;  1FJG E;  3EPH A;  4LF4 E;  5AE3 A;  5LLQ A;  5KL2 A;  1PJS A;  2EPO A;  1EKZ A;  2YTP A;  2NUE A;  4N4R B;  1PKP A;  2B3T B;  4DR5 E;  4O5G A;  1KJK A;  4JI0 E;  3K6Q A;  1BBO A;  3THN A;  4Q35 B;  1PJQ A;  4NXM E;  2GHF A;  5IT9 C;  3J7Y p;  4R2P A;  1LLM C;  2MDR A;  5CFF E;  4WSP A;  3VK6 A;  3IWC A;  4LF8 E;  5A2Q C;  1YYW A;  2WBU A;  2N3H A;  2V83 A;  2YWQ A;  4YY3 E;  1AAY A;  2EPC A;  2MC5 A;  1XMQ E;  2EZ6 A;  2YPN A;  1YSA C;  2EOO A;  4DKK A;  1DI2 A;  3C6M A;  2ODR C;  1TF3 A;  2EOQ A;  1YYK A;  4B3M E;  2HJJ A;  2EN4 A;  4P78 A;  2EMA A;  3ADG A;  3JU0 A;  2EL6 A;  4F9A B;  2ENA A;  3T1Y E;  2MKD A;  2EQ3 A;  2EQ1 A;  2EMC A;  2CPN A;  5AE1 A;  2RQL A;  2UUC E;  2JP9 A;  3L00 A;  4L8N A;  4O4K A;  1UHZ A;  1QNT A;  2LO3 A;  4JI4 E;  2BB8 A;  1WJP A;  2EPU A;  3HPS A;  2EM3 A;  2YTO A;  2EOJ A;  2YU5 A;  2V8Q B;  2EWL A;  2LCE A;  2YSP A;  2EM5 A;  3QG5 C;  2RTX A;  3KZY A;  4KZS A;  2YTQ A;  1X48 A;  2L6M A;  1STU A;  1X6F A;  3OML A;  2JR1 A;  1MEY C;  1IQS A;  1IMU A;  1GTK A;  2VRD A;  1T38 A;  4ZYD A;  4J8Z A;  3DJW A;  1X6E A;  2JWO A;  1EH8 A;  1XNQ E;  4Q28 A;  2LVH A;  1SR9 A;  2DMI A;  2L2N A;  2NAB A;  1IBK E;  3AV0 A;  2EMI A;  2MKN A;  2EML A;  2YSO A;  5A6K A;  1Z1B A;  2EPA A;  2RS7 A;  2EM9 A;  4JI5 E;  2ENC A;  2EM0 A;  2EOY A;  1HNZ E;  2B7T A;  2KOU A;  2CT1 A;  1WHQ A;  2EM4 A;  5LMU E;  2FTX B;  2M7Q A;  2HHH E;  4WYQ B;  1BBG A;  2EN1 A;  2DRP A;  1YPN A;  2E1M A;  1PDA A;  2EOR A;  3BGH A;  4WXC A;  4DV7 E;  2KON A;  2JVA A;  4JI8 E;  5A6B D;  4MLV A;  4JI2 E;  5AC4 A;  1A1I A;  2DIX A;  2VE7 C;  1QU6 A;  4DR4 E;  3ADL A;  2N8X A;  2PRT A;  3LLH A;  2L33 A;  1TF6 A;  4ZYG A;  2JOX A;  2EE8 A;  2EL4 A;  1UIL A;  3THO B;  4LF5 E;  4X64 E;  4X66 E;  1N3G A;  1GQE A;  2MC6 A;  2BBG A;  4LF6 E;  4M9V C;  1XNR E;  3HTX A;  1N33 E;  1WRJ A;  2DLK A;  4DR3 E;  5F3W A;  3AUZ A;  2E72 A;  3H09 A;  2DB2 A;  2WBT A;  4R2S A;  1HR0 E;  2EPP A;  4R03 A;  4B3R E;  5T6J A;  3EPK A;  3BF2 A;  1L4S A;  3MHS C;  3JAM C;  4F6N A;  3DF6 A;  2F4V E;  5IWA E;  5KL3 A;  4JI6 E;  1TN9 A;  1B69 A;  2D9H A;  3ECR A;  3HXL A;  1KYQ A;  2EOZ A;  4WX9 A;  2R1F A;  3BID A;  1MGT A;  1J26 A;  3ADJ A;  4RH8 A;  4DV0 E;  1WHN A;  4DV3 E;  2Q8U A;  3C4B A;  1FKA E;  2YTG A;  4JI3 E;  2DMY A;  2JOB A;  5KL4 A;  3HPZ A;  4I8O A;  1I94 E;  3MHH C;  1IQO A;  2UUA E;  3EPL A;  1BB8 A;  1T39 A;  2ENH A;  2YTF A;  3RMP A;  1PJT A;  2EM6 A;  4OX9 E;  1XMO E;  4HTG A;  2YTJ A;  4RHB B;  2G7H A;  1WXR A;  1HNW E;  2JPA A;  1JK1 A;  3C4T A;  1G2F C;  2EN3 A;  4K0K E;  2ZM6 E;  3UK3 C;  2EOM A;  3IWB A;  2R76 A;  2EN6 A;  1RMD A;  2V86 A;  2V89 A;  2EOE A;  2RSI A;  1SFE A;  2LV2 A;  4DV4 E; 
#chains in the Genus database with same CATH homology
 2HC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...