2B7VA

Structure of adar2 dsrbm2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
PSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase 1
publication title Structure and specific RNA binding of ADAR2 double-stranded RNA binding motifs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 21
structure length 71
sequence length 71
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b7vA00
1XNRE 5CFFE 2UUBE 4DUZE 2B7VA 1T4OA 3P1XA 1J5EE 2NA2A 2ZM6E 1X49A 1GQEA 2RTXA 2NUEA 4KHPE 1YYWA 1X48A 2NUGA 2UXBE 5IWAE 2CPNA 3ADGA 4DR1E 4AQYE 4DV2E 2MDRA 2YT4A 4M30A 2B7TA 2UXCE 3HTXA 4NXNE 4DUYE 1YZ9A 4DR2E 2L3CA 4LF6E 1XMOE 4JV5E 1HNZE 2NUFA 1HR0E 4JI1E 2KHXA 4M2ZA 3VYYA 1UHZA 2LJHA 4B3RE 1EKZA 1QU6A 1WHQA 2UUCE 1J26A 5BR8E 1X47A 4DKKA 2LRSA 1STUA 2IHR1 4DV6E 2UU9E 1ZBTA 4B3ME 1DI2A 4WYQB 3ADLA 4LFBE 2E5LE 4X8WA 1IBLE 2N3GA 2RSMA 1O0WA 4DV0E 4LF5E 2L2NA 2N3HA 2HHHE 4JI3E 2DIXA 3ADIA 2JY9A 3J7Yp 5LMUE 2F4VE 4DV4E 2L2KB 2LUPB 2L2MA 1N36E 4JI7E 2L3JA 4DR6E 4DV3E 2JVAA 3ADJA 2RS6A 4WFTA 1RQ0A 5LMNE 1T4NA 4JYAE 4DR5E 4OOGC 4K0KE 1YYKA 4JI8E 3OTOE 4JI0E 2L33A 3T1YE 1HNXE 4JI5E 4JI2E 2UXDE 2UUAE 1N33E 4X64E 4DR7E 2VQEE 4NXME 1XNQE 4DV5E 1IBME 1UILA 1RC7A 1N32E 4DR3E 4GKKE 2B3TB 4X65E 4LFCE 1PKPA 1WHNA 2RS7A 4JI6E 4B3SE 1XMQE 4LF8E 1FKAE 2LTSA 4DV7E 4LF7E 2DMYA 2LUQA 4GKJE 3C4TA 2LBSB 1YYOA 1IBKE 4LF9E 2LTRA 2EZ6A 4DR4E 1I94E 3T1HE 1HNWE 3C4BA 4LF4E 4DV1E 4B3TE 4YHHE 4YY3E 3VYXA 1N34E 4OX9E 3LLHA 1FJGE 2VQFE 4JI4E 4X62E 1T4LB 2DB2A 4X66E 4LFAE
chains in the Genus database with same CATH superfamily
3THOB 5CFFE 2UUBE 4BC9A 3JAMC 2M7QA 3P1XA 4ZYEA 1J5EE 4WPYA 2YSPA 4DMIA 2ZM6E 1X49A 1UBDC 2FV4B 5IXMB 2LO3A 2ENAA 2EMKA 2ELZA 2NUEA 4KHPE 4ZYDA 2LVHA 2ADRA 2EL6A 2CPNA 3ADGA 2EM2A 1JK2A 3KZYA 1WXRA 4R2RA 4DR2E 4LF6E 2EMBA 4O43A 2NUFA 1HR0E 4JI1E 2WZOA 1A1GA 1MEYC 1AH5A 5A6JA 2FTXB 1UHZA 4B3RE 2EOEA 2EMFA 2YTJA 2V86A 4WXDA 1J26A 2LRSA 1ZBTA 4WYQB 1YUJA 1N3GA 4P78A 2I9IA 2GHFA 2EOFA 2YPNA 4F54A 1B69A 2EN7A 2EN6A 4JI3E 4FK5C 2EOOA 2DIXA 3MSWA 2BBGA 3M99B 2YTFA 4DV4E 4Q35B 2EN8A 2E1MA 4JI7E 2L3JA 1DQ3A 3ADJA 1P47A 5A2QC 3UK3C 2WBTA 4JYAE 4BHCA 4DR5E 1ZAAC 3LMLA 2EMZA 4K0KE 2YRKA 1ZBQA 2EM3A 1Z1BA 2L33A 2EPLX 5A6AA 2E72A 2UXDE 1BBOA 4ZYHA 2GPIA 1IBME 4HEIA 2EQ0A 4BC7A 1TF3A 3FIGA 1RC7A 1N32E 2EMAA 4GKKE 4X65E 1WHNA 4B3SE 3EPJA 1FKAE 2LMZA 4M9VC 3C6MA 4Q28A 2LTRA 2YTNA 1I94E 2EPZA 2MDGA 2EM6A 3VYXA 1RMDA 1A1HA 4TUGA 2VQFE 1A1IA 2MKNA 3VK6A 1X6HA 2EQ3A 1X3CA 4X62E 1T4LB 2V89A 4X66E 1X6FA 3HQ1A 1YPNA 1XNRE 2EPXA 4BBYA 2M9AA 3TQMA 4DUZE 1BB8A 2JR1A 2K7IA 3J7AG 3QG5C 1MGTA 2NA2A 2EJ4A 2EMWA 2L8TA 4KWYA 4TUIA 1X48A 3EPKA 2EQ1A 1IMUA 4MLVA 4DR1E 2YT4A 5IT9C 1F2IG 1WRJA 1BBGA 4DUYE 2EL4A 4M2ZA 3IWDA 4ZYGA 2WBUA 3AV0A 2LJHA 1EKZA 3DF6A 1QU6A 2LT7A 1WHQA 2RPCA 1PJQA 4WXCA 1X47A 1A1LA 1STUA 2EMXA 4DV6E 2UU9E 3AUZA 1PJSA 2E5LE 2HC5A 4R2CA 4X8WA 1UN6B 2N3GA 2RSMA 4DV0E 2EN1A 2MC5A 2HHHE 2JY9A 3J7Yp 4L5NC 2EMIA 4R2QA 4IS1C 2L2KB 2HJJA 2EPPA 2L2MA 2LCEA 2EMGA 3H09A 1SFEA 1LLMC 4DR6E 4WSPA 2RS6A 2EPNA 5A69A 1RQ0A 4IJDA 3RMPA 3C6KA 3OMLA 2DLQA 1YYKA 3OTOE 3T1YE 1WJPA 5A6BA 4DR7E 2JP9A 4NXME 2V88A 4DV5E 1A1JA 1UILA 5T6JA 2K4VA 2YTIA 2R76A 3HXLA 2KONA 4BS9A 2B3TB 2D9HA 4JI6E 2L92A 2CTDA 4M0VA 1G2FC 1IQOA 1L4SA 2LTSA 4O5GA 2DMYA 1NCSA 2EM5A 2JWOA 3VHTB 2DSYA 3C4TA 4F2JC 2EOMA 2GLIA 3C4BA 4LF4E 1EH6A 2EPAA 2DGCA 4NHRA 5LL6R 5IV8B 2YU8A 4WX9A 1N34E 5KL7A 2F8BA 1TF6A 1EH7A 4JI4E 3BBGA 2WCC3 2EPUA 2EPKX 1ZU1A 5A6BD 4RHBB 2G7HA 5AE2A 2YTQA 4KZSA 4L8NA 4R2DA 1X5WA 1T4OA 2CSHA 1IQSA 2HGHA 4R03A 2M1SA 2JOBA 2V85A 2NUGA 4DV2E 2MDRA 2EPRA 4X9JA 4NXNE 2L3CA 1XMOE 4JV5E 2KHXA 2YTDA 4P7DA 4R2SA 3VYYA 5AE1A 5FLXC 4NZVA 2UUCE 1G2DC 5BR8E 2YRHA 2DRPA 1GZ6A 2IHR1 4F9AB 2EMCA 4LFBE 5AASA 2CT1A 5A6KA 2MKDA 1T39A 1IBLE 2EPMX 2EORA 4LF5E 2DMIA 2VRDA 2J7JA 2WBSA 2L2NA 2LJUA 1GTKA 2EMYA 1N36E 2KOUA 3KWRA 2Q8UA 4WFTA 4O4KA 5DNYA 3BIDA 2A25A 4JI8E 5AC5A 2EWLA 3L00A 1N33E 2YWQA 2EOZA 1SR9A 2PRTA 5KL3A 1XNQE 2EOSA 2NABA 1QNTA 2LV2A 2MC6A 1XMQE 2EN3A 5AC4A 4DV7E 4LF7E 3HPZA 2EM7A 5KL6A 2LUQA 4GKJE 3ZOQB 2YTEA 3MHSC 2LBSB 4LF9E 2EOXA 4R8OA 4F6NA 4DV1E 2L6MA 2H36X 4YHHE 4YY3E 4F6MA 1TN9A 2LE2A 2RQLA 2YRMA 2EE8A 2ENCA 2EM9A 4BMJA 2EP3A 3HPSA 2EN2A 4LFAE 5KL4A 2DLKA 3F6HA 2EOQA 1DGCA 2B7VA 2EPOA 5LLQA 2R1FA 4O24A 5TSEA 1GQEA 2EN4A 4F9CB 2RTXA 1YYWA 2UXBE 5IWAE 3KZZA 4AQYE 1PJTA 1KJKA 4N4RB 4M30A 3IWCA 2B7TA 2UXCE 3HTXA 4I8OA 1YZ9A 1NEIA 2B9DA 2EOJA 1HNZE 2YTPA 4RH8A 4J8ZA 3IWBA 1X6EA 2EPCA 2EMHA 4BHBA 2V87A 4R2EA 4DKKA 4GZNC 3F6GA 5AE3A 2N8XA 4MLQA 3J80C 4B3ME 3ADLA 1DI2A 2EM0A 1A1KA 4WSGA 2YU5A 2ENHA 1KYQA 1O0WA 1T38A 1EH8A 1ZR9A 2N3HA 4LTYA 3ADIA 5LMUE 2EM4A 2F4VE 2JOXA 2LUPB 1YUIA 3EPHA 3ECRA 2EMLA 2EL5A 4DV3E 2JVAA 5LMNE 1T4NA 1YSAC 2EOYA 4OOGC 3EPLA 2M4IA 2EM8A 4JI0E 4JI5E 1HNXE 4JI2E 2UUAE 3J81C 4X64E 2ODRC 2ODRD 2VQEE 1JK1A 4GEQB 4LU9A 3BF2A 1AAYA 3THNA 4DR3E 2V83A 3JTZA 2JPAA 1A1FA 4F9BB 4LFCE 3BGHA 1PKPA 2FGGA 2RS7A 2RSIA 2ELYA 4LF8E 2EOIA 3K6QA 5KL5A 2YTGA 3EQ1A 2JYAA 2YZTA 4R2AA 1YYOA 2YTOA 1IBKE 3DJWA 2YSOA 2EOHA 5KL2A 1PDAA 2EZ6A 4DR4E 3T1HE 4R2PA 1HNWE 4BCAA 4B3TE 2BB8A 5F3WA 3MHHC 4OX9E 1YFHA 3LLHA 1FJGE 4HTGA 2VF1A 2I13A 2JXPA 2DB2A 3JU0A 5ADZA 2VE7C 2V8QB
chains in the Genus database with same CATH topology
2G7HA 3HQ1A 5AE2A 1XNRE 5CFFE 4BBYA 3F6HA 4KZSA 4L8NA 2UUBE 4DUZE 2B7VA 2JR1A 1T4OA 3J7AG 4BC9A 3JAMC 2M7QA 3P1XA 1J5EE 4WPYA 4DMIA 2NA2A 4R03A 2M1SA 2ZM6E 1X49A 2FV4B 1GQEA 4F9CB 2RTXA 2L8TA 2JOBA 2NUEA 4KHPE 1YYWA 4TUIA 1X48A 2V85A 2NUGA 2UXBE 5IWAE 2CPNA 3ADGA 4DR1E 4AQYE 4DV2E 2MDRA 2YT4A 4M30A 5IT9C 3IWCA 2B7TA 2UXCE 3HTXA 1WXRA 4I8OA 4NXNE 4DUYE 1YZ9A 4DR2E 2B9DA 2L3CA 4LF6E 1XMOE 4JV5E 1HNZE 2NUFA 1HR0E 3IWDA 2KHXA 4JI1E 4M2ZA 2WZOA 4J8ZA 4P7DA 3IWBA 3VYYA 2FTXB 5AE1A 1UHZA 3AV0A 5FLXC 2LJHA 4B3RE 1EKZA 3DF6A 1QU6A 1WHQA 2V86A 2UUCE 1J26A 5BR8E 1X47A 2V87A 4DKKA 2LRSA 1GZ6A 1STUA 2IHR1 3F6GA 4F9AB 5AE3A 4DV6E 2UU9E 1ZBTA 3J80C 4B3ME 4WYQB 3AUZA 3ADLA 4LFBE 1DI2A 5AASA 2E5LE 4P78A 4X8WA 1IBLE 2N3GA 2RSMA 1O0WA 4DV0E 4F54A 4LF5E 2MC5A 2L2NA 2N3HA 4LTYA 2HHHE 4JI3E 2DIXA 3ADIA 2JY9A 3MSWA 4L5NC 3J7Yp 5LMUE 2F4VE 4DV4E 2JOXA 2L2KB 2LUPB 2L2MA 2E1MA 4JI7E 1N36E 3H09A 2L3JA 1DQ3A 4DR6E 2KOUA 3KWRA 4DV3E 2JVAA 4WSPA 3ADJA 2RS6A 4WFTA 5A2QC 1RQ0A 5LMNE 1T4NA 3RMPA 4JYAE 4DR5E 3OMLA 5DNYA 3LMLA 4OOGC 4K0KE 1ZBQA 2M4IA 1YYKA 4JI8E 3OTOE 4JI0E 2L33A 2EWLA 3T1YE 1HNXE 4JI5E 4JI2E 2UXDE 2UUAE 3J81C 1N33E 1SR9A 4X64E 2ODRC 4DR7E 2ODRD 2VQEE 4NXME 1XNQE 2V88A 4DV5E 4GEQB 4LU9A 1IBME 1UILA 4BC7A 5T6JA 2K4VA 3FIGA 1RC7A 1N32E 3HXLA 4DR3E 2V83A 3JTZA 2KONA 4BS9A 4GKKE 2B3TB 4F9BB 4X65E 4LFCE 1PKPA 1WHNA 2FGGA 2RS7A 4JI6E 2L92A 4B3SE 2MC6A 4M0VA 1XMQE 4LF8E 1FKAE 2LMZA 2LTSA 4DV7E 3K6QA 4LF7E 2DMYA 3HPZA 2JWOA 2LUQA 2DSYA 3C4TA 3ZOQB 4GKJE 2YZTA 4Q28A 2LBSB 1YYOA 1IBKE 4LF9E 3DJWA 2LTRA 2EZ6A 4R8OA 4DR4E 1I94E 3T1HE 1HNWE 3C4BA 4LF4E 4DV1E 2L6MA 4BCAA 4B3TE 2H36X 5LL6R 4YHHE 4YY3E 3VYXA 5F3WA 4TUGA 1N34E 4OX9E 3LLHA 1FJGE 2LE2A 2F8BA 2VQFE 4JI4E 3VK6A 4X62E 2VF1A 1T4LB 4BMJA 2DB2A 2V89A 3HPSA 3JU0A 4X66E 4LFAE 5ADZA 2VE7C 2V8QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR E;  5CFF E;  2UUB E;  4DUZ E;  2B7V A;  1T4O A;  3P1X A;  1J5E E;  2NA2 A;  2ZM6 E;  1X49 A;  1GQE A;  2RTX A;  2NUE A;  4KHP E;  1YYW A;  1X48 A;  2NUG A;  2UXB E;  5IWA E;  2CPN A;  3ADG A;  4DR1 E;  4AQY E;  4DV2 E;  2MDR A;  2YT4 A;  4M30 A;  2B7T A;  2UXC E;  3HTX A;  4NXN E;  4DUY E;  1YZ9 A;  4DR2 E;  2L3C A;  4LF6 E;  1XMO E;  4JV5 E;  1HNZ E;  2NUF A;  1HR0 E;  4JI1 E;  2KHX A;  4M2Z A;  3VYY A;  1UHZ A;  2LJH A;  4B3R E;  1EKZ A;  1QU6 A;  1WHQ A;  2UUC E;  1J26 A;  5BR8 E;  1X47 A;  4DKK A;  2LRS A;  1STU A;  2IHR 1;  4DV6 E;  2UU9 E;  1ZBT A;  4B3M E;  1DI2 A;  4WYQ B;  3ADL A;  4LFB E;  2E5L E;  4X8W A;  1IBL E;  2N3G A;  2RSM A;  1O0W A;  4DV0 E;  4LF5 E;  2L2N A;  2N3H A;  2HHH E;  4JI3 E;  2DIX A;  3ADI A;  2JY9 A;  3J7Y p;  5LMU E;  2F4V E;  4DV4 E;  2L2K B;  2LUP B;  2L2M A;  1N36 E;  4JI7 E;  2L3J A;  4DR6 E;  4DV3 E;  2JVA A;  3ADJ A;  2RS6 A;  4WFT A;  1RQ0 A;  5LMN E;  1T4N A;  4JYA E;  4DR5 E;  4OOG C;  4K0K E;  1YYK A;  4JI8 E;  3OTO E;  4JI0 E;  2L33 A;  3T1Y E;  1HNX E;  4JI5 E;  4JI2 E;  2UXD E;  2UUA E;  1N33 E;  4X64 E;  4DR7 E;  2VQE E;  4NXM E;  1XNQ E;  4DV5 E;  1IBM E;  1UIL A;  1RC7 A;  1N32 E;  4DR3 E;  4GKK E;  2B3T B;  4X65 E;  4LFC E;  1PKP A;  1WHN A;  2RS7 A;  4JI6 E;  4B3S E;  1XMQ E;  4LF8 E;  1FKA E;  2LTS A;  4DV7 E;  4LF7 E;  2DMY A;  2LUQ A;  4GKJ E;  3C4T A;  2LBS B;  1YYO A;  1IBK E;  4LF9 E;  2LTR A;  2EZ6 A;  4DR4 E;  1I94 E;  3T1H E;  1HNW E;  3C4B A;  4LF4 E;  4DV1 E;  4B3T E;  4YHH E;  4YY3 E;  3VYX A;  1N34 E;  4OX9 E;  3LLH A;  1FJG E;  2VQF E;  4JI4 E;  4X62 E;  1T4L B;  2DB2 A;  4X66 E;  4LFA E; 
#chains in the Genus database with same CATH topology
 3THO B;  5CFF E;  2UUB E;  4BC9 A;  3JAM C;  2M7Q A;  3P1X A;  4ZYE A;  1J5E E;  4WPY A;  2YSP A;  4DMI A;  2ZM6 E;  1X49 A;  1UBD C;  2FV4 B;  5IXM B;  2LO3 A;  2ENA A;  2EMK A;  2ELZ A;  2NUE A;  4KHP E;  4ZYD A;  2LVH A;  2ADR A;  2EL6 A;  2CPN A;  3ADG A;  2EM2 A;  1JK2 A;  3KZY A;  1WXR A;  4R2R A;  4DR2 E;  4LF6 E;  2EMB A;  4O43 A;  2NUF A;  1HR0 E;  4JI1 E;  2WZO A;  1A1G A;  1MEY C;  1AH5 A;  5A6J A;  2FTX B;  1UHZ A;  4B3R E;  2EOE A;  2EMF A;  2YTJ A;  2V86 A;  4WXD A;  1J26 A;  2LRS A;  1ZBT A;  4WYQ B;  1YUJ A;  1N3G A;  4P78 A;  2I9I A;  2GHF A;  2EOF A;  2YPN A;  4F54 A;  1B69 A;  2EN7 A;  2EN6 A;  4JI3 E;  4FK5 C;  2EOO A;  2DIX A;  3MSW A;  2BBG A;  3M99 B;  2YTF A;  4DV4 E;  4Q35 B;  2EN8 A;  2E1M A;  4JI7 E;  2L3J A;  1DQ3 A;  3ADJ A;  1P47 A;  5A2Q C;  3UK3 C;  2WBT A;  4JYA E;  4BHC A;  4DR5 E;  1ZAA C;  3LML A;  2EMZ A;  4K0K E;  2YRK A;  1ZBQ A;  2EM3 A;  1Z1B A;  2L33 A;  2EPL X;  5A6A A;  2E72 A;  2UXD E;  1BBO A;  4ZYH A;  2GPI A;  1IBM E;  4HEI A;  2EQ0 A;  4BC7 A;  1TF3 A;  3FIG A;  1RC7 A;  1N32 E;  2EMA A;  4GKK E;  4X65 E;  1WHN A;  4B3S E;  3EPJ A;  1FKA E;  2LMZ A;  4M9V C;  3C6M A;  4Q28 A;  2LTR A;  2YTN A;  1I94 E;  2EPZ A;  2MDG A;  2EM6 A;  3VYX A;  1RMD A;  1A1H A;  4TUG A;  2VQF E;  1A1I A;  2MKN A;  3VK6 A;  1X6H A;  2EQ3 A;  1X3C A;  4X62 E;  1T4L B;  2V89 A;  4X66 E;  1X6F A;  3HQ1 A;  1YPN A;  1XNR E;  2EPX A;  4BBY A;  2M9A A;  3TQM A;  4DUZ E;  1BB8 A;  2JR1 A;  2K7I A;  3J7A G;  3QG5 C;  1MGT A;  2NA2 A;  2EJ4 A;  2EMW A;  2L8T A;  4KWY A;  4TUI A;  1X48 A;  3EPK A;  2EQ1 A;  1IMU A;  4MLV A;  4DR1 E;  2YT4 A;  5IT9 C;  1F2I G;  1WRJ A;  1BBG A;  4DUY E;  2EL4 A;  4M2Z A;  3IWD A;  4ZYG A;  2WBU A;  3AV0 A;  2LJH A;  1EKZ A;  3DF6 A;  1QU6 A;  2LT7 A;  1WHQ A;  2RPC A;  1PJQ A;  4WXC A;  1X47 A;  1A1L A;  1STU A;  2EMX A;  4DV6 E;  2UU9 E;  3AUZ A;  1PJS A;  2E5L E;  2HC5 A;  4R2C A;  4X8W A;  1UN6 B;  2N3G A;  2RSM A;  4DV0 E;  2EN1 A;  2MC5 A;  2HHH E;  2JY9 A;  3J7Y p;  4L5N C;  2EMI A;  4R2Q A;  4IS1 C;  2L2K B;  2HJJ A;  2EPP A;  2L2M A;  2LCE A;  2EMG A;  3H09 A;  1SFE A;  1LLM C;  4DR6 E;  4WSP A;  2RS6 A;  2EPN A;  5A69 A;  1RQ0 A;  4IJD A;  3RMP A;  3C6K A;  3OML A;  2DLQ A;  1YYK A;  3OTO E;  3T1Y E;  1WJP A;  5A6B A;  4DR7 E;  2JP9 A;  4NXM E;  2V88 A;  4DV5 E;  1A1J A;  1UIL A;  5T6J A;  2K4V A;  2YTI A;  2R76 A;  3HXL A;  2KON A;  4BS9 A;  2B3T B;  2D9H A;  4JI6 E;  2L92 A;  2CTD A;  4M0V A;  1G2F C;  1IQO A;  1L4S A;  2LTS A;  4O5G A;  2DMY A;  1NCS A;  2EM5 A;  2JWO A;  3VHT B;  2DSY A;  3C4T A;  4F2J C;  2EOM A;  2GLI A;  3C4B A;  4LF4 E;  1EH6 A;  2EPA A;  2DGC A;  4NHR A;  5LL6 R;  5IV8 B;  2YU8 A;  4WX9 A;  1N34 E;  5KL7 A;  2F8B A;  1TF6 A;  1EH7 A;  4JI4 E;  3BBG A;  2WCC 3;  2EPU A;  2EPK X;  1ZU1 A;  5A6B D;  4RHB B;  2G7H A;  5AE2 A;  2YTQ A;  4KZS A;  4L8N A;  4R2D A;  1X5W A;  1T4O A;  2CSH A;  1IQS A;  2HGH A;  4R03 A;  2M1S A;  2JOB A;  2V85 A;  2NUG A;  4DV2 E;  2MDR A;  2EPR A;  4X9J A;  4NXN E;  2L3C A;  1XMO E;  4JV5 E;  2KHX A;  2YTD A;  4P7D A;  4R2S A;  3VYY A;  5AE1 A;  5FLX C;  4NZV A;  2UUC E;  1G2D C;  5BR8 E;  2YRH A;  2DRP A;  1GZ6 A;  2IHR 1;  4F9A B;  2EMC A;  4LFB E;  5AAS A;  2CT1 A;  5A6K A;  2MKD A;  1T39 A;  1IBL E;  2EPM X;  2EOR A;  4LF5 E;  2DMI A;  2VRD A;  2J7J A;  2WBS A;  2L2N A;  2LJU A;  1GTK A;  2EMY A;  1N36 E;  2KOU A;  3KWR A;  2Q8U A;  4WFT A;  4O4K A;  5DNY A;  3BID A;  2A25 A;  4JI8 E;  5AC5 A;  2EWL A;  3L00 A;  1N33 E;  2YWQ A;  2EOZ A;  1SR9 A;  2PRT A;  5KL3 A;  1XNQ E;  2EOS A;  2NAB A;  1QNT A;  2LV2 A;  2MC6 A;  1XMQ E;  2EN3 A;  5AC4 A;  4DV7 E;  4LF7 E;  3HPZ A;  2EM7 A;  5KL6 A;  2LUQ A;  4GKJ E;  3ZOQ B;  2YTE A;  3MHS C;  2LBS B;  4LF9 E;  2EOX A;  4R8O A;  4F6N A;  4DV1 E;  2L6M A;  2H36 X;  4YHH E;  4YY3 E;  4F6M A;  1TN9 A;  2LE2 A;  2RQL A;  2YRM A;  2EE8 A;  2ENC A;  2EM9 A;  4BMJ A;  2EP3 A;  3HPS A;  2EN2 A;  4LFA E;  5KL4 A;  2DLK A;  3F6H A;  2EOQ A;  1DGC A;  2B7V A;  2EPO A;  5LLQ A;  2R1F A;  4O24 A;  5TSE A;  1GQE A;  2EN4 A;  4F9C B;  2RTX A;  1YYW A;  2UXB E;  5IWA E;  3KZZ A;  4AQY E;  1PJT A;  1KJK A;  4N4R B;  4M30 A;  3IWC A;  2B7T A;  2UXC E;  3HTX A;  4I8O A;  1YZ9 A;  1NEI A;  2B9D A;  2EOJ A;  1HNZ E;  2YTP A;  4RH8 A;  4J8Z A;  3IWB A;  1X6E A;  2EPC A;  2EMH A;  4BHB A;  2V87 A;  4R2E A;  4DKK A;  4GZN C;  3F6G A;  5AE3 A;  2N8X A;  4MLQ A;  3J80 C;  4B3M E;  3ADL A;  1DI2 A;  2EM0 A;  1A1K A;  4WSG A;  2YU5 A;  2ENH A;  1KYQ A;  1O0W A;  1T38 A;  1EH8 A;  1ZR9 A;  2N3H A;  4LTY A;  3ADI A;  5LMU E;  2EM4 A;  2F4V E;  2JOX A;  2LUP B;  1YUI A;  3EPH A;  3ECR A;  2EML A;  2EL5 A;  4DV3 E;  2JVA A;  5LMN E;  1T4N A;  1YSA C;  2EOY A;  4OOG C;  3EPL A;  2M4I A;  2EM8 A;  4JI0 E;  4JI5 E;  1HNX E;  4JI2 E;  2UUA E;  3J81 C;  4X64 E;  2ODR C;  2ODR D;  2VQE E;  1JK1 A;  4GEQ B;  4LU9 A;  3BF2 A;  1AAY A;  3THN A;  4DR3 E;  2V83 A;  3JTZ A;  2JPA A;  1A1F A;  4F9B B;  4LFC E;  3BGH A;  1PKP A;  2FGG A;  2RS7 A;  2RSI A;  2ELY A;  4LF8 E;  2EOI A;  3K6Q A;  5KL5 A;  2YTG A;  3EQ1 A;  2JYA A;  2YZT A;  4R2A A;  1YYO A;  2YTO A;  1IBK E;  3DJW A;  2YSO A;  2EOH A;  5KL2 A;  1PDA A;  2EZ6 A;  4DR4 E;  3T1H E;  4R2P A;  1HNW E;  4BCA A;  4B3T E;  2BB8 A;  5F3W A;  3MHH C;  4OX9 E;  1YFH A;  3LLH A;  1FJG E;  4HTG A;  2VF1 A;  2I13 A;  2JXP A;  2DB2 A;  3JU0 A;  5ADZ A;  2VE7 C;  2V8Q B; 
#chains in the Genus database with same CATH homology
 2G7H A;  3HQ1 A;  5AE2 A;  1XNR E;  5CFF E;  4BBY A;  3F6H A;  4KZS A;  4L8N A;  2UUB E;  4DUZ E;  2B7V A;  2JR1 A;  1T4O A;  3J7A G;  4BC9 A;  3JAM C;  2M7Q A;  3P1X A;  1J5E E;  4WPY A;  4DMI A;  2NA2 A;  4R03 A;  2M1S A;  2ZM6 E;  1X49 A;  2FV4 B;  1GQE A;  4F9C B;  2RTX A;  2L8T A;  2JOB A;  2NUE A;  4KHP E;  1YYW A;  4TUI A;  1X48 A;  2V85 A;  2NUG A;  2UXB E;  5IWA E;  2CPN A;  3ADG A;  4DR1 E;  4AQY E;  4DV2 E;  2MDR A;  2YT4 A;  4M30 A;  5IT9 C;  3IWC A;  2B7T A;  2UXC E;  3HTX A;  1WXR A;  4I8O A;  4NXN E;  4DUY E;  1YZ9 A;  4DR2 E;  2B9D A;  2L3C A;  4LF6 E;  1XMO E;  4JV5 E;  1HNZ E;  2NUF A;  1HR0 E;  3IWD A;  2KHX A;  4JI1 E;  4M2Z A;  2WZO A;  4J8Z A;  4P7D A;  3IWB A;  3VYY A;  2FTX B;  5AE1 A;  1UHZ A;  3AV0 A;  5FLX C;  2LJH A;  4B3R E;  1EKZ A;  3DF6 A;  1QU6 A;  1WHQ A;  2V86 A;  2UUC E;  1J26 A;  5BR8 E;  1X47 A;  2V87 A;  4DKK A;  2LRS A;  1GZ6 A;  1STU A;  2IHR 1;  3F6G A;  4F9A B;  5AE3 A;  4DV6 E;  2UU9 E;  1ZBT A;  3J80 C;  4B3M E;  4WYQ B;  3AUZ A;  3ADL A;  4LFB E;  1DI2 A;  5AAS A;  2E5L E;  4P78 A;  4X8W A;  1IBL E;  2N3G A;  2RSM A;  1O0W A;  4DV0 E;  4F54 A;  4LF5 E;  2MC5 A;  2L2N A;  2N3H A;  4LTY A;  2HHH E;  4JI3 E;  2DIX A;  3ADI A;  2JY9 A;  3MSW A;  4L5N C;  3J7Y p;  5LMU E;  2F4V E;  4DV4 E;  2JOX A;  2L2K B;  2LUP B;  2L2M A;  2E1M A;  4JI7 E;  1N36 E;  3H09 A;  2L3J A;  1DQ3 A;  4DR6 E;  2KOU A;  3KWR A;  4DV3 E;  2JVA A;  4WSP A;  3ADJ A;  2RS6 A;  4WFT A;  5A2Q C;  1RQ0 A;  5LMN E;  1T4N A;  3RMP A;  4JYA E;  4DR5 E;  3OML A;  5DNY A;  3LML A;  4OOG C;  4K0K E;  1ZBQ A;  2M4I A;  1YYK A;  4JI8 E;  3OTO E;  4JI0 E;  2L33 A;  2EWL A;  3T1Y E;  1HNX E;  4JI5 E;  4JI2 E;  2UXD E;  2UUA E;  3J81 C;  1N33 E;  1SR9 A;  4X64 E;  2ODR C;  4DR7 E;  2ODR D;  2VQE E;  4NXM E;  1XNQ E;  2V88 A;  4DV5 E;  4GEQ B;  4LU9 A;  1IBM E;  1UIL A;  4BC7 A;  5T6J A;  2K4V A;  3FIG A;  1RC7 A;  1N32 E;  3HXL A;  4DR3 E;  2V83 A;  3JTZ A;  2KON A;  4BS9 A;  4GKK E;  2B3T B;  4F9B B;  4X65 E;  4LFC E;  1PKP A;  1WHN A;  2FGG A;  2RS7 A;  4JI6 E;  2L92 A;  4B3S E;  2MC6 A;  4M0V A;  1XMQ E;  4LF8 E;  1FKA E;  2LMZ A;  2LTS A;  4DV7 E;  3K6Q A;  4LF7 E;  2DMY A;  3HPZ A;  2JWO A;  2LUQ A;  2DSY A;  3C4T A;  3ZOQ B;  4GKJ E;  2YZT A;  4Q28 A;  2LBS B;  1YYO A;  1IBK E;  4LF9 E;  3DJW A;  2LTR A;  2EZ6 A;  4R8O A;  4DR4 E;  1I94 E;  3T1H E;  1HNW E;  3C4B A;  4LF4 E;  4DV1 E;  2L6M A;  4BCA A;  4B3T E;  2H36 X;  5LL6 R;  4YHH E;  4YY3 E;  3VYX A;  5F3W A;  4TUG A;  1N34 E;  4OX9 E;  3LLH A;  1FJG E;  2LE2 A;  2F8B A;  2VQF E;  4JI4 E;  3VK6 A;  4X62 E;  2VF1 A;  1T4L B;  4BMJ A;  2DB2 A;  2V89 A;  3HPS A;  3JU0 A;  4X66 E;  4LFA E;  5ADZ A;  2VE7 C;  2V8Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...