2B7VA

Structure of adar2 dsrbm2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
b'PSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase 1
publication title Structure and specific RNA binding of ADAR2 double-stranded RNA binding motifs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 21
structure length 71
sequence length 71
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2b7vA00
1DI2A 2HHHE 1HNWE 2MDRA 2N3GA 2LTRA 2RTXA 5LMNE 2B7TA 1FKAE 2NA2A 5CFFE 1T4OA 1X49A 4LF8E 4DR4E 3P1XA 4DV6E 1RQ0A 4WFTA 2EZ6A 4DR5E 2UUAE 2L3JA 4GKKE 4DUYE 4DR6E 1PKPA 2NUFA 2NUEA 1RC7A 3ADGA 2E5LE 2LTSA 2N3HA 4LFBE 2JY9A 4X65E 2UUCE 1HNZE 5IWAE 1HNXE 3T1HE 4X64E 1ZBTA 2CPNA 4JI7E 2DB2A 1WHQA 1YYOA 3J7Yp 4WYQB 1UHZA 3C4TA 5BR8E 4YHHE 2LRSA 1YZ9A 2UUBE 4B3RE 2JVAA 2UU9E 4JI3E 2L3CA 1IBME 3OTOE 4NXME 4DV5E 1J5EE 4M30A 1IBLE 2YT4A 1STUA 1WHNA 4JI2E 1N34E 4JI1E 4DV1E 5LMUE 4JI0E 2UXCE 3VYYA 4X8WA 1YYKA 3LLHA 1X48A 4DR7E 4B3SE 4AQYE 1T4LB 4GKJE 4DR1E 1N36E 1FJGE 3C4BA 4LF4E 1EKZA 2B7VA 4DR3E 1HR0E 4B3ME 2LJHA 2NUGA 1J26A 4LFAE 2VQFE 2F4VE 4DV0E 2IHR1 4DUZE 3T1YE 4LFCE 2RS6A 1QU6A 4DKKA 2UXDE 2LUQA 4JI4E 2ZM6E 4LF5E 4LF9E 2LUPB 4DV4E 4LF7E 2UXBE 1YYWA 2KHXA 2L2KB 2VQEE 4KHPE 4DV3E 4X62E 3ADLA 3HTXA 1XMQE 3ADIA 2RSMA 3VYXA 4JYAE 1XNRE 4K0KE 1X47A 4OX9E 4B3TE 1XNQE 4YY3E 4M2ZA 1N32E 2L33A 1UILA 1T4NA 2DMYA 4JV5E 4X66E 1O0WA 1IBKE 1N33E 2L2MA 4JI8E 4JI5E 1GQEA 4LF6E 2L2NA 1XMOE 1I94E 4JI6E 4DV7E 2DIXA 2RS7A 4NXNE 4DV2E 3ADJA 4DR2E 2LBSB 2B3TB 4OOGC
chains in the Genus database with same CATH superfamily
1X3CA 2LTRA 1X6EA 3MSWA 2GHFA 2NA2A 5CFFE 1NEIA 4BCAA 1X49A 4KZSA 1RQ0A 4BHBA 4LTYA 4GKKE 4DUYE 3ECRA 2NUEA 2LTSA 2JY9A 3C6MA 5AC5A 1HNZE 2LE2A 1ZBQA 2MKDA 1YSAC 1A1LA 2LV2A 1ZBTA 4JI7E 1IQSA 2EQ3A 3C4TA 2RQLA 2WBUA 2MKNA 1PJSA 4NXME 4BC9A 1J5EE 3JTZA 4M30A 5IXMB 4DV1E 2EM4A 5FLXC 2EL4A 2MC5A 2JOBA 2EM7A 2EM6A 4AQYE 2ENAA 2EMZA 3RMPA 2EN8A 4HEIA 5KL5A 2EPLX 2V85A 1F2IG 3HQ1A 1YUJA 2EOXA 2EOEA 2EOMA 2LCEA 2EP3A 2VQFE 4DV0E 4ZYDA 4R2PA 4LFCE 3EPJA 3VK6A 4JI4E 1G2DC 1ZU1A 3QG5C 4DV4E 2M4IA 4LF7E 2UXBE 1YYWA 2KHXA 2LVHA 4BBYA 2L2KB 2VRDA 3AV0A 3EPLA 4X62E 3J7AG 2EPOA 2ODRD 3ADLA 2M7QA 2EMGA 3ADIA 3VYXA 2EN2A 1XNRE 1X47A 2EOIA 5A6BD 2EN3A 2WBSA 2D9HA 4M2ZA 3HPZA 2WBTA 2EQ0A 4J8ZA 2EPMX 2YRHA 1SR9A 2YU5A 2YWQA 4WPYA 1MEYC 4KWYA 4JV5E 2EL6A 2EN4A 4RHBB 4WXDA 4JI8E 4BHCA 4BMJA 2EMIA 1RMDA 3LMLA 2ELZA 4L8NA 2HGHA 4LF6E 2EM5A 2KOUA 2L2NA 1ZR9A 4P78A 2YU8A 4ZYHA 2LT7A 4R03A 3OMLA 2YTIA 2LBSB 2B3TB 1DI2A 2VF1A 2RTXA 1HNWE 1FKAE 2PRTA 1JK2A 4DR4E 1EH8A 2YTFA 4WFTA 1NCSA 4DR5E 5AE2A 3THNA 2JYAA 3M99B 4DR6E 5KL4A 2FTXB 2ADRA 4NZVA 5IWAE 2I9IA 2V89A 1X6HA 1N3GA 2EPZA 3FIGA 1T38A 1UBDC 3MHHC 1WRJA 4O24A 4MLVA 4B3RE 4R8OA 3IWCA 1TF3A 3HPSA 4HTGA 1IBME 1AAYA 3OTOE 2RPCA 2GPIA 5AE1A 2YTEA 3THOB 2LJUA 4IS1C 2YT4A 5KL6A 1STUA 1WHNA 4JI2E 2K7IA 2LO3A 4ZYGA 4JI0E 2UXCE 1IMUA 2B9DA 2V8QB 5AE3A 3LLHA 4F2JC 2KONA 3L00A 1EH7A 5F3WA 2Q8UA 1LLMC 2EMLA 1T4LB 4GKJE 3IWBA 1G2FC 2R1FA 2J7JA 2JXPA 1QNTA 4LF4E 2B7VA 4DR3E 1HR0E 3EPHA 5IV8B 2F4VE 4MLQA 4DUZE 2RS6A 4WSPA 2UXDE 2LUQA 4WX9A 1EH6A 2ZM6E 4ZYEA 3DF6A 1BB8A 2EOJA 4DV3E 2FGGA 1IQOA 2EMCA 4F9AB 4L5NC 5DNYA 4K0KE 2MC6A 2EMYA 2RSMA 5IT9C 2JWOA 1TF6A 2EOQA 4OX9E 2EM3A 5A6AA 4B3TE 1SFEA 2DLKA 1N32E 4I8OA 2ELYA 2L33A 4F9CB 1T4NA 2YSOA 2EM8A 2EPUA 2BBGA 5AC4A 4P7DA 2JOXA 4TUIA 4R2DA 2HC5A 3ADJA 4DR2E 2EPNA 4OOGC 2EPPA 2EMKA 2EMXA 2N3GA 1P47A 1AH5A 5T6JA 4F9BB 1YFHA 4LF8E 2EZ6A 4DV6E 2EMFA 4GZNC 2L3JA 4WSGA 5AASA 1PJTA 3DJWA 3IWDA 3ADGA 2K4VA 2HJJA 4LFBE 1DGCA 4F6MA 2UUCE 1GZ6A 1ZAAC 1A1GA 4RH8A 1MGTA 4O43A 4X64E 3VHTB 4WYQB 2EORA 2EPCA 4YHHE 2I13A 2LRSA 1GTKA 4LU9A 4Q28A 2EPXA 2L6MA 5A69A 2ENCA 4DV5E 1IBLE 2V88A 2EMWA 1B69A 2ODRC 2YPNA 2L8TA 3HXLA 1WXRA 3VYYA 2EM0A 2EOHA 2YTJA 4DMIA 5KL3A 4X8WA 1YYKA 2EJ4A 2EPKX 3C6KA 1X48A 2EWLA 1YPNA 4WXCA 5TSEA 4DR1E 1N36E 4FK5C 3C4BA 2EN7A 2JPAA 3EQ1A 4F54A 4R2QA 2EN6A 1J26A 4LFAE 3J80C 2IHR1 2ENHA 2DLQA 5A2QC 2VE7C 2H36X 1QU6A 4R2SA 4LF5E 2CT1A 3TQMA 3BGHA 4BC7A 3JAMC 2VQEE 4KHPE 1KYQA 2EM9A 2NABA 3HTXA 4TUGA 2YTNA 1XMQE 5LLQA 1DQ3A 1TN9A 4N4RB 1BBOA 2M1SA 1XNQE 1UILA 4M0VA 2DMYA 2EM2A 3AUZA 1O0WA 2DMIA 1IBKE 2EOYA 2L2MA 3BF2A 4O5GA 2M9AA 2EQ1A 5LL6R 2YTPA 1I94E 3KZYA 4DV7E 2DSYA 2YTGA 2CTDA 2LMZA 1Z1BA 5ADZA 2DGCA 2G7HA 2HHHE 2MDRA 5LMNE 2B7TA 2L92A 1T4OA 3P1XA 5KL2A 1A1JA 2YTOA 2UUAE 3EPKA 2V83A 4R2AA 1PKPA 2R76A 2NUFA 1RC7A 2E5LE 2N3HA 4R2RA 4X65E 2V87A 2EE8A 2RSIA 2V86A 2CSHA 2YZTA 1HNXE 4M9VC 3T1HE 2CPNA 2DB2A 1WHQA 1YYOA 4X9JA 2F8BA 1UHZA 3J7Yp 1PDAA 5BR8E 1YZ9A 2UUBE 2JVAA 2UU9E 4JI3E 2L3CA 2EMBA 3ZOQB 3BIDA 2BB8A 3H09A 2E72A 4GEQB 5A6BA 1A1FA 2EN1A 1A1KA 1A1IA 1N34E 4JI1E 5A6KA 5LMUE 2JR1A 3MHSC 2YRKA 4DR7E 4B3SE 4R2CA 1FJGE 2EOOA 4BS9A 2YTDA 2FV4B 5KL7A 1EKZA 2WZOA 4B3ME 1KJKA 2LJHA 2EPRA 2NUGA 1JK1A 2EMAA 2GLIA 2MDGA 3J81C 2EMHA 3T1YE 2WCC3 1UN6B 1L4SA 3KZZA 2DRPA 1PJQA 4DKKA 2EOZA 4LF9E 2LUPB 2EOFA 1A1HA 1BBGA 2N8XA 2YRMA 3KWRA 4JYAE 1X6FA 4Q35B 4F6NA 3F6GA 4YY3E 2A25A 2E1MA 2EL5A 3JU0A 1T39A 4X66E 2JP9A 1N33E 4JI5E 3K6QA 1GQEA 4O4KA 3F6HA 2YTQA 1YUIA 2EPAA 1XMOE 4JI6E 2DIXA 1X5WA 2RS7A 4NXNE 5A6JA 4DV2E 2EOSA 4R2EA 3UK3C 4IJDA 2YSPA 3BBGA 4NHRA 1WJPA
chains in the Genus database with same CATH topology
1DI2A 2G7HA 2HHHE 2VF1A 2MDRA 2N3GA 2LTRA 2RTXA 5LMNE 2B7TA 1FKAE 1HNWE 3MSWA 2L92A 2NA2A 5T6JA 1T4OA 4BCAA 4F9BB 1X49A 5CFFE 4LF8E 4KZSA 3P1XA 4DV6E 1RQ0A 4WFTA 2EZ6A 4DR4E 4DR5E 2UUAE 2L3JA 4LTYA 5AASA 5AE2A 2V83A 4DUYE 4GKKE 3DJWA 4DR6E 1PKPA 2NUFA 2NUEA 3IWDA 1RC7A 2FTXB 2K4VA 2LTSA 2N3HA 3ADGA 2E5LE 4LFBE 2JY9A 4X65E 2V87A 1HNZE 1GZ6A 2UUCE 2LE2A 1ZBQA 5IWAE 2V86A 2V89A 2YZTA 1HNXE 3T1HE 4X64E 1ZBTA 2CPNA 4JI7E 2DB2A 1WHQA 1YYOA 3FIGA 3J7Yp 2F8BA 1UHZA 3C4TA 4WYQB 5BR8E 4YHHE 2LRSA 1YZ9A 2UUBE 4B3RE 4R8OA 2JVAA 4LU9A 2UU9E 4K0KE 3IWCA 4JI3E 2L3CA 3HPSA 1IBME 4Q28A 2L6MA 3OTOE 4NXME 5AE1A 4BC9A 4DV5E 3JTZA 4M30A 1J5EE 1IBLE 3ZOQB 2YT4A 3H09A 4GEQB 1STUA 2V88A 1WHNA 2ODRC 4JI2E 1N34E 2L8TA 3HXLA 1WXRA 5LMUE 4DV1E 4JI1E 4JI0E 2JR1A 3VYYA 4DMIA 5FLXC 4X8WA 2B9DA 2MC5A 2V8QB 2JOBA 5AE3A 1YYKA 3LLHA 1X48A 4DR7E 4B3SE 2EWLA 2KONA 4AQYE 5F3WA 3RMPA 1T4LB 4GKJE 4DR1E 3IWBA 1N36E 1FJGE 4BS9A 3C4BA 2V85A 4LF4E 2FV4B 4F54A 3HQ1A 1EKZA 2B7VA 4DR3E 1HR0E 2WZOA 4B3ME 2LJHA 2NUGA 1J26A 2UXCE 4LFAE 3J80C 2VQFE 4DV0E 2F4VE 2IHR1 3J81C 4DUZE 5A2QC 2VE7C 3T1YE 4LFCE 2RS6A 2H36X 1QU6A 4WSPA 4DKKA 2LUQA 2UXDE 3VK6A 4JI4E 2ZM6E 4LF5E 4LF9E 2LUPB 4DV4E 4LF7E 2M4IA 2UXBE 1YYWA 3DF6A 2KHXA 4BBYA 4BC7A 3JAMC 3AV0A 2L2KB 2VQEE 4KHPE 4DV3E 2FGGA 4X62E 3J7AG 2ODRD 4F9AB 3ADLA 3HTXA 4TUGA 4L5NC 3KWRA 2M7QA 5DNYA 1XMQE 2MC6A 2RSMA 1DQ3A 1XNRE 3ADIA 5IT9C 2JWOA 3VYXA 4JYAE 1X47A 4OX9E 2M1SA 3F6GA 4B3TE 1XNQE 4YY3E 4M2ZA 1N32E 2E1MA 3HPZA 4I8OA 2L33A 1UILA 3JU0A 4F9CB 4M0VA 1T4NA 2DMYA 4J8ZA 1SR9A 3AUZA 4WPYA 4JV5E 4X66E 1O0WA 1IBKE 1N33E 4BMJA 2L2MA 4JI8E 3K6QA 4JI5E 4P7DA 1GQEA 5LL6R 2JOXA 3F6HA 3LMLA 4L8NA 4LF6E 2KOUA 2L2NA 4P78A 1XMOE 1I94E 4TUIA 4JI6E 4DV7E 2DIXA 2RS7A 4NXNE 4R03A 4DV2E 3OMLA 3ADJA 4DR2E 2DSYA 2LBSB 2B3TB 2LMZA 4OOGC 5ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DI2 A;  2HHH E;  1HNW E;  2MDR A;  2N3G A;  2LTR A;  2RTX A;  5LMN E;  2B7T A;  1FKA E;  2NA2 A;  5CFF E;  1T4O A;  1X49 A;  4LF8 E;  4DR4 E;  3P1X A;  4DV6 E;  1RQ0 A;  4WFT A;  2EZ6 A;  4DR5 E;  2UUA E;  2L3J A;  4GKK E;  4DUY E;  4DR6 E;  1PKP A;  2NUF A;  2NUE A;  1RC7 A;  3ADG A;  2E5L E;  2LTS A;  2N3H A;  4LFB E;  2JY9 A;  4X65 E;  2UUC E;  1HNZ E;  5IWA E;  1HNX E;  3T1H E;  4X64 E;  1ZBT A;  2CPN A;  4JI7 E;  2DB2 A;  1WHQ A;  1YYO A;  3J7Y p;  4WYQ B;  1UHZ A;  3C4T A;  5BR8 E;  4YHH E;  2LRS A;  1YZ9 A;  2UUB E;  4B3R E;  2JVA A;  2UU9 E;  4JI3 E;  2L3C A;  1IBM E;  3OTO E;  4NXM E;  4DV5 E;  1J5E E;  4M30 A;  1IBL E;  2YT4 A;  1STU A;  1WHN A;  4JI2 E;  1N34 E;  4JI1 E;  4DV1 E;  5LMU E;  4JI0 E;  2UXC E;  3VYY A;  4X8W A;  1YYK A;  3LLH A;  1X48 A;  4DR7 E;  4B3S E;  4AQY E;  1T4L B;  4GKJ E;  4DR1 E;  1N36 E;  1FJG E;  3C4B A;  4LF4 E;  1EKZ A;  2B7V A;  4DR3 E;  1HR0 E;  4B3M E;  2LJH A;  2NUG A;  1J26 A;  4LFA E;  2VQF E;  2F4V E;  4DV0 E;  2IHR 1;  4DUZ E;  3T1Y E;  4LFC E;  2RS6 A;  1QU6 A;  4DKK A;  2UXD E;  2LUQ A;  4JI4 E;  2ZM6 E;  4LF5 E;  4LF9 E;  2LUP B;  4DV4 E;  4LF7 E;  2UXB E;  1YYW A;  2KHX A;  2L2K B;  2VQE E;  4KHP E;  4DV3 E;  4X62 E;  3ADL A;  3HTX A;  1XMQ E;  3ADI A;  2RSM A;  3VYX A;  4JYA E;  1XNR E;  4K0K E;  1X47 A;  4OX9 E;  4B3T E;  1XNQ E;  4YY3 E;  4M2Z A;  1N32 E;  2L33 A;  1UIL A;  1T4N A;  2DMY A;  4JV5 E;  4X66 E;  1O0W A;  1IBK E;  1N33 E;  2L2M A;  4JI8 E;  4JI5 E;  1GQE A;  4LF6 E;  2L2N A;  1XMO E;  1I94 E;  4JI6 E;  4DV7 E;  2DIX A;  2RS7 A;  4NXN E;  4DV2 E;  3ADJ A;  4DR2 E;  2LBS B;  2B3T B;  4OOG C; 
#chains in the Genus database with same CATH topology
 1X3C A;  2LTR A;  1X6E A;  3MSW A;  2GHF A;  2NA2 A;  5CFF E;  1NEI A;  4BCA A;  1X49 A;  4KZS A;  1RQ0 A;  4BHB A;  4LTY A;  4GKK E;  4DUY E;  3ECR A;  2NUE A;  2LTS A;  2JY9 A;  3C6M A;  5AC5 A;  1HNZ E;  2LE2 A;  1ZBQ A;  2MKD A;  1YSA C;  1A1L A;  2LV2 A;  1ZBT A;  4JI7 E;  1IQS A;  2EQ3 A;  3C4T A;  2RQL A;  2WBU A;  2MKN A;  1PJS A;  4NXM E;  4BC9 A;  1J5E E;  3JTZ A;  4M30 A;  5IXM B;  4DV1 E;  2EM4 A;  5FLX C;  2EL4 A;  2MC5 A;  2JOB A;  2EM7 A;  2EM6 A;  4AQY E;  2ENA A;  2EMZ A;  3RMP A;  2EN8 A;  4HEI A;  5KL5 A;  2EPL X;  2V85 A;  1F2I G;  3HQ1 A;  1YUJ A;  2EOX A;  2EOE A;  2EOM A;  2LCE A;  2EP3 A;  2VQF E;  4DV0 E;  4ZYD A;  4R2P A;  4LFC E;  3EPJ A;  3VK6 A;  4JI4 E;  1G2D C;  1ZU1 A;  3QG5 C;  4DV4 E;  2M4I A;  4LF7 E;  2UXB E;  1YYW A;  2KHX A;  2LVH A;  4BBY A;  2L2K B;  2VRD A;  3AV0 A;  3EPL A;  4X62 E;  3J7A G;  2EPO A;  2ODR D;  3ADL A;  2M7Q A;  2EMG A;  3ADI A;  3VYX A;  2EN2 A;  1XNR E;  1X47 A;  2EOI A;  5A6B D;  2EN3 A;  2WBS A;  2D9H A;  4M2Z A;  3HPZ A;  2WBT A;  2EQ0 A;  4J8Z A;  2EPM X;  2YRH A;  1SR9 A;  2YU5 A;  2YWQ A;  4WPY A;  1MEY C;  4KWY A;  4JV5 E;  2EL6 A;  2EN4 A;  4RHB B;  4WXD A;  4JI8 E;  4BHC A;  4BMJ A;  2EMI A;  1RMD A;  3LML A;  2ELZ A;  4L8N A;  2HGH A;  4LF6 E;  2EM5 A;  2KOU A;  2L2N A;  1ZR9 A;  4P78 A;  2YU8 A;  4ZYH A;  2LT7 A;  4R03 A;  3OML A;  2YTI A;  2LBS B;  2B3T B;  1DI2 A;  2VF1 A;  2RTX A;  1HNW E;  1FKA E;  2PRT A;  1JK2 A;  4DR4 E;  1EH8 A;  2YTF A;  4WFT A;  1NCS A;  4DR5 E;  5AE2 A;  3THN A;  2JYA A;  3M99 B;  4DR6 E;  5KL4 A;  2FTX B;  2ADR A;  4NZV A;  5IWA E;  2I9I A;  2V89 A;  1X6H A;  1N3G A;  2EPZ A;  3FIG A;  1T38 A;  1UBD C;  3MHH C;  1WRJ A;  4O24 A;  4MLV A;  4B3R E;  4R8O A;  3IWC A;  1TF3 A;  3HPS A;  4HTG A;  1IBM E;  1AAY A;  3OTO E;  2RPC A;  2GPI A;  5AE1 A;  2YTE A;  3THO B;  2LJU A;  4IS1 C;  2YT4 A;  5KL6 A;  1STU A;  1WHN A;  4JI2 E;  2K7I A;  2LO3 A;  4ZYG A;  4JI0 E;  2UXC E;  1IMU A;  2B9D A;  2V8Q B;  5AE3 A;  3LLH A;  4F2J C;  2KON A;  3L00 A;  1EH7 A;  5F3W A;  2Q8U A;  1LLM C;  2EML A;  1T4L B;  4GKJ E;  3IWB A;  1G2F C;  2R1F A;  2J7J A;  2JXP A;  1QNT A;  4LF4 E;  2B7V A;  4DR3 E;  1HR0 E;  3EPH A;  5IV8 B;  2F4V E;  4MLQ A;  4DUZ E;  2RS6 A;  4WSP A;  2UXD E;  2LUQ A;  4WX9 A;  1EH6 A;  2ZM6 E;  4ZYE A;  3DF6 A;  1BB8 A;  2EOJ A;  4DV3 E;  2FGG A;  1IQO A;  2EMC A;  4F9A B;  4L5N C;  5DNY A;  4K0K E;  2MC6 A;  2EMY A;  2RSM A;  5IT9 C;  2JWO A;  1TF6 A;  2EOQ A;  4OX9 E;  2EM3 A;  5A6A A;  4B3T E;  1SFE A;  2DLK A;  1N32 E;  4I8O A;  2ELY A;  2L33 A;  4F9C B;  1T4N A;  2YSO A;  2EM8 A;  2EPU A;  2BBG A;  5AC4 A;  4P7D A;  2JOX A;  4TUI A;  4R2D A;  2HC5 A;  3ADJ A;  4DR2 E;  2EPN A;  4OOG C;  2EPP A;  2EMK A;  2EMX A;  2N3G A;  1P47 A;  1AH5 A;  5T6J A;  4F9B B;  1YFH A;  4LF8 E;  2EZ6 A;  4DV6 E;  2EMF A;  4GZN C;  2L3J A;  4WSG A;  5AAS A;  1PJT A;  3DJW A;  3IWD A;  3ADG A;  2K4V A;  2HJJ A;  4LFB E;  1DGC A;  4F6M A;  2UUC E;  1GZ6 A;  1ZAA C;  1A1G A;  4RH8 A;  1MGT A;  4O43 A;  4X64 E;  3VHT B;  4WYQ B;  2EOR A;  2EPC A;  4YHH E;  2I13 A;  2LRS A;  1GTK A;  4LU9 A;  4Q28 A;  2EPX A;  2L6M A;  5A69 A;  2ENC A;  4DV5 E;  1IBL E;  2V88 A;  2EMW A;  1B69 A;  2ODR C;  2YPN A;  2L8T A;  3HXL A;  1WXR A;  3VYY A;  2EM0 A;  2EOH A;  2YTJ A;  4DMI A;  5KL3 A;  4X8W A;  1YYK A;  2EJ4 A;  2EPK X;  3C6K A;  1X48 A;  2EWL A;  1YPN A;  4WXC A;  5TSE A;  4DR1 E;  1N36 E;  4FK5 C;  3C4B A;  2EN7 A;  2JPA A;  3EQ1 A;  4F54 A;  4R2Q A;  2EN6 A;  1J26 A;  4LFA E;  3J80 C;  2IHR 1;  2ENH A;  2DLQ A;  5A2Q C;  2VE7 C;  2H36 X;  1QU6 A;  4R2S A;  4LF5 E;  2CT1 A;  3TQM A;  3BGH A;  4BC7 A;  3JAM C;  2VQE E;  4KHP E;  1KYQ A;  2EM9 A;  2NAB A;  3HTX A;  4TUG A;  2YTN A;  1XMQ E;  5LLQ A;  1DQ3 A;  1TN9 A;  4N4R B;  1BBO A;  2M1S A;  1XNQ E;  1UIL A;  4M0V A;  2DMY A;  2EM2 A;  3AUZ A;  1O0W A;  2DMI A;  1IBK E;  2EOY A;  2L2M A;  3BF2 A;  4O5G A;  2M9A A;  2EQ1 A;  5LL6 R;  2YTP A;  1I94 E;  3KZY A;  4DV7 E;  2DSY A;  2YTG A;  2CTD A;  2LMZ A;  1Z1B A;  5ADZ A;  2DGC A;  2G7H A;  2HHH E;  2MDR A;  5LMN E;  2B7T A;  2L92 A;  1T4O A;  3P1X A;  5KL2 A;  1A1J A;  2YTO A;  2UUA E;  3EPK A;  2V83 A;  4R2A A;  1PKP A;  2R76 A;  2NUF A;  1RC7 A;  2E5L E;  2N3H A;  4R2R A;  4X65 E;  2V87 A;  2EE8 A;  2RSI A;  2V86 A;  2CSH A;  2YZT A;  1HNX E;  4M9V C;  3T1H E;  2CPN A;  2DB2 A;  1WHQ A;  1YYO A;  4X9J A;  2F8B A;  1UHZ A;  3J7Y p;  1PDA A;  5BR8 E;  1YZ9 A;  2UUB E;  2JVA A;  2UU9 E;  4JI3 E;  2L3C A;  2EMB A;  3ZOQ B;  3BID A;  2BB8 A;  3H09 A;  2E72 A;  4GEQ B;  5A6B A;  1A1F A;  2EN1 A;  1A1K A;  1A1I A;  1N34 E;  4JI1 E;  5A6K A;  5LMU E;  2JR1 A;  3MHS C;  2YRK A;  4DR7 E;  4B3S E;  4R2C A;  1FJG E;  2EOO A;  4BS9 A;  2YTD A;  2FV4 B;  5KL7 A;  1EKZ A;  2WZO A;  4B3M E;  1KJK A;  2LJH A;  2EPR A;  2NUG A;  1JK1 A;  2EMA A;  2GLI A;  2MDG A;  3J81 C;  2EMH A;  3T1Y E;  2WCC 3;  1UN6 B;  1L4S A;  3KZZ A;  2DRP A;  1PJQ A;  4DKK A;  2EOZ A;  4LF9 E;  2LUP B;  2EOF A;  1A1H A;  1BBG A;  2N8X A;  2YRM A;  3KWR A;  4JYA E;  1X6F A;  4Q35 B;  4F6N A;  3F6G A;  4YY3 E;  2A25 A;  2E1M A;  2EL5 A;  3JU0 A;  1T39 A;  4X66 E;  2JP9 A;  1N33 E;  4JI5 E;  3K6Q A;  1GQE A;  4O4K A;  3F6H A;  2YTQ A;  1YUI A;  2EPA A;  1XMO E;  4JI6 E;  2DIX A;  1X5W A;  2RS7 A;  4NXN E;  5A6J A;  4DV2 E;  2EOS A;  4R2E A;  3UK3 C;  4IJD A;  2YSP A;  3BBG A;  4NHR A;  1WJP A; 
#chains in the Genus database with same CATH homology
 1DI2 A;  2G7H A;  2HHH E;  2VF1 A;  2MDR A;  2N3G A;  2LTR A;  2RTX A;  5LMN E;  2B7T A;  1FKA E;  1HNW E;  3MSW A;  2L92 A;  2NA2 A;  5T6J A;  1T4O A;  4BCA A;  4F9B B;  1X49 A;  5CFF E;  4LF8 E;  4KZS A;  3P1X A;  4DV6 E;  1RQ0 A;  4WFT A;  2EZ6 A;  4DR4 E;  4DR5 E;  2UUA E;  2L3J A;  4LTY A;  5AAS A;  5AE2 A;  2V83 A;  4DUY E;  4GKK E;  3DJW A;  4DR6 E;  1PKP A;  2NUF A;  2NUE A;  3IWD A;  1RC7 A;  2FTX B;  2K4V A;  2LTS A;  2N3H A;  3ADG A;  2E5L E;  4LFB E;  2JY9 A;  4X65 E;  2V87 A;  1HNZ E;  1GZ6 A;  2UUC E;  2LE2 A;  1ZBQ A;  5IWA E;  2V86 A;  2V89 A;  2YZT A;  1HNX E;  3T1H E;  4X64 E;  1ZBT A;  2CPN A;  4JI7 E;  2DB2 A;  1WHQ A;  1YYO A;  3FIG A;  3J7Y p;  2F8B A;  1UHZ A;  3C4T A;  4WYQ B;  5BR8 E;  4YHH E;  2LRS A;  1YZ9 A;  2UUB E;  4B3R E;  4R8O A;  2JVA A;  4LU9 A;  2UU9 E;  4K0K E;  3IWC A;  4JI3 E;  2L3C A;  3HPS A;  1IBM E;  4Q28 A;  2L6M A;  3OTO E;  4NXM E;  5AE1 A;  4BC9 A;  4DV5 E;  3JTZ A;  4M30 A;  1J5E E;  1IBL E;  3ZOQ B;  2YT4 A;  3H09 A;  4GEQ B;  1STU A;  2V88 A;  1WHN A;  2ODR C;  4JI2 E;  1N34 E;  2L8T A;  3HXL A;  1WXR A;  5LMU E;  4DV1 E;  4JI1 E;  4JI0 E;  2JR1 A;  3VYY A;  4DMI A;  5FLX C;  4X8W A;  2B9D A;  2MC5 A;  2V8Q B;  2JOB A;  5AE3 A;  1YYK A;  3LLH A;  1X48 A;  4DR7 E;  4B3S E;  2EWL A;  2KON A;  4AQY E;  5F3W A;  3RMP A;  1T4L B;  4GKJ E;  4DR1 E;  3IWB A;  1N36 E;  1FJG E;  4BS9 A;  3C4B A;  2V85 A;  4LF4 E;  2FV4 B;  4F54 A;  3HQ1 A;  1EKZ A;  2B7V A;  4DR3 E;  1HR0 E;  2WZO A;  4B3M E;  2LJH A;  2NUG A;  1J26 A;  2UXC E;  4LFA E;  3J80 C;  2VQF E;  4DV0 E;  2F4V E;  2IHR 1;  3J81 C;  4DUZ E;  5A2Q C;  2VE7 C;  3T1Y E;  4LFC E;  2RS6 A;  2H36 X;  1QU6 A;  4WSP A;  4DKK A;  2LUQ A;  2UXD E;  3VK6 A;  4JI4 E;  2ZM6 E;  4LF5 E;  4LF9 E;  2LUP B;  4DV4 E;  4LF7 E;  2M4I A;  2UXB E;  1YYW A;  3DF6 A;  2KHX A;  4BBY A;  4BC7 A;  3JAM C;  3AV0 A;  2L2K B;  2VQE E;  4KHP E;  4DV3 E;  2FGG A;  4X62 E;  3J7A G;  2ODR D;  4F9A B;  3ADL A;  3HTX A;  4TUG A;  4L5N C;  3KWR A;  2M7Q A;  5DNY A;  1XMQ E;  2MC6 A;  2RSM A;  1DQ3 A;  1XNR E;  3ADI A;  5IT9 C;  2JWO A;  3VYX A;  4JYA E;  1X47 A;  4OX9 E;  2M1S A;  3F6G A;  4B3T E;  1XNQ E;  4YY3 E;  4M2Z A;  1N32 E;  2E1M A;  3HPZ A;  4I8O A;  2L33 A;  1UIL A;  3JU0 A;  4F9C B;  4M0V A;  1T4N A;  2DMY A;  4J8Z A;  1SR9 A;  3AUZ A;  4WPY A;  4JV5 E;  4X66 E;  1O0W A;  1IBK E;  1N33 E;  4BMJ A;  2L2M A;  4JI8 E;  3K6Q A;  4JI5 E;  4P7D A;  1GQE A;  5LL6 R;  2JOX A;  3F6H A;  3LML A;  4L8N A;  4LF6 E;  2KOU A;  2L2N A;  4P78 A;  1XMO E;  1I94 E;  4TUI A;  4JI6 E;  4DV7 E;  2DIX A;  2RS7 A;  4NXN E;  4R03 A;  4DV2 E;  3OML A;  3ADJ A;  4DR2 E;  2DSY A;  2LBS B;  2B3T B;  2LMZ A;  4OOG C;  5ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...