2B7VA

Structure of adar2 dsrbm2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
PSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and specific RNA binding of ADAR2 double-stranded RNA binding motifs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific editase 1
total genus 21
structure length 71
sequence length 71
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b7vA00
1ZBTA 2UUCE 4X64E 1WHQA 2L33A 2F4VE 2B3TB 2HHHE 1IBKE 5CFFE 4LF5E 4NXME 1UILA 2NUGA 3ADIA 4DV4E 4DR2E 2UUBE 3C4BA 3ADLA 1HNXE 2DMYA 2ZM6E 1HNWE 4DV6E 4JI2E 2DIXA 2UUAE 4DR6E 1EKZA 2DB2A 2E5LE 1FKAE 4YY3E 1DI2A 4DUZE 4DUYE 4LF6E 4OX9E 5LMNE 2LRSA 4DV0E 4DV7E 3ADGA 4X8WA 4DR5E 1RC7A 4JI6E 4B3TE 5BR8E 2RSMA 4LFCE 1J26A 2B7TA 1XNRE 4LFAE 4DR4E 1T4NA 4DR1E 4X62E 4M2ZA 1N32E 4GKJE 4DV3E 1RQ0A 2LTSA 4AQYE 1WHNA 1XMOE 1T4LB 2YT4A 2VQEE 1N34E 1GQEA 4B3ME 2RS7A 1J5EE 3OTOE 3C4TA 2LUQA 3T1YE 1XNQE 1XMQE 1IBLE 2NUFA 2VQFE 4WFTA 1IBME 2JY9A 4GKKE 2LBSB 3VYXA 1N33E 4B3RE 4YHHE 5LMUE 4B3SE 4JI5E 4JI4E 1YYWA 2L2KB 5IWAE 4LF4E 1HR0E 2MDRA 4NXNE 1FJGE 2L3CA 4LF9E 4DKKA 2UXBE 4JI8E 1X47A 4OOGC 4JI7E 4M30A 4X66E 2UU9E 1YYKA 2UXCE 1HNZE 2N3HA 2N3GA 4DR3E 2RTXA 2L2NA 3HTXA 2IHR1 2L2MA 1X49A 1YYOA 4WYQB 4KHPE 2UXDE 2LUPB 1STUA 2KHXA 2LJHA 1YZ9A 3P1XA 4X65E 2CPNA 2L3JA 1O0WA 1I94E 4LF7E 2NUEA 1X48A 4JV5E 3ADJA 4JI1E 4LFBE 1UHZA 3LLHA 4JI0E 2B7VA 4LF8E 1QU6A 2NA2A 3VYYA 2RS6A 2JVAA 3J7Yp 4DV1E 3T1HE 2EZ6A 4JYAE 4DV5E 4JI3E 1T4OA 4K0KE 4DV2E 2LTRA 4DR7E 1N36E 1PKPA
chains in the Genus database with same CATH superfamily
4R2CA 2ADRA 1YSAC 2UUCE 2LO3A 2DLQA 1P47A 1EH6A 5IV8B 4BHBA 1BBGA 2V87A 1IBKE 5CFFE 2YPNA 4LF5E 4WSPA 5AASA 3LMLA 2LE2A 2EM9A 2V85A 1T39A 2EMAA 4LU9A 1Z1BA 3HQ1A 2UUAE 4DR6E 1A1JA 3VHTB 1EKZA 2E5LE 3EQ1A 2HC5A 5AC5A 4DUYE 4FK5C 2JP9A 2Q8UA 3M99B 1YPNA 2YRKA 4OX9E 4DV7E 2PRTA 2D9HA 4ZYDA 5A6AA 3F6HA 2RSMA 5BR8E 1J26A 1XNRE 4DR4E 2YTDA 1G2FC 4X62E 2YSPA 3VK6A 2GHFA 1N32E 2EJ4A 1F2IG 2EMLA 1MEYC 4MLQA 2LTSA 1XMOE 2YT4A 1GQEA 4LTYA 2RS7A 5IXMB 1A1GA 1J5EE 3OTOE 2LUQA 3QG5C 4WFTA 2VQFE 1IBME 4NZVA 4GKKE 2LBSB 2EPUA 2VF1A 4JI5E 1DGCA 4LF4E 2EP3A 4Q28A 4NXNE 1WJPA 2EPOA 2UXBE 4TUGA 4JI8E 2BB8A 2V86A 4J8ZA 3IWDA 1A1KA 4M30A 3EPHA 1EH7A 4KWYA 1UN6B 5KL4A 2JXPA 2L2NA 2IHR1 2B9DA 2EPCA 2EMWA 1YYOA 4WYQB 2UXDE 2KHXA 1GZ6A 4RHBB 4L8NA 2R1FA 2YTJA 3IWBA 4KZSA 2YSOA 1O0WA 1I94E 4LF7E 3ADJA 1TF6A 4LFBE 1UHZA 4DMIA 2B7VA 4LF8E 4P7DA 3C6KA 1PJQA 4DV1E 2EZ6A 2YZTA 1AH5A 2EN4A 1N3GA 2EOMA 3EPKA 2EMZA 4F9BB 3EPJA 2M7QA 2B3TB 2EM8A 1A1FA 2EMFA 4MLVA 1SR9A 4DR2E 2UUBE 2EOIA 2CSHA 2LV2A 2MC5A 3BIDA 1A1IA 2ZM6E 2M1SA 1MGTA 5A6BD 1G2DC 4HEIA 2DIXA 2DB2A 2JYAA 2JR1A 2ENCA 4YY3E 4F9CB 2H36X 2F8BA 2ELZA 3DJWA 2R76A 2L8TA 3JAMC 4JI6E 3IWCA 4ZYEA 2EN6A 1X3CA 2B7TA 3AV0A 2NABA 1RMDA 1ZU1A 4M2ZA 3DF6A 2EOYA 4O24A 4DV3E 2V89A 1RQ0A 4L5NC 1WHNA 1KYQA 1T4LB 1N34E 4ZYHA 1UBDC 5DNYA 2EWLA 4GZNC 2EL4A 2ENAA 2LMZA 2DRPA 2GLIA 2YTOA 2LJUA 1N33E 2EMXA 3MSWA 1SFEA 4B3RE 5AE3A 5ADZA 5LMUE 1TF3A 3F6GA 2EN3A 4JI4E 3BBGA 1YYWA 3FIGA 3J81C 2E72A 2MDRA 1A1HA 4R03A 3L00A 2L3CA 2EOJA 4I8OA 4IJDA 1YUIA 4DKKA 5KL7A 2JPAA 4R2DA 1X47A 5AE1A 1L4SA 2KOUA 4X66E 1YYKA 1ZR9A 2EM3A 3EPLA 2N3HA 3HPSA 4DR3E 2FTXB 2L2MA 1GTKA 4M0VA 5A2QC 2LUPB 2EMIA 2ODRC 1STUA 1ZBQA 4HTGA 4O5GA 4X65E 2CPNA 3BGHA 4M9VC 2L3JA 2MKDA 2LT7A 2EPRA 3LLHA 5A69A 2NA2A 4R2AA 2DGCA 3T1HE 2ODRD 4JYAE 1NEIA 4DV2E 2LTRA 2RPCA 1ZBTA 2K4VA 2EOXA 2EPKX 2V83A 2YWQA 5LL6R 1WHQA 2V88A 2F4VE 3KZZA 1ZAAC 2ELYA 2M4IA 2NUGA 3ADIA 3C4BA 4F6MA 1PJSA 4R2QA 4BBYA 4DV6E 1IQSA 5A6JA 1FKAE 2EOFA 4DV0E 3ADGA 2YU5A 1PDAA 2KONA 3ZOQB 3RMPA 5A6KA 4R2SA 4B3TE 4BHCA 2YTPA 4DR1E 2EPMX 4R8OA 2YRMA 2MKNA 4O43A 2EOQA 4WXDA 3H09A 2FGGA 4AQYE 2E1MA 2L6MA 4N4RB 5F3WA 2I9IA 1XMQE 2YTIA 1IBLE 2JY9A 2EPNA 2YTGA 4WX9A 2JWOA 2EOEA 2DMIA 2EM6A 2EN2A 4YHHE 2YRHA 2EPXA 2HJJA 5IWAE 2BBGA 1HR0E 4RH8A 3MHSC 2M9AA 2VRDA 3THNA 2K7IA 3C6MA 5LLQA 2A25A 2EOOA 1IMUA 2CTDA 4R2PA 4BCAA 2EMKA 4OOGC 4JI7E 2DSYA 2UXCE 2CT1A 2MDGA 2GPIA 4ZYGA 2RTXA 2YTFA 3HTXA 5KL5A 1TN9A 2RSIA 1WXRA 1X49A 2EE8A 1YZ9A 2EN7A 2EOHA 3P1XA 1LLMC 5T6JA 1X48A 3AUZA 1AAYA 2VE7C 4JV5E 4JI1E 4JI0E 2YTQA 2RS6A 2EPZA 3J7Yp 2EPAA 4JI3E 4F54A 1T4OA 4F9AB 2EM0A 3TQMA 4K0KE 3KWRA 4DR7E 5TSEA 1N36E 1PKPA 2EM2A 4X64E 2EN1A 3THOB 1YFHA 2HGHA 2L33A 5FLXC 4P78A 1X6FA 4F6NA 2HHHE 1JK1A 1B69A 4NXME 1UILA 4DV4E 2YTNA 3HXLA 1HNXE 2LVHA 2EMHA 5KL3A 2DMYA 2WZOA 1JK2A 2MC6A 1HNWE 4R2RA 4BMJA 1QNTA 2EORA 4JI2E 2YTEA 3BF2A 3J80C 1DI2A 4DUZE 4LF6E 4WPYA 5AE2A 2EPPA 2EMGA 1KJKA 2YU8A 5LMNE 2LRSA 2EL5A 4X8WA 4DR5E 1RC7A 1X6HA 2ENHA 4LFCE 2WBUA 4LFAE 2EMBA 1T4NA 3K6QA 2I13A 2EM5A 4BC7A 3UK3C 2EMYA 2EN8A 1X6EA 4GKJE 3JTZA 3JU0A 4NHRA 1T38A 4TUIA 2EOSA 3ECRA 2VQEE 4R2EA 4B3ME 2FV4B 3OMLA 3HPZA 3C4TA 3T1YE 2JOXA 1XNQE 2NUFA 1IQOA 2EM4A 3VYXA 4WXCA 2EOZA 1NCSA 5KL6A 2WCC3 4B3SE 1PJTA 2L2KB 2J7JA 2WBSA 2EM7A 1FJGE 4Q35B 4X9JA 4O4KA 5IT9C 4LF9E 2DLKA 2G7HA 2N8XA 4WSGA 1YUJA 1BBOA 2EQ3A 2RQLA 1A1LA 2EQ0A 2UU9E 5A6BA 4BS9A 1HNZE 2N3GA 2WBTA 1DQ3A 3J7AG 4KHPE 3KZYA 4GEQB 1WRJA 2EMCA 2LJHA 2EQ1A 5AC4A 2V8QB 2NUEA 5KL2A 1BB8A 2EPLX 4F2JC 2L92A 4BC9A 1QU6A 3VYYA 4IS1C 2JVAA 1EH8A 2LCEA 4DV5E 1X5WA 2JOBA 3MHHC 2EL6A 3ADLA
chains in the Genus database with same CATH topology
1ZBTA 2UUCE 2K4VA 4X64E 2V83A 4F9BB 5LL6R 1WHQA 2L33A 2V88A 5FLXC 2F4VE 2M7QA 4P78A 2B3TB 2V87A 2HHHE 1IBKE 5CFFE 2M4IA 4LF5E 1SR9A 1UILA 4NXME 4DV4E 4DR2E 4WSPA 3HXLA 5AASA 3C4BA 3LMLA 2LE2A 1HNXE 2V85A 2UUBE 2NUGA 3ADLA 2MC5A 2DMYA 2WZOA 2ZM6E 2M1SA 2MC6A 1HNWE 4BMJA 4LU9A 4BBYA 4DV6E 4JI2E 2DIXA 3HQ1A 2UUAE 4DR6E 1EKZA 2DB2A 2E5LE 2JR1A 1FKAE 4YY3E 3J80C 4DUZE 4F9CB 4WPYA 4DUYE 2H36X 5AE2A 4LF6E 1DI2A 2F8BA 3DJWA 4OX9E 2L8TA 2LRSA 5LMNE 4DV0E 4DV7E 3ADGA 3JAMC 4X8WA 4DR5E 1RC7A 4JI6E 3IWCA 2KONA 3ZOQB 3RMPA 4B3TE 3F6HA 2RSMA 5BR8E 4LFCE 2B7TA 3AV0A 1XNRE 4LFAE 4DR4E 1T4NA 3K6QA 4DR1E 4BC7A 4R8OA 3VK6A 3DF6A 4X62E 4M2ZA 1N32E 4GKJE 4DV3E 2V89A 3JTZA 3JU0A 1RQ0A 3H09A 4L5NC 2LTSA 2FGGA 4TUIA 4AQYE 1WHNA 1XMOE 1T4LB 2E1MA 2YT4A 2VQEE 1N34E 1GQEA 2L6MA 4B3ME 4LTYA 2RS7A 2FV4B 3OMLA 5DNYA 5F3WA 2EWLA 3C4TA 2LUQA 3HPZA 3OTOE 1J5EE 3T1YE 2JOXA 1XNQE 1XMQE 2LMZA 1IBLE 2NUFA 4WFTA 2VQFE 1IBME 2JY9A 4GKKE 2LBSB 3VYXA 1N33E 4B3RE 3MSWA 2JWOA 2VF1A 5AE3A 4YHHE 5ADZA 5LMUE 4B3SE 3F6GA 4JI5E 4JI4E 1YYWA 2L2KB 3FIGA 3J81C 5IWAE 4LF4E 1HR0E 2MDRA 4Q28A 4NXNE 4R03A 1FJGE 2L3CA 4I8OA 5IT9C 4LF9E 2G7HA 4DKKA 2UXBE 4TUGA 4JI8E 2V86A 1X47A 4BCAA 5AE1A 4J8ZA 4OOGC 4JI7E 3IWDA 2DSYA 4M30A 2KOUA 4X66E 2UU9E 1YYKA 2UXCE 4BS9A 1HNZE 2N3HA 2N3GA 3HPSA 1DQ3A 4DR3E 2RTXA 2FTXB 2L2NA 3HTXA 2IHR1 1J26A 2L2MA 4M0VA 1WXRA 2B9DA 3J7AG 1X49A 5A2QC 1YYOA 4WYQB 4KHPE 2UXDE 4GEQB 2LUPB 2ODRC 1STUA 1ZBQA 2KHXA 2LJHA 1GZ6A 1YZ9A 3P1XA 4L8NA 4X65E 3IWBA 2CPNA 4KZSA 2V8QB 5T6JA 2L3JA 1O0WA 1I94E 4LF7E 2NUEA 1X48A 3AUZA 4JV5E 2VE7C 3ADJA 4JI1E 4LFBE 1UHZA 3LLHA 4DMIA 4JI0E 2B7VA 2L92A 4BC9A 1QU6A 2NA2A 4P7DA 4LF8E 3VYYA 2RS6A 2JVAA 3J7Yp 4DV1E 3T1HE 2EZ6A 2ODRD 2YZTA 4JYAE 4DV5E 4F54A 4JI3E 1T4OA 4F9AB 2JOBA 4K0KE 4DV2E 3KWRA 3ADIA 2LTRA 4DR7E 1N36E 1PKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBT A;  2UUC E;  4X64 E;  1WHQ A;  2L33 A;  2F4V E;  2B3T B;  2HHH E;  1IBK E;  5CFF E;  4LF5 E;  4NXM E;  1UIL A;  2NUG A;  3ADI A;  4DV4 E;  4DR2 E;  2UUB E;  3C4B A;  3ADL A;  1HNX E;  2DMY A;  2ZM6 E;  1HNW E;  4DV6 E;  4JI2 E;  2DIX A;  2UUA E;  4DR6 E;  1EKZ A;  2DB2 A;  2E5L E;  1FKA E;  4YY3 E;  1DI2 A;  4DUZ E;  4DUY E;  4LF6 E;  4OX9 E;  5LMN E;  2LRS A;  4DV0 E;  4DV7 E;  3ADG A;  4X8W A;  4DR5 E;  1RC7 A;  4JI6 E;  4B3T E;  5BR8 E;  2RSM A;  4LFC E;  1J26 A;  2B7T A;  1XNR E;  4LFA E;  4DR4 E;  1T4N A;  4DR1 E;  4X62 E;  4M2Z A;  1N32 E;  4GKJ E;  4DV3 E;  1RQ0 A;  2LTS A;  4AQY E;  1WHN A;  1XMO E;  1T4L B;  2YT4 A;  2VQE E;  1N34 E;  1GQE A;  4B3M E;  2RS7 A;  1J5E E;  3OTO E;  3C4T A;  2LUQ A;  3T1Y E;  1XNQ E;  1XMQ E;  1IBL E;  2NUF A;  2VQF E;  4WFT A;  1IBM E;  2JY9 A;  4GKK E;  2LBS B;  3VYX A;  1N33 E;  4B3R E;  4YHH E;  5LMU E;  4B3S E;  4JI5 E;  4JI4 E;  1YYW A;  2L2K B;  5IWA E;  4LF4 E;  1HR0 E;  2MDR A;  4NXN E;  1FJG E;  2L3C A;  4LF9 E;  4DKK A;  2UXB E;  4JI8 E;  1X47 A;  4OOG C;  4JI7 E;  4M30 A;  4X66 E;  2UU9 E;  1YYK A;  2UXC E;  1HNZ E;  2N3H A;  2N3G A;  4DR3 E;  2RTX A;  2L2N A;  3HTX A;  2IHR 1;  2L2M A;  1X49 A;  1YYO A;  4WYQ B;  4KHP E;  2UXD E;  2LUP B;  1STU A;  2KHX A;  2LJH A;  1YZ9 A;  3P1X A;  4X65 E;  2CPN A;  2L3J A;  1O0W A;  1I94 E;  4LF7 E;  2NUE A;  1X48 A;  4JV5 E;  3ADJ A;  4JI1 E;  4LFB E;  1UHZ A;  3LLH A;  4JI0 E;  2B7V A;  4LF8 E;  1QU6 A;  2NA2 A;  3VYY A;  2RS6 A;  2JVA A;  3J7Y p;  4DV1 E;  3T1H E;  2EZ6 A;  4JYA E;  4DV5 E;  4JI3 E;  1T4O A;  4K0K E;  4DV2 E;  2LTR A;  4DR7 E;  1N36 E;  1PKP A; 
#chains in the Genus database with same CATH topology
 4R2C A;  2ADR A;  1YSA C;  2UUC E;  2LO3 A;  2DLQ A;  1P47 A;  1EH6 A;  5IV8 B;  4BHB A;  1BBG A;  2V87 A;  1IBK E;  5CFF E;  2YPN A;  4LF5 E;  4WSP A;  5AAS A;  3LML A;  2LE2 A;  2EM9 A;  2V85 A;  1T39 A;  2EMA A;  4LU9 A;  1Z1B A;  3HQ1 A;  2UUA E;  4DR6 E;  1A1J A;  3VHT B;  1EKZ A;  2E5L E;  3EQ1 A;  2HC5 A;  5AC5 A;  4DUY E;  4FK5 C;  2JP9 A;  2Q8U A;  3M99 B;  1YPN A;  2YRK A;  4OX9 E;  4DV7 E;  2PRT A;  2D9H A;  4ZYD A;  5A6A A;  3F6H A;  2RSM A;  5BR8 E;  1J26 A;  1XNR E;  4DR4 E;  2YTD A;  1G2F C;  4X62 E;  2YSP A;  3VK6 A;  2GHF A;  1N32 E;  2EJ4 A;  1F2I G;  2EML A;  1MEY C;  4MLQ A;  2LTS A;  1XMO E;  2YT4 A;  1GQE A;  4LTY A;  2RS7 A;  5IXM B;  1A1G A;  1J5E E;  3OTO E;  2LUQ A;  3QG5 C;  4WFT A;  2VQF E;  1IBM E;  4NZV A;  4GKK E;  2LBS B;  2EPU A;  2VF1 A;  4JI5 E;  1DGC A;  4LF4 E;  2EP3 A;  4Q28 A;  4NXN E;  1WJP A;  2EPO A;  2UXB E;  4TUG A;  4JI8 E;  2BB8 A;  2V86 A;  4J8Z A;  3IWD A;  1A1K A;  4M30 A;  3EPH A;  1EH7 A;  4KWY A;  1UN6 B;  5KL4 A;  2JXP A;  2L2N A;  2IHR 1;  2B9D A;  2EPC A;  2EMW A;  1YYO A;  4WYQ B;  2UXD E;  2KHX A;  1GZ6 A;  4RHB B;  4L8N A;  2R1F A;  2YTJ A;  3IWB A;  4KZS A;  2YSO A;  1O0W A;  1I94 E;  4LF7 E;  3ADJ A;  1TF6 A;  4LFB E;  1UHZ A;  4DMI A;  2B7V A;  4LF8 E;  4P7D A;  3C6K A;  1PJQ A;  4DV1 E;  2EZ6 A;  2YZT A;  1AH5 A;  2EN4 A;  1N3G A;  2EOM A;  3EPK A;  2EMZ A;  4F9B B;  3EPJ A;  2M7Q A;  2B3T B;  2EM8 A;  1A1F A;  2EMF A;  4MLV A;  1SR9 A;  4DR2 E;  2UUB E;  2EOI A;  2CSH A;  2LV2 A;  2MC5 A;  3BID A;  1A1I A;  2ZM6 E;  2M1S A;  1MGT A;  5A6B D;  1G2D C;  4HEI A;  2DIX A;  2DB2 A;  2JYA A;  2JR1 A;  2ENC A;  4YY3 E;  4F9C B;  2H36 X;  2F8B A;  2ELZ A;  3DJW A;  2R76 A;  2L8T A;  3JAM C;  4JI6 E;  3IWC A;  4ZYE A;  2EN6 A;  1X3C A;  2B7T A;  3AV0 A;  2NAB A;  1RMD A;  1ZU1 A;  4M2Z A;  3DF6 A;  2EOY A;  4O24 A;  4DV3 E;  2V89 A;  1RQ0 A;  4L5N C;  1WHN A;  1KYQ A;  1T4L B;  1N34 E;  4ZYH A;  1UBD C;  5DNY A;  2EWL A;  4GZN C;  2EL4 A;  2ENA A;  2LMZ A;  2DRP A;  2GLI A;  2YTO A;  2LJU A;  1N33 E;  2EMX A;  3MSW A;  1SFE A;  4B3R E;  5AE3 A;  5ADZ A;  5LMU E;  1TF3 A;  3F6G A;  2EN3 A;  4JI4 E;  3BBG A;  1YYW A;  3FIG A;  3J81 C;  2E72 A;  2MDR A;  1A1H A;  4R03 A;  3L00 A;  2L3C A;  2EOJ A;  4I8O A;  4IJD A;  1YUI A;  4DKK A;  5KL7 A;  2JPA A;  4R2D A;  1X47 A;  5AE1 A;  1L4S A;  2KOU A;  4X66 E;  1YYK A;  1ZR9 A;  2EM3 A;  3EPL A;  2N3H A;  3HPS A;  4DR3 E;  2FTX B;  2L2M A;  1GTK A;  4M0V A;  5A2Q C;  2LUP B;  2EMI A;  2ODR C;  1STU A;  1ZBQ A;  4HTG A;  4O5G A;  4X65 E;  2CPN A;  3BGH A;  4M9V C;  2L3J A;  2MKD A;  2LT7 A;  2EPR A;  3LLH A;  5A69 A;  2NA2 A;  4R2A A;  2DGC A;  3T1H E;  2ODR D;  4JYA E;  1NEI A;  4DV2 E;  2LTR A;  2RPC A;  1ZBT A;  2K4V A;  2EOX A;  2EPK X;  2V83 A;  2YWQ A;  5LL6 R;  1WHQ A;  2V88 A;  2F4V E;  3KZZ A;  1ZAA C;  2ELY A;  2M4I A;  2NUG A;  3ADI A;  3C4B A;  4F6M A;  1PJS A;  4R2Q A;  4BBY A;  4DV6 E;  1IQS A;  5A6J A;  1FKA E;  2EOF A;  4DV0 E;  3ADG A;  2YU5 A;  1PDA A;  2KON A;  3ZOQ B;  3RMP A;  5A6K A;  4R2S A;  4B3T E;  4BHC A;  2YTP A;  4DR1 E;  2EPM X;  4R8O A;  2YRM A;  2MKN A;  4O43 A;  2EOQ A;  4WXD A;  3H09 A;  2FGG A;  4AQY E;  2E1M A;  2L6M A;  4N4R B;  5F3W A;  2I9I A;  1XMQ E;  2YTI A;  1IBL E;  2JY9 A;  2EPN A;  2YTG A;  4WX9 A;  2JWO A;  2EOE A;  2DMI A;  2EM6 A;  2EN2 A;  4YHH E;  2YRH A;  2EPX A;  2HJJ A;  5IWA E;  2BBG A;  1HR0 E;  4RH8 A;  3MHS C;  2M9A A;  2VRD A;  3THN A;  2K7I A;  3C6M A;  5LLQ A;  2A25 A;  2EOO A;  1IMU A;  2CTD A;  4R2P A;  4BCA A;  2EMK A;  4OOG C;  4JI7 E;  2DSY A;  2UXC E;  2CT1 A;  2MDG A;  2GPI A;  4ZYG A;  2RTX A;  2YTF A;  3HTX A;  5KL5 A;  1TN9 A;  2RSI A;  1WXR A;  1X49 A;  2EE8 A;  1YZ9 A;  2EN7 A;  2EOH A;  3P1X A;  1LLM C;  5T6J A;  1X48 A;  3AUZ A;  1AAY A;  2VE7 C;  4JV5 E;  4JI1 E;  4JI0 E;  2YTQ A;  2RS6 A;  2EPZ A;  3J7Y p;  2EPA A;  4JI3 E;  4F54 A;  1T4O A;  4F9A B;  2EM0 A;  3TQM A;  4K0K E;  3KWR A;  4DR7 E;  5TSE A;  1N36 E;  1PKP A;  2EM2 A;  4X64 E;  2EN1 A;  3THO B;  1YFH A;  2HGH A;  2L33 A;  5FLX C;  4P78 A;  1X6F A;  4F6N A;  2HHH E;  1JK1 A;  1B69 A;  4NXM E;  1UIL A;  4DV4 E;  2YTN A;  3HXL A;  1HNX E;  2LVH A;  2EMH A;  5KL3 A;  2DMY A;  2WZO A;  1JK2 A;  2MC6 A;  1HNW E;  4R2R A;  4BMJ A;  1QNT A;  2EOR A;  4JI2 E;  2YTE A;  3BF2 A;  3J80 C;  1DI2 A;  4DUZ E;  4LF6 E;  4WPY A;  5AE2 A;  2EPP A;  2EMG A;  1KJK A;  2YU8 A;  5LMN E;  2LRS A;  2EL5 A;  4X8W A;  4DR5 E;  1RC7 A;  1X6H A;  2ENH A;  4LFC E;  2WBU A;  4LFA E;  2EMB A;  1T4N A;  3K6Q A;  2I13 A;  2EM5 A;  4BC7 A;  3UK3 C;  2EMY A;  2EN8 A;  1X6E A;  4GKJ E;  3JTZ A;  3JU0 A;  4NHR A;  1T38 A;  4TUI A;  2EOS A;  3ECR A;  2VQE E;  4R2E A;  4B3M E;  2FV4 B;  3OML A;  3HPZ A;  3C4T A;  3T1Y E;  2JOX A;  1XNQ E;  2NUF A;  1IQO A;  2EM4 A;  3VYX A;  4WXC A;  2EOZ A;  1NCS A;  5KL6 A;  2WCC 3;  4B3S E;  1PJT A;  2L2K B;  2J7J A;  2WBS A;  2EM7 A;  1FJG E;  4Q35 B;  4X9J A;  4O4K A;  5IT9 C;  4LF9 E;  2DLK A;  2G7H A;  2N8X A;  4WSG A;  1YUJ A;  1BBO A;  2EQ3 A;  2RQL A;  1A1L A;  2EQ0 A;  2UU9 E;  5A6B A;  4BS9 A;  1HNZ E;  2N3G A;  2WBT A;  1DQ3 A;  3J7A G;  4KHP E;  3KZY A;  4GEQ B;  1WRJ A;  2EMC A;  2LJH A;  2EQ1 A;  5AC4 A;  2V8Q B;  2NUE A;  5KL2 A;  1BB8 A;  2EPL X;  4F2J C;  2L92 A;  4BC9 A;  1QU6 A;  3VYY A;  4IS1 C;  2JVA A;  1EH8 A;  2LCE A;  4DV5 E;  1X5W A;  2JOB A;  3MHH C;  2EL6 A;  3ADL A; 
#chains in the Genus database with same CATH homology
 1ZBT A;  2UUC E;  2K4V A;  4X64 E;  2V83 A;  4F9B B;  5LL6 R;  1WHQ A;  2L33 A;  2V88 A;  5FLX C;  2F4V E;  2M7Q A;  4P78 A;  2B3T B;  2V87 A;  2HHH E;  1IBK E;  5CFF E;  2M4I A;  4LF5 E;  1SR9 A;  1UIL A;  4NXM E;  4DV4 E;  4DR2 E;  4WSP A;  3HXL A;  5AAS A;  3C4B A;  3LML A;  2LE2 A;  1HNX E;  2V85 A;  2UUB E;  2NUG A;  3ADL A;  2MC5 A;  2DMY A;  2WZO A;  2ZM6 E;  2M1S A;  2MC6 A;  1HNW E;  4BMJ A;  4LU9 A;  4BBY A;  4DV6 E;  4JI2 E;  2DIX A;  3HQ1 A;  2UUA E;  4DR6 E;  1EKZ A;  2DB2 A;  2E5L E;  2JR1 A;  1FKA E;  4YY3 E;  3J80 C;  4DUZ E;  4F9C B;  4WPY A;  4DUY E;  2H36 X;  5AE2 A;  4LF6 E;  1DI2 A;  2F8B A;  3DJW A;  4OX9 E;  2L8T A;  2LRS A;  5LMN E;  4DV0 E;  4DV7 E;  3ADG A;  3JAM C;  4X8W A;  4DR5 E;  1RC7 A;  4JI6 E;  3IWC A;  2KON A;  3ZOQ B;  3RMP A;  4B3T E;  3F6H A;  2RSM A;  5BR8 E;  4LFC E;  2B7T A;  3AV0 A;  1XNR E;  4LFA E;  4DR4 E;  1T4N A;  3K6Q A;  4DR1 E;  4BC7 A;  4R8O A;  3VK6 A;  3DF6 A;  4X62 E;  4M2Z A;  1N32 E;  4GKJ E;  4DV3 E;  2V89 A;  3JTZ A;  3JU0 A;  1RQ0 A;  3H09 A;  4L5N C;  2LTS A;  2FGG A;  4TUI A;  4AQY E;  1WHN A;  1XMO E;  1T4L B;  2E1M A;  2YT4 A;  2VQE E;  1N34 E;  1GQE A;  2L6M A;  4B3M E;  4LTY A;  2RS7 A;  2FV4 B;  3OML A;  5DNY A;  5F3W A;  2EWL A;  3C4T A;  2LUQ A;  3HPZ A;  3OTO E;  1J5E E;  3T1Y E;  2JOX A;  1XNQ E;  1XMQ E;  2LMZ A;  1IBL E;  2NUF A;  4WFT A;  2VQF E;  1IBM E;  2JY9 A;  4GKK E;  2LBS B;  3VYX A;  1N33 E;  4B3R E;  3MSW A;  2JWO A;  2VF1 A;  5AE3 A;  4YHH E;  5ADZ A;  5LMU E;  4B3S E;  3F6G A;  4JI5 E;  4JI4 E;  1YYW A;  2L2K B;  3FIG A;  3J81 C;  5IWA E;  4LF4 E;  1HR0 E;  2MDR A;  4Q28 A;  4NXN E;  4R03 A;  1FJG E;  2L3C A;  4I8O A;  5IT9 C;  4LF9 E;  2G7H A;  4DKK A;  2UXB E;  4TUG A;  4JI8 E;  2V86 A;  1X47 A;  4BCA A;  5AE1 A;  4J8Z A;  4OOG C;  4JI7 E;  3IWD A;  2DSY A;  4M30 A;  2KOU A;  4X66 E;  2UU9 E;  1YYK A;  2UXC E;  4BS9 A;  1HNZ E;  2N3H A;  2N3G A;  3HPS A;  1DQ3 A;  4DR3 E;  2RTX A;  2FTX B;  2L2N A;  3HTX A;  2IHR 1;  1J26 A;  2L2M A;  4M0V A;  1WXR A;  2B9D A;  3J7A G;  1X49 A;  5A2Q C;  1YYO A;  4WYQ B;  4KHP E;  2UXD E;  4GEQ B;  2LUP B;  2ODR C;  1STU A;  1ZBQ A;  2KHX A;  2LJH A;  1GZ6 A;  1YZ9 A;  3P1X A;  4L8N A;  4X65 E;  3IWB A;  2CPN A;  4KZS A;  2V8Q B;  5T6J A;  2L3J A;  1O0W A;  1I94 E;  4LF7 E;  2NUE A;  1X48 A;  3AUZ A;  4JV5 E;  2VE7 C;  3ADJ A;  4JI1 E;  4LFB E;  1UHZ A;  3LLH A;  4DMI A;  4JI0 E;  2B7V A;  2L92 A;  4BC9 A;  1QU6 A;  2NA2 A;  4P7D A;  4LF8 E;  3VYY A;  2RS6 A;  2JVA A;  3J7Y p;  4DV1 E;  3T1H E;  2EZ6 A;  2ODR D;  2YZT A;  4JYA E;  4DV5 E;  4F54 A;  4JI3 E;  1T4O A;  4F9A B;  2JOB A;  4K0K E;  4DV2 E;  3KWR A;  3ADI A;  2LTR A;  4DR7 E;  1N36 E;  1PKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...