2B7VA

Structure of adar2 dsrbm2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
PSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific editase 1
publication title Structure and specific RNA binding of ADAR2 double-stranded RNA binding motifs.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 71
sequence length 71
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b7vA00
2JY9A 1YYWA 1XNQE 1IBME 4B3SE 4GKKE 4LF4E 3J7Yp 2RTXA 4JI4E 4JI0E 1EKZA 3ADIA 1N33E 4DV4E 4OOGC 4LF7E 1N36E 2B7TA 4JI6E 4X66E 4AQYE 1XNRE 4JI1E 4DR4E 1RQ0A 1HNXE 1UILA 4LF6E 4X62E 4OX9E 4LFBE 4JI2E 1YYKA 4GKJE 4KHPE 4DR3E 4B3TE 3ADGA 1N32E 1O0WA 4DV5E 3VYXA 2N3HA 2L33A 2UU9E 1X48A 4DV0E 1YZ9A 4JV5E 4JI8E 4DR6E 4WFTA 4JI3E 3HTXA 2UXDE 4YY3E 4LFAE 1UHZA 2LUQA 4DR2E 2N3GA 1PKPA 1IBLE 3ADLA 2CPNA 2JVAA 2LTSA 2LJHA 4K0KE 2VQEE 5LMUE 1X49A 2KHXA 4YHHE 2F4VE 2UUCE 4M30A 1WHNA 2LBSB 2IHR1 4X64E 2ZM6E 4DR5E 1I94E 2L3CA 1XMQE 2NUFA 1QU6A 4DR7E 2LRSA 1T4LB 1J26A 2RSMA 1X47A 4DUZE 1T4OA 1ZBTA 3C4TA 3T1HE 4NXNE 1DI2A 2B3TB 1HNWE 1T4NA 4WYQB 4M2ZA 2EZ6A 1IBKE 4DUYE 1FKAE 4NXME 1RC7A 2LTRA 4LF8E 1GQEA 2DIXA 4DV2E 2DMYA 4LFCE 1FJGE 2UUBE 1YYOA 4DKKA 2VQFE 4X8WA 5LMNE 2MDRA 4DV3E 3P1XA 2NUEA 2B7VA 1HNZE 4DV7E 4DR1E 4X65E 2RS6A 5CFFE 3C4BA 2NUGA 3VYYA 2HHHE 4DV6E 2L2MA 4DV1E 4B3RE 5BR8E 4B3ME 1J5EE 1HR0E 1XMOE 4JI5E 3ADJA 2L3JA 5IWAE 1STUA 3OTOE 1WHQA 1N34E 2DB2A 2UXCE 2RS7A 3T1YE 2UXBE 2E5LE 2L2KB 2UUAE 4LF5E 4JYAE 2YT4A 2NA2A 3LLHA 2LUPB 4LF9E 4JI7E 2L2NA
chains in the Genus database with same CATH superfamily
2EPCA 2JY9A 5IXMB 1XNQE 2EJ4A 5ADZA 4IS1C 3J7Yp 4R03A 3QG5C 1DGCA 4JI0E 1EKZA 3C6KA 1N33E 2EM4A 1A1GA 2B7TA 2VF1A 2NABA 3F6GA 5T6JA 4BC7A 4F2JC 4JI1E 2CT1A 1RQ0A 4M0VA 1UILA 4FK5C 4R2QA 5LL6R 4MLVA 4KHPE 2N8XA 3MHHC 3ADGA 1N32E 1O0WA 4BMJA 2N3HA 2GHFA 5FLXC 5KL2A 2KOUA 4WXDA 4JI8E 4LU9A 4DR6E 5DNYA 3HTXA 3HPZA 2YU5A 5KL3A 4R2SA 2LUQA 2EMZA 4F9BB 4DR2E 1P47A 2LJHA 2M9AA 3THOB 5AE1A 3KZZA 2EP3A 2WZOA 2KHXA 1YFHA 1F2IG 2RSIA 4IJDA 5AE3A 2G7HA 3ZOQB 2IHR1 2ZM6E 2YTGA 2LT7A 2L3CA 2M7QA 2EN6A 2BBGA 5AE2A 2EQ0A 2EOEA 1A1KA 5LLQA 1ZBTA 3T1HE 2V8QB 2JWOA 4P7DA 1T4NA 3OMLA 2EOZA 1IBKE 4F54A 4LF8E 2EOMA 5AC4A 4WPYA 2MDGA 2VQFE 5A6BD 2HC5A 5LMNE 2EM2A 1GTKA 2EM3A 4DV3E 4WSGA 4DMIA 1G2DC 1X6FA 2L2MA 4DV1E 4B3RE 5BR8E 2EMKA 1SFEA 2EM5A 2EPNA 2CSHA 2DB2A 2UXCE 3T1YE 3H09A 2E5LE 4M9VC 4JYAE 2YT4A 4ZYEA 2NA2A 2EMLA 2LUPB 1WJPA 4LF9E 3ADJA 3L00A 1YUIA 1YYWA 2MKNA 4GKKE 2E1MA 3HXLA 4JI4E 3HPSA 4DV4E 4OOGC 2YU8A 4JI6E 2V85A 2LCEA 4X66E 2EMBA 4F6MA 4DR4E 4R2CA 2DGCA 1RMDA 2EN7A 1HNXE 1X3CA 2JXPA 2FGGA 4LF6E 3J7AG 4OX9E 4GKJE 4DR3E 2EPZA 4DV5E 3VYXA 1X6EA 2ENCA 1X6HA 1X48A 3DF6A 4JV5E 2JP9A 3TQMA 4R2DA 2M4IA 5TSEA 2EN1A 2UXDE 2ODRC 5IV8B 1PKPA 2JVAA 2EPLX 2EN3A 2LTSA 2YRHA 3BF2A 3EPLA 1UBDC 2VQEE 5LMUE 2GLIA 2YTDA 2YWQA 2EQ3A 1A1LA 1WHNA 2LBSB 3JAMC 1IMUA 2EL4A 2HJJA 2KONA 2WBUA 1XMQE 1T39A 1A1FA 4Q35B 1TF3A 2LRSA 4DR7E 3BIDA 1T4LB 2I13A 1J26A 2WBSA 1X47A 4O4KA 3J80C 2B3TB 4RH8A 1HNWE 1WRJA 2EM9A 2EOIA 4DUYE 4NXME 1EH8A 4DV2E 2DMYA 1FJGE 2R76A 5A2QC 4DKKA 1YYOA 5AASA 4TUIA 2MDRA 1LLMC 1IQOA 3P1XA 4F9AB 1HNZE 5A6JA 2RS6A 3DJWA 5CFFE 3C4BA 4TUGA 3VYYA 4R2EA 4O43A 1PJQA 1XMOE 1NEIA 2L3JA 3MHSC 3EPKA 4BHCA 2EMCA 1N34E 2RQLA 4O5GA 2DLKA 1AH5A 1UN6B 4O24A 2JOXA 3LLHA 3HQ1A 4JI7E 2A25A 3C6MA 2DRPA 3JTZA 1IBME 4LF4E 1IQSA 2EPMX 2RTXA 2FTXB 3BGHA 3ADIA 1ZU1A 4LF7E 2GPIA 2BB8A 1PJTA 2EPPA 2YTOA 4AQYE 2ODRD 3J81C 5IT9C 2EN8A 2YTIA 4GZNC 4HTGA 4X62E 2YPNA 4LFBE 1WXRA 4JI2E 1YYKA 2EWLA 1BB8A 2ELZA 2MC6A 4WSPA 2YSPA 4BHBA 4B3TE 4GEQB 3MSWA 4X9JA 1AAYA 2L33A 2HGHA 2UU9E 5KL4A 4DV0E 1JK1A 3EQ1A 1YZ9A 2EORA 2ENAA 2D9HA 4WFTA 1MGTA 2EL6A 1ZR9A 1DQ3A 1IBLE 2YTPA 2CPNA 2V88A 2EQ1A 2YTFA 4LTYA 3K6QA 4K0KE 3KZYA 4ZYGA 2F4VE 1A1IA 2EL5A 2EPAA 1ZAAC 3F6HA 4X64E 2EM0A 1ZBQA 5AC5A 4RHBB 4BCAA 5KL6A 4DR5E 2H36X 2YRKA 2L6MA 1A1HA 2EOHA 1L4SA 4L8NA 3VK6A 4DUZE 1T4OA 2EMWA 3C4TA 1MEYC 4NXNE 4J8ZA 2EOSA 2EPUA 3IWCA 1KYQA 5KL7A 4WYQB 4WX9A 5A6KA 2K7IA 1QNTA 2EMFA 1YSAC 5F3WA 2RPCA 1X5WA 2MKDA 3JU0A 2MC5A 2B9DA 1YUJA 2NUEA 2EPXA 4X65E 3IWBA 2F8BA 2NUGA 2EMYA 2HHHE 2EMHA 4ZYHA 5A6AA 1B69A 1J5EE 4JI5E 2DLQA 2EOQA 4R2RA 1Z1BA 1G2FC 2UUAE 2UXBE 2L92A 4LF5E 1A1JA 3KWRA 2E72A 2WCC3 4F9CB 2L2NA 2V83A 4Q28A 2JYAA 3EPHA 4B3SE 2EMXA 4MLQA 2ENHA 1GZ6A 2DSYA 2L8TA 2PRTA 1N36E 2EM6A 1XNRE 4F6NA 1TF6A 2EOOA 2WBTA 2V89A 3AUZA 4N4RB 1T38A 2EOYA 3EPJA 3LMLA 1EH7A 5KL5A 2YTNA 2LMZA 4KZSA 2VRDA 3BBGA 2EN2A 4WXCA 4BS9A 1SR9A 2Q8UA 4JI3E 2FV4B 4YY3E 2EM8A 4LFAE 1UHZA 1TN9A 5A6BA 2LO3A 2N3GA 2ADRA 3ADLA 3M99B 1PJSA 2DMIA 3IWDA 2JOBA 2LE2A 2EMAA 1X49A 2EE8A 4YHHE 4BC9A 4ZYDA 3FIGA 4M30A 2UUCE 2EPOA 2V86A 2V87A 5A69A 1I94E 2YSOA 4I8OA 1QU6A 2EOXA 2NUFA 4R8OA 2LVHA 2LV2A 1NCSA 1BBGA 2J7JA 3RMPA 2R1FA 2RSMA 2EPKX 4HEIA 1DI2A 2LJUA 2EOJA 4P78A 1JK2A 1YPNA 3ECRA 1KJKA 4NHRA 2JR1A 4M2ZA 2EZ6A 2VE7C 1FKAE 1RC7A 2LTRA 2EMIA 1GQEA 2DIXA 2EMGA 2K4VA 2M1SA 4LFCE 4L5NC 2UUBE 2EN4A 2EPRA 4X8WA 4BBYA 2YTEA 2B7VA 4DV7E 4NZVA 4DR1E 4DV6E 2I9IA 2YZTA 4R2PA 4B3ME 2EOFA 1HR0E 2YTQA 1EH6A 2CTDA 5IWAE 1STUA 2ELYA 3AV0A 3OTOE 1WHQA 2YTJA 1N3GA 2RS7A 3UK3C 2YRMA 2L2KB 1BBOA 2EM7A 2JPAA 3VHTB 3THNA 4R2AA 1PDAA 4KWYA
chains in the Genus database with same CATH topology
2V83A 4Q28A 2JY9A 1YYWA 3JTZA 1XNQE 1IBME 4B3SE 2NUGA 4GKKE 5ADZA 4LF4E 3J7Yp 4R03A 2E1MA 2RTXA 2FTXB 3HXLA 1GZ6A 2DSYA 2L8TA 1EKZA 4JI0E 3HPSA 4JI4E 3ADIA 4DV4E 4OOGC 4LF7E 1N33E 1N36E 2B7TA 4JI6E 2VF1A 2V85A 3F6GA 5T6JA 4X66E 4BC7A 4AQYE 1XNRE 4JI1E 4DR4E 2ODRD 3J81C 5IT9C 2V89A 3AUZA 1RQ0A 1HNXE 4M0VA 1UILA 2FGGA 4X62E 4LF6E 5LL6R 4OX9E 1WXRA 3J7AG 4JI2E 1YYKA 4GKJE 2EWLA 3LMLA 2MC6A 4WSPA 4KHPE 4DR3E 4B3TE 4GEQB 3ADGA 2LMZA 1O0WA 3MSWA 4KZSA 4BMJA 4DV5E 2N3HA 1N32E 3VYXA 4LFBE 2L33A 5FLXC 1X48A 2UU9E 4DV0E 3DF6A 1YZ9A 4JV5E 2KOUA 4JI8E 4BS9A 4LU9A 1SR9A 4DR6E 4WFTA 2M4IA 4JI3E 5DNYA 2FV4B 3HPZA 3HTXA 2UXDE 4YY3E 4LFAE 1UHZA 2LUQA 2ODRC 4F9BB 4DR2E 2N3GA 1DQ3A 1PKPA 1IBLE 2V88A 2CPNA 2JVAA 3ADLA 2LTSA 2LJHA 4LTYA 3K6QA 3IWDA 5AE1A 2JOBA 2LE2A 4K0KE 2WZOA 2VQEE 5LMUE 1X49A 2KHXA 4YHHE 4BC9A 2F4VE 5AE3A 3FIGA 4M30A 2UUCE 2V86A 1WHNA 2G7HA 3ZOQB 2LBSB 3F6HA 2IHR1 2V87A 4X64E 1ZBQA 3JAMC 4BCAA 2ZM6E 2KONA 4DR5E 1I94E 2H36X 2L3CA 1XMQE 2M7QA 4I8OA 1QU6A 2L6MA 2NUFA 4R8OA 5AE2A 4DR7E 2LRSA 1T4LB 3RMPA 4L8NA 1J26A 2RSMA 3VK6A 1X47A 4DUZE 1T4OA 1ZBTA 3C4TA 2V8QB 3T1HE 3J80C 4NXNE 1DI2A 2B3TB 4J8ZA 2JWOA 4P78A 1HNWE 3IWCA 4P7DA 1T4NA 4WYQB 2JR1A 4M2ZA 3OMLA 2EZ6A 2VE7C 1IBKE 4DUYE 1FKAE 4NXME 1RC7A 2LTRA 4F54A 4LF8E 1GQEA 2DIXA 2K4VA 2M1SA 2DMYA 4DV2E 4LFCE 1FJGE 4L5NC 2UUBE 4WPYA 5F3WA 5A2QC 4DKKA 1YYOA 5AASA 2VQFE 3JU0A 4X8WA 4TUIA 2MC5A 4BBYA 5LMNE 2B9DA 2MDRA 4DV3E 3P1XA 4F9AB 2B7VA 1HNZE 2NUEA 4DV7E 4DR1E 4DMIA 4X65E 3IWBA 2RS6A 3DJWA 2F8BA 3C4BA 5CFFE 4TUGA 3VYYA 2HHHE 4DV6E 2L2MA 2YZTA 4DV1E 4B3RE 5BR8E 4B3ME 4LF9E 1J5EE 1HR0E 1XMOE 4JI5E 2L3JA 5IWAE 1STUA 3AV0A 3OTOE 1WHQA 4JI7E 1N34E 2DB2A 2UXCE 2RS7A 3T1YE 2UXBE 3H09A 2L2KB 2L92A 2E5LE 2UUAE 4LF5E 4JYAE 2YT4A 2JOXA 2NA2A 3KWRA 3LLHA 2LUPB 3HQ1A 3ADJA 4F9CB 2L2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY9 A;  1YYW A;  1XNQ E;  1IBM E;  4B3S E;  4GKK E;  4LF4 E;  3J7Y p;  2RTX A;  4JI4 E;  4JI0 E;  1EKZ A;  3ADI A;  1N33 E;  4DV4 E;  4OOG C;  4LF7 E;  1N36 E;  2B7T A;  4JI6 E;  4X66 E;  4AQY E;  1XNR E;  4JI1 E;  4DR4 E;  1RQ0 A;  1HNX E;  1UIL A;  4LF6 E;  4X62 E;  4OX9 E;  4LFB E;  4JI2 E;  1YYK A;  4GKJ E;  4KHP E;  4DR3 E;  4B3T E;  3ADG A;  1N32 E;  1O0W A;  4DV5 E;  3VYX A;  2N3H A;  2L33 A;  2UU9 E;  1X48 A;  4DV0 E;  1YZ9 A;  4JV5 E;  4JI8 E;  4DR6 E;  4WFT A;  4JI3 E;  3HTX A;  2UXD E;  4YY3 E;  4LFA E;  1UHZ A;  2LUQ A;  4DR2 E;  2N3G A;  1PKP A;  1IBL E;  3ADL A;  2CPN A;  2JVA A;  2LTS A;  2LJH A;  4K0K E;  2VQE E;  5LMU E;  1X49 A;  2KHX A;  4YHH E;  2F4V E;  2UUC E;  4M30 A;  1WHN A;  2LBS B;  2IHR 1;  4X64 E;  2ZM6 E;  4DR5 E;  1I94 E;  2L3C A;  1XMQ E;  2NUF A;  1QU6 A;  4DR7 E;  2LRS A;  1T4L B;  1J26 A;  2RSM A;  1X47 A;  4DUZ E;  1T4O A;  1ZBT A;  3C4T A;  3T1H E;  4NXN E;  1DI2 A;  2B3T B;  1HNW E;  1T4N A;  4WYQ B;  4M2Z A;  2EZ6 A;  1IBK E;  4DUY E;  1FKA E;  4NXM E;  1RC7 A;  2LTR A;  4LF8 E;  1GQE A;  2DIX A;  4DV2 E;  2DMY A;  4LFC E;  1FJG E;  2UUB E;  1YYO A;  4DKK A;  2VQF E;  4X8W A;  5LMN E;  2MDR A;  4DV3 E;  3P1X A;  2NUE A;  2B7V A;  1HNZ E;  4DV7 E;  4DR1 E;  4X65 E;  2RS6 A;  5CFF E;  3C4B A;  2NUG A;  3VYY A;  2HHH E;  4DV6 E;  2L2M A;  4DV1 E;  4B3R E;  5BR8 E;  4B3M E;  1J5E E;  1HR0 E;  1XMO E;  4JI5 E;  3ADJ A;  2L3J A;  5IWA E;  1STU A;  3OTO E;  1WHQ A;  1N34 E;  2DB2 A;  2UXC E;  2RS7 A;  3T1Y E;  2UXB E;  2E5L E;  2L2K B;  2UUA E;  4LF5 E;  4JYA E;  2YT4 A;  2NA2 A;  3LLH A;  2LUP B;  4LF9 E;  4JI7 E;  2L2N A; 
#chains in the Genus database with same CATH topology
 2EPC A;  2JY9 A;  5IXM B;  1XNQ E;  2EJ4 A;  5ADZ A;  4IS1 C;  3J7Y p;  4R03 A;  3QG5 C;  1DGC A;  4JI0 E;  1EKZ A;  3C6K A;  1N33 E;  2EM4 A;  1A1G A;  2B7T A;  2VF1 A;  2NAB A;  3F6G A;  5T6J A;  4BC7 A;  4F2J C;  4JI1 E;  2CT1 A;  1RQ0 A;  4M0V A;  1UIL A;  4FK5 C;  4R2Q A;  5LL6 R;  4MLV A;  4KHP E;  2N8X A;  3MHH C;  3ADG A;  1N32 E;  1O0W A;  4BMJ A;  2N3H A;  2GHF A;  5FLX C;  5KL2 A;  2KOU A;  4WXD A;  4JI8 E;  4LU9 A;  4DR6 E;  5DNY A;  3HTX A;  3HPZ A;  2YU5 A;  5KL3 A;  4R2S A;  2LUQ A;  2EMZ A;  4F9B B;  4DR2 E;  1P47 A;  2LJH A;  2M9A A;  3THO B;  5AE1 A;  3KZZ A;  2EP3 A;  2WZO A;  2KHX A;  1YFH A;  1F2I G;  2RSI A;  4IJD A;  5AE3 A;  2G7H A;  3ZOQ B;  2IHR 1;  2ZM6 E;  2YTG A;  2LT7 A;  2L3C A;  2M7Q A;  2EN6 A;  2BBG A;  5AE2 A;  2EQ0 A;  2EOE A;  1A1K A;  5LLQ A;  1ZBT A;  3T1H E;  2V8Q B;  2JWO A;  4P7D A;  1T4N A;  3OML A;  2EOZ A;  1IBK E;  4F54 A;  4LF8 E;  2EOM A;  5AC4 A;  4WPY A;  2MDG A;  2VQF E;  5A6B D;  2HC5 A;  5LMN E;  2EM2 A;  1GTK A;  2EM3 A;  4DV3 E;  4WSG A;  4DMI A;  1G2D C;  1X6F A;  2L2M A;  4DV1 E;  4B3R E;  5BR8 E;  2EMK A;  1SFE A;  2EM5 A;  2EPN A;  2CSH A;  2DB2 A;  2UXC E;  3T1Y E;  3H09 A;  2E5L E;  4M9V C;  4JYA E;  2YT4 A;  4ZYE A;  2NA2 A;  2EML A;  2LUP B;  1WJP A;  4LF9 E;  3ADJ A;  3L00 A;  1YUI A;  1YYW A;  2MKN A;  4GKK E;  2E1M A;  3HXL A;  4JI4 E;  3HPS A;  4DV4 E;  4OOG C;  2YU8 A;  4JI6 E;  2V85 A;  2LCE A;  4X66 E;  2EMB A;  4F6M A;  4DR4 E;  4R2C A;  2DGC A;  1RMD A;  2EN7 A;  1HNX E;  1X3C A;  2JXP A;  2FGG A;  4LF6 E;  3J7A G;  4OX9 E;  4GKJ E;  4DR3 E;  2EPZ A;  4DV5 E;  3VYX A;  1X6E A;  2ENC A;  1X6H A;  1X48 A;  3DF6 A;  4JV5 E;  2JP9 A;  3TQM A;  4R2D A;  2M4I A;  5TSE A;  2EN1 A;  2UXD E;  2ODR C;  5IV8 B;  1PKP A;  2JVA A;  2EPL X;  2EN3 A;  2LTS A;  2YRH A;  3BF2 A;  3EPL A;  1UBD C;  2VQE E;  5LMU E;  2GLI A;  2YTD A;  2YWQ A;  2EQ3 A;  1A1L A;  1WHN A;  2LBS B;  3JAM C;  1IMU A;  2EL4 A;  2HJJ A;  2KON A;  2WBU A;  1XMQ E;  1T39 A;  1A1F A;  4Q35 B;  1TF3 A;  2LRS A;  4DR7 E;  3BID A;  1T4L B;  2I13 A;  1J26 A;  2WBS A;  1X47 A;  4O4K A;  3J80 C;  2B3T B;  4RH8 A;  1HNW E;  1WRJ A;  2EM9 A;  2EOI A;  4DUY E;  4NXM E;  1EH8 A;  4DV2 E;  2DMY A;  1FJG E;  2R76 A;  5A2Q C;  4DKK A;  1YYO A;  5AAS A;  4TUI A;  2MDR A;  1LLM C;  1IQO A;  3P1X A;  4F9A B;  1HNZ E;  5A6J A;  2RS6 A;  3DJW A;  5CFF E;  3C4B A;  4TUG A;  3VYY A;  4R2E A;  4O43 A;  1PJQ A;  1XMO E;  1NEI A;  2L3J A;  3MHS C;  3EPK A;  4BHC A;  2EMC A;  1N34 E;  2RQL A;  4O5G A;  2DLK A;  1AH5 A;  1UN6 B;  4O24 A;  2JOX A;  3LLH A;  3HQ1 A;  4JI7 E;  2A25 A;  3C6M A;  2DRP A;  3JTZ A;  1IBM E;  4LF4 E;  1IQS A;  2EPM X;  2RTX A;  2FTX B;  3BGH A;  3ADI A;  1ZU1 A;  4LF7 E;  2GPI A;  2BB8 A;  1PJT A;  2EPP A;  2YTO A;  4AQY E;  2ODR D;  3J81 C;  5IT9 C;  2EN8 A;  2YTI A;  4GZN C;  4HTG A;  4X62 E;  2YPN A;  4LFB E;  1WXR A;  4JI2 E;  1YYK A;  2EWL A;  1BB8 A;  2ELZ A;  2MC6 A;  4WSP A;  2YSP A;  4BHB A;  4B3T E;  4GEQ B;  3MSW A;  4X9J A;  1AAY A;  2L33 A;  2HGH A;  2UU9 E;  5KL4 A;  4DV0 E;  1JK1 A;  3EQ1 A;  1YZ9 A;  2EOR A;  2ENA A;  2D9H A;  4WFT A;  1MGT A;  2EL6 A;  1ZR9 A;  1DQ3 A;  1IBL E;  2YTP A;  2CPN A;  2V88 A;  2EQ1 A;  2YTF A;  4LTY A;  3K6Q A;  4K0K E;  3KZY A;  4ZYG A;  2F4V E;  1A1I A;  2EL5 A;  2EPA A;  1ZAA C;  3F6H A;  4X64 E;  2EM0 A;  1ZBQ A;  5AC5 A;  4RHB B;  4BCA A;  5KL6 A;  4DR5 E;  2H36 X;  2YRK A;  2L6M A;  1A1H A;  2EOH A;  1L4S A;  4L8N A;  3VK6 A;  4DUZ E;  1T4O A;  2EMW A;  3C4T A;  1MEY C;  4NXN E;  4J8Z A;  2EOS A;  2EPU A;  3IWC A;  1KYQ A;  5KL7 A;  4WYQ B;  4WX9 A;  5A6K A;  2K7I A;  1QNT A;  2EMF A;  1YSA C;  5F3W A;  2RPC A;  1X5W A;  2MKD A;  3JU0 A;  2MC5 A;  2B9D A;  1YUJ A;  2NUE A;  2EPX A;  4X65 E;  3IWB A;  2F8B A;  2NUG A;  2EMY A;  2HHH E;  2EMH A;  4ZYH A;  5A6A A;  1B69 A;  1J5E E;  4JI5 E;  2DLQ A;  2EOQ A;  4R2R A;  1Z1B A;  1G2F C;  2UUA E;  2UXB E;  2L92 A;  4LF5 E;  1A1J A;  3KWR A;  2E72 A;  2WCC 3;  4F9C B;  2L2N A;  2V83 A;  4Q28 A;  2JYA A;  3EPH A;  4B3S E;  2EMX A;  4MLQ A;  2ENH A;  1GZ6 A;  2DSY A;  2L8T A;  2PRT A;  1N36 E;  2EM6 A;  1XNR E;  4F6N A;  1TF6 A;  2EOO A;  2WBT A;  2V89 A;  3AUZ A;  4N4R B;  1T38 A;  2EOY A;  3EPJ A;  3LML A;  1EH7 A;  5KL5 A;  2YTN A;  2LMZ A;  4KZS A;  2VRD A;  3BBG A;  2EN2 A;  4WXC A;  4BS9 A;  1SR9 A;  2Q8U A;  4JI3 E;  2FV4 B;  4YY3 E;  2EM8 A;  4LFA E;  1UHZ A;  1TN9 A;  5A6B A;  2LO3 A;  2N3G A;  2ADR A;  3ADL A;  3M99 B;  1PJS A;  2DMI A;  3IWD A;  2JOB A;  2LE2 A;  2EMA A;  1X49 A;  2EE8 A;  4YHH E;  4BC9 A;  4ZYD A;  3FIG A;  4M30 A;  2UUC E;  2EPO A;  2V86 A;  2V87 A;  5A69 A;  1I94 E;  2YSO A;  4I8O A;  1QU6 A;  2EOX A;  2NUF A;  4R8O A;  2LVH A;  2LV2 A;  1NCS A;  1BBG A;  2J7J A;  3RMP A;  2R1F A;  2RSM A;  2EPK X;  4HEI A;  1DI2 A;  2LJU A;  2EOJ A;  4P78 A;  1JK2 A;  1YPN A;  3ECR A;  1KJK A;  4NHR A;  2JR1 A;  4M2Z A;  2EZ6 A;  2VE7 C;  1FKA E;  1RC7 A;  2LTR A;  2EMI A;  1GQE A;  2DIX A;  2EMG A;  2K4V A;  2M1S A;  4LFC E;  4L5N C;  2UUB E;  2EN4 A;  2EPR A;  4X8W A;  4BBY A;  2YTE A;  2B7V A;  4DV7 E;  4NZV A;  4DR1 E;  4DV6 E;  2I9I A;  2YZT A;  4R2P A;  4B3M E;  2EOF A;  1HR0 E;  2YTQ A;  1EH6 A;  2CTD A;  5IWA E;  1STU A;  2ELY A;  3AV0 A;  3OTO E;  1WHQ A;  2YTJ A;  1N3G A;  2RS7 A;  3UK3 C;  2YRM A;  2L2K B;  1BBO A;  2EM7 A;  2JPA A;  3VHT B;  3THN A;  4R2A A;  1PDA A;  4KWY A; 
#chains in the Genus database with same CATH homology
 2V83 A;  4Q28 A;  2JY9 A;  1YYW A;  3JTZ A;  1XNQ E;  1IBM E;  4B3S E;  2NUG A;  4GKK E;  5ADZ A;  4LF4 E;  3J7Y p;  4R03 A;  2E1M A;  2RTX A;  2FTX B;  3HXL A;  1GZ6 A;  2DSY A;  2L8T A;  1EKZ A;  4JI0 E;  3HPS A;  4JI4 E;  3ADI A;  4DV4 E;  4OOG C;  4LF7 E;  1N33 E;  1N36 E;  2B7T A;  4JI6 E;  2VF1 A;  2V85 A;  3F6G A;  5T6J A;  4X66 E;  4BC7 A;  4AQY E;  1XNR E;  4JI1 E;  4DR4 E;  2ODR D;  3J81 C;  5IT9 C;  2V89 A;  3AUZ A;  1RQ0 A;  1HNX E;  4M0V A;  1UIL A;  2FGG A;  4X62 E;  4LF6 E;  5LL6 R;  4OX9 E;  1WXR A;  3J7A G;  4JI2 E;  1YYK A;  4GKJ E;  2EWL A;  3LML A;  2MC6 A;  4WSP A;  4KHP E;  4DR3 E;  4B3T E;  4GEQ B;  3ADG A;  2LMZ A;  1O0W A;  3MSW A;  4KZS A;  4BMJ A;  4DV5 E;  2N3H A;  1N32 E;  3VYX A;  4LFB E;  2L33 A;  5FLX C;  1X48 A;  2UU9 E;  4DV0 E;  3DF6 A;  1YZ9 A;  4JV5 E;  2KOU A;  4JI8 E;  4BS9 A;  4LU9 A;  1SR9 A;  4DR6 E;  4WFT A;  2M4I A;  4JI3 E;  5DNY A;  2FV4 B;  3HPZ A;  3HTX A;  2UXD E;  4YY3 E;  4LFA E;  1UHZ A;  2LUQ A;  2ODR C;  4F9B B;  4DR2 E;  2N3G A;  1DQ3 A;  1PKP A;  1IBL E;  2V88 A;  2CPN A;  2JVA A;  3ADL A;  2LTS A;  2LJH A;  4LTY A;  3K6Q A;  3IWD A;  5AE1 A;  2JOB A;  2LE2 A;  4K0K E;  2WZO A;  2VQE E;  5LMU E;  1X49 A;  2KHX A;  4YHH E;  4BC9 A;  2F4V E;  5AE3 A;  3FIG A;  4M30 A;  2UUC E;  2V86 A;  1WHN A;  2G7H A;  3ZOQ B;  2LBS B;  3F6H A;  2IHR 1;  2V87 A;  4X64 E;  1ZBQ A;  3JAM C;  4BCA A;  2ZM6 E;  2KON A;  4DR5 E;  1I94 E;  2H36 X;  2L3C A;  1XMQ E;  2M7Q A;  4I8O A;  1QU6 A;  2L6M A;  2NUF A;  4R8O A;  5AE2 A;  4DR7 E;  2LRS A;  1T4L B;  3RMP A;  4L8N A;  1J26 A;  2RSM A;  3VK6 A;  1X47 A;  4DUZ E;  1T4O A;  1ZBT A;  3C4T A;  2V8Q B;  3T1H E;  3J80 C;  4NXN E;  1DI2 A;  2B3T B;  4J8Z A;  2JWO A;  4P78 A;  1HNW E;  3IWC A;  4P7D A;  1T4N A;  4WYQ B;  2JR1 A;  4M2Z A;  3OML A;  2EZ6 A;  2VE7 C;  1IBK E;  4DUY E;  1FKA E;  4NXM E;  1RC7 A;  2LTR A;  4F54 A;  4LF8 E;  1GQE A;  2DIX A;  2K4V A;  2M1S A;  2DMY A;  4DV2 E;  4LFC E;  1FJG E;  4L5N C;  2UUB E;  4WPY A;  5F3W A;  5A2Q C;  4DKK A;  1YYO A;  5AAS A;  2VQF E;  3JU0 A;  4X8W A;  4TUI A;  2MC5 A;  4BBY A;  5LMN E;  2B9D A;  2MDR A;  4DV3 E;  3P1X A;  4F9A B;  2B7V A;  1HNZ E;  2NUE A;  4DV7 E;  4DR1 E;  4DMI A;  4X65 E;  3IWB A;  2RS6 A;  3DJW A;  2F8B A;  3C4B A;  5CFF E;  4TUG A;  3VYY A;  2HHH E;  4DV6 E;  2L2M A;  2YZT A;  4DV1 E;  4B3R E;  5BR8 E;  4B3M E;  4LF9 E;  1J5E E;  1HR0 E;  1XMO E;  4JI5 E;  2L3J A;  5IWA E;  1STU A;  3AV0 A;  3OTO E;  1WHQ A;  4JI7 E;  1N34 E;  2DB2 A;  2UXC E;  2RS7 A;  3T1Y E;  2UXB E;  3H09 A;  2L2K B;  2L92 A;  2E5L E;  2UUA E;  4LF5 E;  4JYA E;  2YT4 A;  2JOX A;  2NA2 A;  3KWR A;  3LLH A;  2LUP B;  3HQ1 A;  3ADJ A;  4F9C B;  2L2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...