2B7VA

Structure of adar2 dsrbm2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
PSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and specific RNA binding of ADAR2 double-stranded RNA binding motifs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific editase 1
total genus 21
structure length 71
sequence length 71
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b7vA00
1T4NA 2LJHA 4DKKA 2LBSB 2UXCE 4DR3E 2LUPB 1J26A 1X49A 4B3TE 2RSMA 1HNZE 1T4OA 3LLHA 5CFFE 1ZBTA 2DB2A 2JY9A 4DV3E 3ADIA 2JVAA 4X64E 4K0KE 2B3TB 5LMUE 5IWAE 1IBKE 1N32E 4GKJE 1T4LB 3HTXA 2B7TA 4DR1E 3P1XA 4YHHE 2UXBE 2EZ6A 1EKZA 1X47A 1WHNA 4OOGC 2IHR1 1X48A 1N34E 2F4VE 5LMNE 4DV2E 4LF5E 2N3HA 1XNRE 2UXDE 3J7Yp 4NXNE 1I94E 4WFTA 4M2ZA 1IBLE 3ADGA 4X66E 4JYAE 3T1YE 2E5LE 2VQEE 4JI1E 2DIXA 4DR6E 2NA2A 4DV7E 1WHQA 2VQFE 2B7VA 4DR2E 3ADLA 2LTRA 4YY3E 1XNQE 4LF7E 4X65E 2L2KB 2LTSA 4NXME 2HHHE 3VYYA 4DV1E 4X62E 1STUA 1FJGE 4LF4E 1XMQE 2DMYA 2RTXA 4DR7E 2L2NA 1HNWE 3ADJA 3OTOE 2L33A 4OX9E 1FKAE 2UU9E 4DR5E 4JI3E 2NUEA 4DV6E 4LF9E 2RS7A 1HR0E 4LFAE 4LFBE 4GKKE 2LUQA 1IBME 4LFCE 1YYKA 4JI8E 2CPNA 4X8WA 4JI2E 2UUBE 4LF6E 4KHPE 2YT4A 2RS6A 2NUFA 4JI6E 1RC7A 1YYWA 1HNXE 4LF8E 1DI2A 2L3CA 4B3SE 1YZ9A 4JI5E 2L3JA 2NUGA 3T1HE 1J5EE 4DR4E 2LRSA 4DV5E 5BR8E 1UILA 4M30A 4AQYE 1QU6A 2KHXA 3C4BA 2L2MA 4JV5E 4JI7E 2UUAE 4JI0E 4DV0E 1RQ0A 2N3GA 4B3ME 3VYXA 1O0WA 1GQEA 1UHZA 1N33E 4DV4E 1PKPA 1YYOA 2MDRA 4DUYE 4B3RE 1N36E 3C4TA 2ZM6E 4DUZE 2UUCE 4WYQB 4JI4E 1XMOE
chains in the Genus database with same CATH superfamily
2R1FA 2D9HA 2LBSB 5ADZA 4DR3E 2LUPB 1HNZE 3IWCA 2M9AA 2LE2A 4ZYHA 2LVHA 3ADIA 3L00A 4GKJE 2EOJA 2UXBE 1X6EA 4OOGC 5AC5A 2IHR1 2EM4A 2YU5A 4BBYA 2WBUA 2EN1A 2M4IA 2UXDE 3J7Yp 2JPAA 4NXNE 2YU8A 1I94E 1WJPA 2YTPA 2EQ0A 1PJTA 2EOZA 2JYAA 4MLVA 3KZZA 2VRDA 1WXRA 2DIXA 3KWRA 3HPSA 4DV7E 2CT1A 1JK1A 2JP9A 2B7VA 3C6KA 3EPJA 4X65E 4X62E 1STUA 4F2JC 3H09A 2YTJA 2RTXA 4DR7E 2E1MA 2L2NA 3HQ1A 4Q28A 2HC5A 2L33A 1DQ3A 4DR5E 2V85A 2JWOA 2RS7A 2EN8A 1ZBQA 4GKKE 3TQMA 2GLIA 1IBME 1ZAAC 3JAMC 3F6GA 3ZOQB 2EWLA 4JI2E 4R2RA 2JOBA 2YT4A 2RS6A 4JI6E 1YYWA 2YTIA 1PJSA 5AASA 2EMKA 4N4RB 2NUGA 3T1HE 1J5EE 4DR4E 1DGCA 1UILA 1G2DC 2L92A 2J7JA 1N3GA 5F3WA 2EM2A 4AQYE 4TUIA 2YSPA 2MC6A 2EPOA 2YRHA 4JI7E 2EMGA 4HEIA 4DV4E 4F9AB 3LMLA 2JXPA 1YPNA 2LJUA 4WYQB 2RSIA 2GHFA 1XMOE 2ENHA 2WZOA 2HGHA 3AV0A 2EN4A 2WBTA 4DKKA 2NABA 2UXCE 5A6BD 1T4OA 5CFFE 1TN9A 3HXLA 2N8XA 1ZBTA 2DB2A 2V87A 1PJQA 2JVAA 4X64E 4F6MA 5KL6A 3J80C 4K0KE 2B3TB 5LMUE 1N32E 4HTGA 1T4LB 2EL5A 5T6JA 4YHHE 1EKZA 4WXDA 1A1HA 1WHNA 1KYQA 2ADRA 3M99B 2CSHA 3EPLA 5LMNE 4DV2E 2N3HA 5LLQA 4F54A 2EOYA 2EMXA 2YRMA 1MEYC 4M2ZA 5IV8B 2YSOA 4GEQB 4R2SA 1B69A 4BC9A 4BC7A 3T1YE 3FIGA 1JK2A 2E5LE 4JI1E 4DR6E 2YTOA 2EPLX 1EH8A 2WBSA 3ADLA 4YY3E 1XNQE 2EPMX 2LCEA 1KJKA 2MC5A 4DV1E 2ENAA 1XMQE 2R76A 2PRTA 1X5WA 2HJJA 1HNWE 3ADJA 1YSAC 4KWYA 2EMZA 4BCAA 3OTOE 1RMDA 2E72A 4WPYA 2V8QB 4DV6E 2MKNA 2Q8UA 4O5GA 4KZSA 1HR0E 2EOQA 4LFAE 2EMFA 1YFHA 2LUQA 2V83A 2EMAA 2YPNA 4JI8E 3MHHC 2EOOA 2EMLA 4LF6E 4KHPE 3BF2A 4LF8E 1DI2A 1BB8A 4JI5E 4NZVA 5BR8E 2EJ4A 4WSPA 1AH5A 5TSEA 2LT7A 2EMHA 2FTXB 2KHXA 2EOIA 3C4BA 1SR9A 2JOXA 4JV5E 5KL2A 2EN3A 4JI0E 2F8BA 1RQ0A 2BB8A 5AC4A 5IT9C 1GQEA 2DSYA 1N33E 4WSGA 1ZR9A 4DUYE 1N36E 2DLKA 2ZM6E 3QG5C 3EPHA 1WRJA 2DGCA 2CTDA 3DJWA 2EN6A 2YTFA 2LJHA 5KL7A 1J26A 2YZTA 4F9BB 1X49A 2EM8A 3LLHA 4M0VA 2EPXA 4FK5C 2JY9A 4DV3E 1A1LA 2EMYA 2RPCA 1TF3A 4R2AA 4R03A 4F6NA 4I8OA 5IWAE 3HTXA 4DR1E 4L8NA 4BHCA 3P1XA 2EZ6A 5A6AA 1X47A 4DMIA 1T38A 1N34E 3BIDA 4LF5E 2EPRA 2EOHA 3IWBA 3KZYA 2EPPA 2MDGA 3JU0A 2MKDA 1AAYA 4O43A 2EM6A 2NA2A 1WHQA 2VQFE 2EMBA 2EQ1A 2KONA 2LO3A 2HHHE 2EMCA 3ECRA 3VYYA 2YTEA 1Z1BA 1FJGE 4P78A 2YTNA 5A69A 2DMYA 4R2CA 3THNA 3J7AG 2EOSA 2KOUA 2ELYA 4R2EA 4OX9E 1BBGA 4JI3E 1F2IG 4LF9E 2LV2A 2DLQA 4L5NC 2EM0A 4ZYGA 2EM5A 4LFBE 1A1KA 1IQSA 2ODRD 2VE7C 4LFCE 3DF6A 2CPNA 4BHBA 4R2QA 2UUBE 2YTDA 4J8ZA 2ODRC 4LU9A 1RC7A 1HNXE 2L3CA 1LLMC 1YZ9A 2L3JA 2K4VA 2EL4A 3BGHA 1A1FA 1EH7A 4R2PA 5KL4A 3RMPA 2LMZA 2ENCA 1SFEA 1QU6A 1IQOA 5KL5A 2EP3A 2V86A 3BBGA 5DNYA 4MLQA 5A6KA 2BBGA 4DV0E 4BMJA 3VYXA 1O0WA 2EM3A 1X3CA 2I13A 1UHZA 1UBDC 3C6MA 2A25A 4BS9A 3UK3C 4B3RE 3MHSC 1ZU1A 2L8TA 1A1GA 2EOXA 2RQLA 2EL6A 4IS1C 4DUZE 2UUCE 4JI4E 1X6FA 2EE8A 2EMWA 1T4NA 5A6BA 4WX9A 2VF1A 4LTYA 5IXMB 2EOMA 4B3TE 2EPUA 2RSMA 3EQ1A 2EPZA 4Q35B 1GTKA 3HPZA 1PDAA 1P47A 2G7HA 1NCSA 1IBKE 4R8OA 2EN7A 2B7TA 4M9VC 2EOFA 2EQ3A 1MGTA 1G2FC 1X48A 5AE2A 2F4VE 5LL6R 2FGGA 1XNRE 2EPKX 4NHRA 4R2DA 4RHBB 2V88A 4WFTA 4ZYDA 2GPIA 2K7IA 1QNTA 1IBLE 1NEIA 3ADGA 4X66E 1A1JA 4JYAE 4ZYEA 2M1SA 2B9DA 2EPCA 2VQEE 2YRKA 3THOB 4WXCA 2EM7A 2L6MA 1IMUA 4DR2E 2LTRA 2DMIA 4LF7E 2ELZA 2L2KB 2LTSA 4NXME 1L4SA 1X6HA 4X9JA 3AUZA 4O4KA 5A6JA 3JTZA 2FV4B 4LF4E 3K6QA 2YWQA 1BBOA 3EPKA 3VK6A 2I9IA 1FKAE 2UU9E 2NUEA 5AE3A 2V89A 1EH6A 2EM9A 3MSWA 3OMLA 2EOEA 1YYKA 2H36X 4X8WA 2EORA 1TF6A 4RH8A 2YTGA 2NUFA 2EPNA 4B3SE 3J81C 5AE1A 2EN2A 5A2QC 2LRSA 4DV5E 4M30A 4TUGA 1YUJA 3VHTB 4GZNC 4O24A 4F9CB 1T39A 3F6HA 2L2MA 2WCC3 2UUAE 2M7QA 2YTQA 3IWDA 2N3GA 5FLXC 4B3ME 1UN6B 2JR1A 5KL3A 4P7DA 2DRPA 1YYOA 1PKPA 1YUIA 2MDRA 1GZ6A 3C4TA 2EPAA 1A1IA 2EMIA 4IJDA
chains in the Genus database with same CATH topology
3DJWA 2WZOA 1T4NA 3AV0A 2LJHA 4DKKA 2VF1A 4LTYA 2LBSB 2UXCE 5ADZA 4DR3E 2LUPB 1J26A 2YZTA 4F9BB 1X49A 4B3TE 2RSMA 1HNZE 1T4OA 3LLHA 3IWCA 4M0VA 3HXLA 5CFFE 2LE2A 1ZBTA 2DB2A 2JY9A 3HPZA 4DV3E 3ADIA 2V87A 2JVAA 4X64E 2G7HA 4K0KE 3J80C 2B3TB 4R03A 4I8OA 5IWAE 5LMUE 1IBKE 4R8OA 1T4LB 1N32E 3HTXA 4GKJE 2B7TA 4L8NA 4DR1E 5T6JA 3P1XA 4YHHE 2UXBE 2EZ6A 1EKZA 1X47A 1WHNA 4OOGC 2IHR1 4DMIA 4JI1E 1X48A 4DR6E 4BBYA 5AE2A 1N34E 2F4VE 5LMNE 4DV2E 5LL6R 2FGGA 4LF5E 2N3HA 1XNRE 2M4IA 2UXDE 3J7Yp 4NXNE 4F54A 2V88A 3IWBA 1I94E 4WFTA 4M2ZA 1IBLE 3ADGA 3JU0A 4X66E 4GEQB 4BC9A 4JYAE 2M1SA 4BC7A 2B9DA 3T1YE 3FIGA 1WXRA 2VQEE 2DIXA 2E5LE 3KWRA 2NA2A 3HPSA 1WHQA 2VQFE 4DV7E 2B7VA 2L6MA 4DR2E 3ADLA 2LTRA 4YY3E 1XNQE 4LF7E 2KONA 4X65E 2L2KB 2LTSA 4NXME 2HHHE 2MC5A 3VYYA 4X62E 1STUA 4DV1E 3AUZA 3H09A 3JTZA 2FV4B 4P78A 4LF4E 1XMQE 1FJGE 2DMYA 3K6QA 3J7AG 2RTXA 2KOUA 4DR7E 2E1MA 2L2NA 3HQ1A 4Q28A 3ADJA 1HNWE 3VK6A 4BCAA 2L33A 3OTOE 4OX9E 1FKAE 4WPYA 2UU9E 1DQ3A 4DR5E 4JI3E 2V85A 2NUEA 2V8QB 4DV6E 4LF9E 2JWOA 5AE3A 4KZSA 2RS7A 1HR0E 2V89A 4L5NC 3MSWA 1ZBQA 4LFAE 3OMLA 4LFBE 4GKKE 2LUQA 2V83A 1IBME 2ODRD 2VE7C 3JAMC 4LFCE 2H36X 4JI8E 3DF6A 2CPNA 3F6GA 3ZOQB 4X8WA 2EWLA 1YYKA 4JI2E 2UUBE 4LF6E 4KHPE 2JOBA 2YT4A 4J8ZA 2RS6A 2ODRC 2NUFA 4JI6E 4LU9A 1RC7A 1HNXE 4LF8E 1YYWA 1DI2A 2L3CA 4B3SE 3J81C 1YZ9A 4JI5E 5AE1A 5AASA 2L3JA 5A2QC 2NUGA 2K4VA 3T1HE 1J5EE 4DR4E 2LRSA 4DV5E 5BR8E 1UILA 4M30A 4WSPA 2L92A 4TUGA 3RMPA 2LMZA 5F3WA 2FTXB 4AQYE 1QU6A 4TUIA 2KHXA 4F9CB 3C4BA 2L2MA 2V86A 1SR9A 2JOXA 2MC6A 3F6HA 4JV5E 4JI7E 5DNYA 2UUAE 4JI0E 2M7QA 3IWDA 2F8BA 4DV0E 1RQ0A 2N3GA 4BMJA 5FLXC 1O0WA 4B3ME 3VYXA 5IT9C 2JR1A 1GQEA 1UHZA 2DSYA 4P7DA 4DV4E 1PKPA 1YYOA 1N33E 4F9AB 2MDRA 4BS9A 4DUYE 4B3RE 1N36E 1GZ6A 3C4TA 2L8TA 2ZM6E 3LMLA 4DUZE 2UUCE 4WYQB 4JI4E 1XMOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4N A;  2LJH A;  4DKK A;  2LBS B;  2UXC E;  4DR3 E;  2LUP B;  1J26 A;  1X49 A;  4B3T E;  2RSM A;  1HNZ E;  1T4O A;  3LLH A;  5CFF E;  1ZBT A;  2DB2 A;  2JY9 A;  4DV3 E;  3ADI A;  2JVA A;  4X64 E;  4K0K E;  2B3T B;  5LMU E;  5IWA E;  1IBK E;  1N32 E;  4GKJ E;  1T4L B;  3HTX A;  2B7T A;  4DR1 E;  3P1X A;  4YHH E;  2UXB E;  2EZ6 A;  1EKZ A;  1X47 A;  1WHN A;  4OOG C;  2IHR 1;  1X48 A;  1N34 E;  2F4V E;  5LMN E;  4DV2 E;  4LF5 E;  2N3H A;  1XNR E;  2UXD E;  3J7Y p;  4NXN E;  1I94 E;  4WFT A;  4M2Z A;  1IBL E;  3ADG A;  4X66 E;  4JYA E;  3T1Y E;  2E5L E;  2VQE E;  4JI1 E;  2DIX A;  4DR6 E;  2NA2 A;  4DV7 E;  1WHQ A;  2VQF E;  2B7V A;  4DR2 E;  3ADL A;  2LTR A;  4YY3 E;  1XNQ E;  4LF7 E;  4X65 E;  2L2K B;  2LTS A;  4NXM E;  2HHH E;  3VYY A;  4DV1 E;  4X62 E;  1STU A;  1FJG E;  4LF4 E;  1XMQ E;  2DMY A;  2RTX A;  4DR7 E;  2L2N A;  1HNW E;  3ADJ A;  3OTO E;  2L33 A;  4OX9 E;  1FKA E;  2UU9 E;  4DR5 E;  4JI3 E;  2NUE A;  4DV6 E;  4LF9 E;  2RS7 A;  1HR0 E;  4LFA E;  4LFB E;  4GKK E;  2LUQ A;  1IBM E;  4LFC E;  1YYK A;  4JI8 E;  2CPN A;  4X8W A;  4JI2 E;  2UUB E;  4LF6 E;  4KHP E;  2YT4 A;  2RS6 A;  2NUF A;  4JI6 E;  1RC7 A;  1YYW A;  1HNX E;  4LF8 E;  1DI2 A;  2L3C A;  4B3S E;  1YZ9 A;  4JI5 E;  2L3J A;  2NUG A;  3T1H E;  1J5E E;  4DR4 E;  2LRS A;  4DV5 E;  5BR8 E;  1UIL A;  4M30 A;  4AQY E;  1QU6 A;  2KHX A;  3C4B A;  2L2M A;  4JV5 E;  4JI7 E;  2UUA E;  4JI0 E;  4DV0 E;  1RQ0 A;  2N3G A;  4B3M E;  3VYX A;  1O0W A;  1GQE A;  1UHZ A;  1N33 E;  4DV4 E;  1PKP A;  1YYO A;  2MDR A;  4DUY E;  4B3R E;  1N36 E;  3C4T A;  2ZM6 E;  4DUZ E;  2UUC E;  4WYQ B;  4JI4 E;  1XMO E; 
#chains in the Genus database with same CATH topology
 2R1F A;  2D9H A;  2LBS B;  5ADZ A;  4DR3 E;  2LUP B;  1HNZ E;  3IWC A;  2M9A A;  2LE2 A;  4ZYH A;  2LVH A;  3ADI A;  3L00 A;  4GKJ E;  2EOJ A;  2UXB E;  1X6E A;  4OOG C;  5AC5 A;  2IHR 1;  2EM4 A;  2YU5 A;  4BBY A;  2WBU A;  2EN1 A;  2M4I A;  2UXD E;  3J7Y p;  2JPA A;  4NXN E;  2YU8 A;  1I94 E;  1WJP A;  2YTP A;  2EQ0 A;  1PJT A;  2EOZ A;  2JYA A;  4MLV A;  3KZZ A;  2VRD A;  1WXR A;  2DIX A;  3KWR A;  3HPS A;  4DV7 E;  2CT1 A;  1JK1 A;  2JP9 A;  2B7V A;  3C6K A;  3EPJ A;  4X65 E;  4X62 E;  1STU A;  4F2J C;  3H09 A;  2YTJ A;  2RTX A;  4DR7 E;  2E1M A;  2L2N A;  3HQ1 A;  4Q28 A;  2HC5 A;  2L33 A;  1DQ3 A;  4DR5 E;  2V85 A;  2JWO A;  2RS7 A;  2EN8 A;  1ZBQ A;  4GKK E;  3TQM A;  2GLI A;  1IBM E;  1ZAA C;  3JAM C;  3F6G A;  3ZOQ B;  2EWL A;  4JI2 E;  4R2R A;  2JOB A;  2YT4 A;  2RS6 A;  4JI6 E;  1YYW A;  2YTI A;  1PJS A;  5AAS A;  2EMK A;  4N4R B;  2NUG A;  3T1H E;  1J5E E;  4DR4 E;  1DGC A;  1UIL A;  1G2D C;  2L92 A;  2J7J A;  1N3G A;  5F3W A;  2EM2 A;  4AQY E;  4TUI A;  2YSP A;  2MC6 A;  2EPO A;  2YRH A;  4JI7 E;  2EMG A;  4HEI A;  4DV4 E;  4F9A B;  3LML A;  2JXP A;  1YPN A;  2LJU A;  4WYQ B;  2RSI A;  2GHF A;  1XMO E;  2ENH A;  2WZO A;  2HGH A;  3AV0 A;  2EN4 A;  2WBT A;  4DKK A;  2NAB A;  2UXC E;  5A6B D;  1T4O A;  5CFF E;  1TN9 A;  3HXL A;  2N8X A;  1ZBT A;  2DB2 A;  2V87 A;  1PJQ A;  2JVA A;  4X64 E;  4F6M A;  5KL6 A;  3J80 C;  4K0K E;  2B3T B;  5LMU E;  1N32 E;  4HTG A;  1T4L B;  2EL5 A;  5T6J A;  4YHH E;  1EKZ A;  4WXD A;  1A1H A;  1WHN A;  1KYQ A;  2ADR A;  3M99 B;  2CSH A;  3EPL A;  5LMN E;  4DV2 E;  2N3H A;  5LLQ A;  4F54 A;  2EOY A;  2EMX A;  2YRM A;  1MEY C;  4M2Z A;  5IV8 B;  2YSO A;  4GEQ B;  4R2S A;  1B69 A;  4BC9 A;  4BC7 A;  3T1Y E;  3FIG A;  1JK2 A;  2E5L E;  4JI1 E;  4DR6 E;  2YTO A;  2EPL X;  1EH8 A;  2WBS A;  3ADL A;  4YY3 E;  1XNQ E;  2EPM X;  2LCE A;  1KJK A;  2MC5 A;  4DV1 E;  2ENA A;  1XMQ E;  2R76 A;  2PRT A;  1X5W A;  2HJJ A;  1HNW E;  3ADJ A;  1YSA C;  4KWY A;  2EMZ A;  4BCA A;  3OTO E;  1RMD A;  2E72 A;  4WPY A;  2V8Q B;  4DV6 E;  2MKN A;  2Q8U A;  4O5G A;  4KZS A;  1HR0 E;  2EOQ A;  4LFA E;  2EMF A;  1YFH A;  2LUQ A;  2V83 A;  2EMA A;  2YPN A;  4JI8 E;  3MHH C;  2EOO A;  2EML A;  4LF6 E;  4KHP E;  3BF2 A;  4LF8 E;  1DI2 A;  1BB8 A;  4JI5 E;  4NZV A;  5BR8 E;  2EJ4 A;  4WSP A;  1AH5 A;  5TSE A;  2LT7 A;  2EMH A;  2FTX B;  2KHX A;  2EOI A;  3C4B A;  1SR9 A;  2JOX A;  4JV5 E;  5KL2 A;  2EN3 A;  4JI0 E;  2F8B A;  1RQ0 A;  2BB8 A;  5AC4 A;  5IT9 C;  1GQE A;  2DSY A;  1N33 E;  4WSG A;  1ZR9 A;  4DUY E;  1N36 E;  2DLK A;  2ZM6 E;  3QG5 C;  3EPH A;  1WRJ A;  2DGC A;  2CTD A;  3DJW A;  2EN6 A;  2YTF A;  2LJH A;  5KL7 A;  1J26 A;  2YZT A;  4F9B B;  1X49 A;  2EM8 A;  3LLH A;  4M0V A;  2EPX A;  4FK5 C;  2JY9 A;  4DV3 E;  1A1L A;  2EMY A;  2RPC A;  1TF3 A;  4R2A A;  4R03 A;  4F6N A;  4I8O A;  5IWA E;  3HTX A;  4DR1 E;  4L8N A;  4BHC A;  3P1X A;  2EZ6 A;  5A6A A;  1X47 A;  4DMI A;  1T38 A;  1N34 E;  3BID A;  4LF5 E;  2EPR A;  2EOH A;  3IWB A;  3KZY A;  2EPP A;  2MDG A;  3JU0 A;  2MKD A;  1AAY A;  4O43 A;  2EM6 A;  2NA2 A;  1WHQ A;  2VQF E;  2EMB A;  2EQ1 A;  2KON A;  2LO3 A;  2HHH E;  2EMC A;  3ECR A;  3VYY A;  2YTE A;  1Z1B A;  1FJG E;  4P78 A;  2YTN A;  5A69 A;  2DMY A;  4R2C A;  3THN A;  3J7A G;  2EOS A;  2KOU A;  2ELY A;  4R2E A;  4OX9 E;  1BBG A;  4JI3 E;  1F2I G;  4LF9 E;  2LV2 A;  2DLQ A;  4L5N C;  2EM0 A;  4ZYG A;  2EM5 A;  4LFB E;  1A1K A;  1IQS A;  2ODR D;  2VE7 C;  4LFC E;  3DF6 A;  2CPN A;  4BHB A;  4R2Q A;  2UUB E;  2YTD A;  4J8Z A;  2ODR C;  4LU9 A;  1RC7 A;  1HNX E;  2L3C A;  1LLM C;  1YZ9 A;  2L3J A;  2K4V A;  2EL4 A;  3BGH A;  1A1F A;  1EH7 A;  4R2P A;  5KL4 A;  3RMP A;  2LMZ A;  2ENC A;  1SFE A;  1QU6 A;  1IQO A;  5KL5 A;  2EP3 A;  2V86 A;  3BBG A;  5DNY A;  4MLQ A;  5A6K A;  2BBG A;  4DV0 E;  4BMJ A;  3VYX A;  1O0W A;  2EM3 A;  1X3C A;  2I13 A;  1UHZ A;  1UBD C;  3C6M A;  2A25 A;  4BS9 A;  3UK3 C;  4B3R E;  3MHS C;  1ZU1 A;  2L8T A;  1A1G A;  2EOX A;  2RQL A;  2EL6 A;  4IS1 C;  4DUZ E;  2UUC E;  4JI4 E;  1X6F A;  2EE8 A;  2EMW A;  1T4N A;  5A6B A;  4WX9 A;  2VF1 A;  4LTY A;  5IXM B;  2EOM A;  4B3T E;  2EPU A;  2RSM A;  3EQ1 A;  2EPZ A;  4Q35 B;  1GTK A;  3HPZ A;  1PDA A;  1P47 A;  2G7H A;  1NCS A;  1IBK E;  4R8O A;  2EN7 A;  2B7T A;  4M9V C;  2EOF A;  2EQ3 A;  1MGT A;  1G2F C;  1X48 A;  5AE2 A;  2F4V E;  5LL6 R;  2FGG A;  1XNR E;  2EPK X;  4NHR A;  4R2D A;  4RHB B;  2V88 A;  4WFT A;  4ZYD A;  2GPI A;  2K7I A;  1QNT A;  1IBL E;  1NEI A;  3ADG A;  4X66 E;  1A1J A;  4JYA E;  4ZYE A;  2M1S A;  2B9D A;  2EPC A;  2VQE E;  2YRK A;  3THO B;  4WXC A;  2EM7 A;  2L6M A;  1IMU A;  4DR2 E;  2LTR A;  2DMI A;  4LF7 E;  2ELZ A;  2L2K B;  2LTS A;  4NXM E;  1L4S A;  1X6H A;  4X9J A;  3AUZ A;  4O4K A;  5A6J A;  3JTZ A;  2FV4 B;  4LF4 E;  3K6Q A;  2YWQ A;  1BBO A;  3EPK A;  3VK6 A;  2I9I A;  1FKA E;  2UU9 E;  2NUE A;  5AE3 A;  2V89 A;  1EH6 A;  2EM9 A;  3MSW A;  3OML A;  2EOE A;  1YYK A;  2H36 X;  4X8W A;  2EOR A;  1TF6 A;  4RH8 A;  2YTG A;  2NUF A;  2EPN A;  4B3S E;  3J81 C;  5AE1 A;  2EN2 A;  5A2Q C;  2LRS A;  4DV5 E;  4M30 A;  4TUG A;  1YUJ A;  3VHT B;  4GZN C;  4O24 A;  4F9C B;  1T39 A;  3F6H A;  2L2M A;  2WCC 3;  2UUA E;  2M7Q A;  2YTQ A;  3IWD A;  2N3G A;  5FLX C;  4B3M E;  1UN6 B;  2JR1 A;  5KL3 A;  4P7D A;  2DRP A;  1YYO A;  1PKP A;  1YUI A;  2MDR A;  1GZ6 A;  3C4T A;  2EPA A;  1A1I A;  2EMI A;  4IJD A; 
#chains in the Genus database with same CATH homology
 3DJW A;  2WZO A;  1T4N A;  3AV0 A;  2LJH A;  4DKK A;  2VF1 A;  4LTY A;  2LBS B;  2UXC E;  5ADZ A;  4DR3 E;  2LUP B;  1J26 A;  2YZT A;  4F9B B;  1X49 A;  4B3T E;  2RSM A;  1HNZ E;  1T4O A;  3LLH A;  3IWC A;  4M0V A;  3HXL A;  5CFF E;  2LE2 A;  1ZBT A;  2DB2 A;  2JY9 A;  3HPZ A;  4DV3 E;  3ADI A;  2V87 A;  2JVA A;  4X64 E;  2G7H A;  4K0K E;  3J80 C;  2B3T B;  4R03 A;  4I8O A;  5IWA E;  5LMU E;  1IBK E;  4R8O A;  1T4L B;  1N32 E;  3HTX A;  4GKJ E;  2B7T A;  4L8N A;  4DR1 E;  5T6J A;  3P1X A;  4YHH E;  2UXB E;  2EZ6 A;  1EKZ A;  1X47 A;  1WHN A;  4OOG C;  2IHR 1;  4DMI A;  4JI1 E;  1X48 A;  4DR6 E;  4BBY A;  5AE2 A;  1N34 E;  2F4V E;  5LMN E;  4DV2 E;  5LL6 R;  2FGG A;  4LF5 E;  2N3H A;  1XNR E;  2M4I A;  2UXD E;  3J7Y p;  4NXN E;  4F54 A;  2V88 A;  3IWB A;  1I94 E;  4WFT A;  4M2Z A;  1IBL E;  3ADG A;  3JU0 A;  4X66 E;  4GEQ B;  4BC9 A;  4JYA E;  2M1S A;  4BC7 A;  2B9D A;  3T1Y E;  3FIG A;  1WXR A;  2VQE E;  2DIX A;  2E5L E;  3KWR A;  2NA2 A;  3HPS A;  1WHQ A;  2VQF E;  4DV7 E;  2B7V A;  2L6M A;  4DR2 E;  3ADL A;  2LTR A;  4YY3 E;  1XNQ E;  4LF7 E;  2KON A;  4X65 E;  2L2K B;  2LTS A;  4NXM E;  2HHH E;  2MC5 A;  3VYY A;  4X62 E;  1STU A;  4DV1 E;  3AUZ A;  3H09 A;  3JTZ A;  2FV4 B;  4P78 A;  4LF4 E;  1XMQ E;  1FJG E;  2DMY A;  3K6Q A;  3J7A G;  2RTX A;  2KOU A;  4DR7 E;  2E1M A;  2L2N A;  3HQ1 A;  4Q28 A;  3ADJ A;  1HNW E;  3VK6 A;  4BCA A;  2L33 A;  3OTO E;  4OX9 E;  1FKA E;  4WPY A;  2UU9 E;  1DQ3 A;  4DR5 E;  4JI3 E;  2V85 A;  2NUE A;  2V8Q B;  4DV6 E;  4LF9 E;  2JWO A;  5AE3 A;  4KZS A;  2RS7 A;  1HR0 E;  2V89 A;  4L5N C;  3MSW A;  1ZBQ A;  4LFA E;  3OML A;  4LFB E;  4GKK E;  2LUQ A;  2V83 A;  1IBM E;  2ODR D;  2VE7 C;  3JAM C;  4LFC E;  2H36 X;  4JI8 E;  3DF6 A;  2CPN A;  3F6G A;  3ZOQ B;  4X8W A;  2EWL A;  1YYK A;  4JI2 E;  2UUB E;  4LF6 E;  4KHP E;  2JOB A;  2YT4 A;  4J8Z A;  2RS6 A;  2ODR C;  2NUF A;  4JI6 E;  4LU9 A;  1RC7 A;  1HNX E;  4LF8 E;  1YYW A;  1DI2 A;  2L3C A;  4B3S E;  3J81 C;  1YZ9 A;  4JI5 E;  5AE1 A;  5AAS A;  2L3J A;  5A2Q C;  2NUG A;  2K4V A;  3T1H E;  1J5E E;  4DR4 E;  2LRS A;  4DV5 E;  5BR8 E;  1UIL A;  4M30 A;  4WSP A;  2L92 A;  4TUG A;  3RMP A;  2LMZ A;  5F3W A;  2FTX B;  4AQY E;  1QU6 A;  4TUI A;  2KHX A;  4F9C B;  3C4B A;  2L2M A;  2V86 A;  1SR9 A;  2JOX A;  2MC6 A;  3F6H A;  4JV5 E;  4JI7 E;  5DNY A;  2UUA E;  4JI0 E;  2M7Q A;  3IWD A;  2F8B A;  4DV0 E;  1RQ0 A;  2N3G A;  4BMJ A;  5FLX C;  1O0W A;  4B3M E;  3VYX A;  5IT9 C;  2JR1 A;  1GQE A;  1UHZ A;  2DSY A;  4P7D A;  4DV4 E;  1PKP A;  1YYO A;  1N33 E;  4F9A B;  2MDR A;  4BS9 A;  4DUY E;  4B3R E;  1N36 E;  1GZ6 A;  3C4T A;  2L8T A;  2ZM6 E;  3LML A;  4DUZ E;  2UUC E;  4WYQ B;  4JI4 E;  1XMO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...