4R2SA

Wilms tumor protein (wt1) q369p zinc fingers in complex with methylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
b'SEKPYQCDFKDCERRFSRSDPLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2sA00
2MDGA 1A1LA 2YRMA 2YTIA 1LLMC 2EM5A 2EMFA 3VHTB 2EMBA 3M99B 2HGHA 4GZNC 2EPZA 2YTFA 2EOHA 3EPLA 4F2JC 4R2DA 1BB8A 2EN3A 1JK2A 2EM9A 4R2RA 3UK3C 2YRKA 2EOSA 4IS1C 2JP9A 2WBSA 4FK5C 2BB8A 4IJDA 5KL7A 2EN6A 1B69A 2VRDA 2ENCA 2EMIA 1WJPA 2EP3A 1YSAC 2EOIA 2YTGA 2ENAA 2EM7A 2LV2A 2EMZA 2CT1A 2EN2A 2EOEA 2YRHA 2EOZA 3MHSC 2I13A 2RPCA 2EOOA 2MKDA 5KL4A 4R2SA 2DGCA 1X6HA 2EPCA 2EN8A 2CSHA 2EMXA 2EQ0A 3MHHC 1YUJA 2EOQA 1NCSA 4F6NA 1A1GA 2EM0A 2RSIA 2GLIA 2EN1A 1TN9A 2EOFA 2YTOA 5KL5A 2DLQA 2JPAA 1X6FA 2EOMA 2EOXA 4R2CA 1A1HA 2YTPA 2EOYA 2EORA 2EMYA 1P47A 1BBOA 2WCC3 2EM3A 1MEYC 4R2QA 2D9HA 2EPRA 2EPAA 2A25A 2WBUA 1X6EA 2NABA 2EMCA 1F2IG 2DRPA 2EM8A 2LVHA 2DLKA 2EN7A 2ELZA 2YTDA 1ZU1A 2EQ3A 1G2DC 2EM4A 4R2AA 4R2PA 2YTQA 2EE8A 2ENHA 2EM6A 1X5WA 3EPHA 1A1JA 2EPPA 1X3CA 1UN6B 2EL6A 5KL6A 2YTEA 3EPJA 1TF3A 2DMIA 2EQ1A 4WSGA 2ADRA 2YU8A 2EPXA 1DGCA 2EL4A 2EN4A 4R2EA 1ZR9A 2R1FA 4X9JA 2ELYA 2WBTA 1AAYA 2EM2A 2YU5A 1A1FA 2EMGA 2YTNA 2LO3A 1RMDA 2CTDA 1TF6A 2EJ4A 2LT7A 4M9VC 1A1IA 2MKNA 1UBDC 2PRTA 1Z1BA 1A1KA 3EPKA 2LCEA 1KJKA 1JK1A 2EMLA 2EOJA 2J7JA 2YTJA 2EMWA 2E72A 2YSOA 1ZAAC 2EMAA 2GHFA 2EPUA 1YUIA 2M9AA 5KL2A 2EMHA 2EL5A 2EMKA 1G2FC 4F6MA 2YSPA 5KL3A
chains in the Genus database with same CATH superfamily
2YZTA 4HTGA 1HNZE 2YTIA 3VHTB 2YTFA 4JV5E 4P7DA 1T39A 1IBKE 5T6JA 2EN3A 4R2RA 1ZBTA 3DJWA 5KL7A 4R03A 3THNA 1GTKA 1XNQE 1WJPA 4OOGC 2HHHE 1YSAC 2R76A 1NEIA 2LV2A 2EN2A 2V87A 4MLVA 1UHZA 4O24A 2G7HA 4KZSA 2KHXA 2V88A 2M1SA 4L5NC 2JOXA 2EN8A 2EMXA 4YY3E 3HTXA 2JWOA 4F6NA 1A1GA 2V89A 2JXPA 2GLIA 4DR6E 2Q8UA 2N8XA 2YTOA 1ZBQA 2DLQA 2ZM6E 2JPAA 1FJGE 2EOMA 4WSPA 4R2CA 1A1HA 2LTRA 4BHBA 2JY9A 2EMYA 2L2KB 1BBOA 3BIDA 4F9BB 2VQEE 2NUGA 1EH7A 1BBGA 2WCC3 1DI2A 4X65E 4WXDA 2VF1A 4R2QA 4TUIA 1X6EA 5AC4A 2NABA 3BGHA 2DRPA 2EPLX 2LVHA 1O0WA 3F6GA 2ELZA 3RMPA 2GPIA 4BHCA 2EZ6A 4BC9A 4BCAA 4F54A 2EPPA 2LUQA 5KL6A 5AE2A 1PJSA 3EPJA 1TF3A 4WSGA 2YU8A 5DNYA 2YT4A 2EN4A 1ZR9A 2VE7C 2UXCE 4X9JA 2ELYA 1N36E 3BBGA 1J5EE 2EM2A 2YU5A 1A1FA 3FIGA 2EPOA 1TF6A 2EJ4A 2M7QA 3ADGA 2L3CA 2MKNA 5A6AA 5LMUE 4BC7A 5IXMB 1A1KA 1JK1A 2B9DA 2L6MA 2YSOA 2L3JA 2GHFA 4LF8E 4RHBB 2M9AA 2B3TB 4DV1E 1PJQA 2H36X 4LF4E 2EMFA 1T4LB 4GKJE 4M2ZA 2HGHA 4GZNC 2EPZA 2EOHA 3OTOE 2UXDE 1BB8A 1JK2A 2DB2A 2YRKA 5A6BD 1WRJA 4FK5C 4IJDA 5A69A 3JAMC 3IWDA 2V8QB 3THOB 4JI4E 1YYWA 2YTGA 1N33E 2UUAE 2EM7A 2F4VE 1EH6A 2EOEA 2EOZA 4NXNE 2MKDA 2DGCA 2EPCA 2EQ0A 2DIXA 1SFEA 1YUJA 2EOQA 2JVAA 5A6JA 2V83A 2B7VA 4TUGA 2RS7A 4BS9A 1WXRA 2EN1A 4NHRA 2EWLA 4P78A 4DR3E 5KL5A 1IQOA 1HR0E 1X6FA 2WZOA 4DR1E 4DR2E 1UILA 3J80C 2L92A 4DR7E 4WX9A 4LTYA 1PDAA 1XNRE 1F2IG 3EQ1A 1ZU1A 5A6KA 1FKAE 4B3SE 4O4KA 4R8OA 2UUBE 1HNXE 2ENHA 2EM6A 1X5WA 1A1JA 1N34E 4LFBE 1X3CA 2DMIA 2EQ1A 2ADRA 1T4NA 2RTXA 2VQFE 4DMIA 5TSEA 4YHHE 4LF6E 1WHNA 3JTZA 4JI8E 3LMLA 2UUCE 2EMGA 2YTNA 5LMNE 4BBYA 3T1HE 2B7TA 2CPNA 2ODRD 2LT7A 3LLHA 2HC5A 4O43A 4B3RE 2PRTA 1Z1BA 2F8BA 3EPKA 1KJKA 4DV2E 5LLQA 3KWRA 1X49A 2J7JA 4NZVA 2E72A 3ADLA 2EMHA 2EL5A 2EMKA 4X66E 1G2FC 2YSPA 2BBGA 3VK6A 1A1LA 1T4OA 2V85A 1LLMC 4KWYA 2UU9E 2N3GA 2EMBA 1KYQA 5ADZA 3VYXA 3J81C 5BR8E 2EM9A 3UK3C 2MC5A 2EOSA 4K0KE 4IS1C 2JP9A 3BF2A 2LRSA 2WBSA 2M4IA 2BB8A 2EN6A 5IT9C 4I8OA 2NUEA 2ENCA 2EMIA 1SR9A 2EP3A 2EOIA 4LFAE 2ENAA 1WHQA 4DV3E 2FGGA 2EMZA 2CT1A 2L8TA 2YWQA 4WFTA 5CFFE 4DV4E 2YRHA 4N4RB 3MHSC 4DV6E 4GEQB 3JU0A 2EOOA 5KL4A 4JI1E 1X6HA 2CSHA 3L00A 4DR5E 2MC6A 4DV0E 2EPKX 4DV7E 5AE3A 4ZYDA 2EM0A 5F3WA 2RSIA 4M0VA 4O5GA 1DQ3A 4HEIA 1PKPA 2EOYA 4DKKA 1P47A 4LF7E 2LMZA 3KZYA 3HXLA 2EPRA 2HJJA 2L2NA 2WBUA 2EMCA 4JI2E 4DV5E 2DLKA 4JI7E 3OMLA 4F9AB 3ADIA 1J26A 1G2DC 3ECRA 2MDRA 4DR4E 5IV8B 4OX9E 3DF6A 5AE1A 2V86A 2N3HA 2RQLA 4R2AA 2YTQA 2LUPB 1QNTA 4M30A 3EPHA 3C6MA 4RH8A 4DUYE 1I94E 1UN6B 2YTEA 1GZ6A 5A2QC 3IWCA 1IMUA 2EPXA 4WYQB 1EKZA 4MLQA 3MSWA 2R1FA 2WBTA 1AH5A 2E1MA 4ZYEA 4AQYE 3KZZA 4L8NA 4M9VC 2K4VA 3K6QA 1A1IA 2ODRC 4JI3E 3AUZA 2EMLA 4X62E 2YTJA 2EMWA 5AASA 1IBLE 2EPUA 2DMYA 3C6KA 1UBDC 4F6MA 5KL3A 2MDGA 1N32E 2LTSA 2YRMA 2LJUA 2FTXB 2EM5A 3AV0A 4LF9E 3M99B 3EPLA 2L33A 4F2JC 4B3ME 4JYAE 1GQEA 4R2DA 1YPNA 4JI0E 2K7IA 2FV4B 4J8ZA 1B69A 2UXBE 4JI5E 2VRDA 2RSMA 1IBME 1YZ9A 2EPNA 4X8WA 4JI6E 4WPYA 2I13A 2RPCA 5FLXC 1T38A 1IQSA 4R2SA 5LL6R 3MHHC 1YYKA 1NCSA 3TQMA 1QU6A 1TN9A 2EOFA 4F9CB 5AC5A 2EOXA 2YTPA 3C4TA 1N3GA 3HQ1A 3QG5C 2EORA 4LU9A 3HPZA 3VYYA 2NUFA 4B3TE 3T1YE 1EH8A 3ADJA 3J7AG 3IWBA 2EM3A 2JR1A 3J7Yp 1MEYC 1MGTA 2D9HA 2LE2A 3P1XA 2EPAA 2A25A 2EM8A 2KOUA 1L4SA 2EN7A 4ZYGA 4X64E 2YTDA 2EQ3A 2EM4A 3HPSA 4Q35B 5A6BA 1YYOA 4R2PA 2I9IA 2EE8A 4KHPE 1X47A 3ZOQB 2EL6A 2JYAA 4NXME 1PJTA 2IHR1 1YFHA 4GKKE 2DSYA 2NA2A 1DGCA 2EL4A 4LF5E 4R2EA 3F6HA 1X48A 3C4BA 1AAYA 4ZYHA 2EPMX 2KONA 1XMOE 4LFCE 2LO3A 1RMDA 1RC7A 1HNWE 2CTDA 4BMJA 2LBSB 3H09A 4DUZE 1XMQE 4WXCA 2JOBA 4Q28A 2LCEA 1STUA 2LJHA 2EOJA 1RQ0A 2RS6A 1ZAAC 2EMAA 5IWAE 2E5LE 1YUIA 2L2MA 5KL2A 2YPNA
chains in the Genus database with same CATH topology
2MDGA 1A1LA 2YRMA 2YTIA 1LLMC 2EM5A 2EMFA 3VHTB 2EMBA 3M99B 2HGHA 4GZNC 2EPZA 2YTFA 2EOHA 3EPLA 4F2JC 4R2DA 1BB8A 2EN3A 1JK2A 2EM9A 4R2RA 3UK3C 2YRKA 2EOSA 4IS1C 2JP9A 2WBSA 4FK5C 2BB8A 4IJDA 5KL7A 2EN6A 1B69A 2VRDA 2ENCA 2EMIA 1WJPA 2EP3A 1YSAC 2EOIA 2YTGA 2ENAA 2EM7A 2LV2A 2EMZA 2CT1A 2EN2A 2EOEA 2YRHA 2EOZA 3MHSC 2I13A 2RPCA 2EOOA 2MKDA 5KL4A 4R2SA 2DGCA 1X6HA 2EPCA 2EN8A 2CSHA 2EMXA 2EQ0A 3MHHC 1YUJA 2EOQA 1NCSA 4F6NA 1A1GA 2EM0A 2RSIA 2GLIA 2EN1A 1TN9A 2EOFA 2YTOA 5KL5A 2DLQA 2JPAA 1X6FA 2EOMA 2EOXA 4R2CA 1A1HA 2YTPA 2EOYA 2EORA 2EMYA 1P47A 1BBOA 2WCC3 2EM3A 1MEYC 4R2QA 2D9HA 2EPRA 2EPAA 2A25A 2WBUA 1X6EA 2NABA 2EMCA 1F2IG 2DRPA 2EM8A 2LVHA 2DLKA 2EN7A 2ELZA 2YTDA 1ZU1A 2EQ3A 1G2DC 2EM4A 4R2AA 4R2PA 2YTQA 2EE8A 2ENHA 2EM6A 1X5WA 3EPHA 1A1JA 2EPPA 1X3CA 1UN6B 2EL6A 5KL6A 2YTEA 3EPJA 1TF3A 2DMIA 2EQ1A 4WSGA 2ADRA 2YU8A 2EPXA 1DGCA 2EL4A 2EN4A 4R2EA 1ZR9A 2R1FA 4X9JA 2ELYA 2WBTA 1AAYA 2EM2A 2YU5A 1A1FA 2EMGA 2YTNA 2LO3A 1RMDA 2CTDA 1TF6A 2EJ4A 2LT7A 4M9VC 1A1IA 2MKNA 1UBDC 2PRTA 1Z1BA 1A1KA 3EPKA 2LCEA 1KJKA 1JK1A 2EMLA 2EOJA 2J7JA 2YTJA 2EMWA 2E72A 2YSOA 1ZAAC 2EMAA 2GHFA 2EPUA 1YUIA 2M9AA 5KL2A 2EMHA 2EL5A 2EMKA 1G2FC 4F6MA 2YSPA 5KL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDG A;  1A1L A;  2YRM A;  2YTI A;  1LLM C;  2EM5 A;  2EMF A;  3VHT B;  2EMB A;  3M99 B;  2HGH A;  4GZN C;  2EPZ A;  2YTF A;  2EOH A;  3EPL A;  4F2J C;  4R2D A;  1BB8 A;  2EN3 A;  1JK2 A;  2EM9 A;  4R2R A;  3UK3 C;  2YRK A;  2EOS A;  4IS1 C;  2JP9 A;  2WBS A;  4FK5 C;  2BB8 A;  4IJD A;  5KL7 A;  2EN6 A;  1B69 A;  2VRD A;  2ENC A;  2EMI A;  1WJP A;  2EP3 A;  1YSA C;  2EOI A;  2YTG A;  2ENA A;  2EM7 A;  2LV2 A;  2EMZ A;  2CT1 A;  2EN2 A;  2EOE A;  2YRH A;  2EOZ A;  3MHS C;  2I13 A;  2RPC A;  2EOO A;  2MKD A;  5KL4 A;  4R2S A;  2DGC A;  1X6H A;  2EPC A;  2EN8 A;  2CSH A;  2EMX A;  2EQ0 A;  3MHH C;  1YUJ A;  2EOQ A;  1NCS A;  4F6N A;  1A1G A;  2EM0 A;  2RSI A;  2GLI A;  2EN1 A;  1TN9 A;  2EOF A;  2YTO A;  5KL5 A;  2DLQ A;  2JPA A;  1X6F A;  2EOM A;  2EOX A;  4R2C A;  1A1H A;  2YTP A;  2EOY A;  2EOR A;  2EMY A;  1P47 A;  1BBO A;  2WCC 3;  2EM3 A;  1MEY C;  4R2Q A;  2D9H A;  2EPR A;  2EPA A;  2A25 A;  2WBU A;  1X6E A;  2NAB A;  2EMC A;  1F2I G;  2DRP A;  2EM8 A;  2LVH A;  2DLK A;  2EN7 A;  2ELZ A;  2YTD A;  1ZU1 A;  2EQ3 A;  1G2D C;  2EM4 A;  4R2A A;  4R2P A;  2YTQ A;  2EE8 A;  2ENH A;  2EM6 A;  1X5W A;  3EPH A;  1A1J A;  2EPP A;  1X3C A;  1UN6 B;  2EL6 A;  5KL6 A;  2YTE A;  3EPJ A;  1TF3 A;  2DMI A;  2EQ1 A;  4WSG A;  2ADR A;  2YU8 A;  2EPX A;  1DGC A;  2EL4 A;  2EN4 A;  4R2E A;  1ZR9 A;  2R1F A;  4X9J A;  2ELY A;  2WBT A;  1AAY A;  2EM2 A;  2YU5 A;  1A1F A;  2EMG A;  2YTN A;  2LO3 A;  1RMD A;  2CTD A;  1TF6 A;  2EJ4 A;  2LT7 A;  4M9V C;  1A1I A;  2MKN A;  1UBD C;  2PRT A;  1Z1B A;  1A1K A;  3EPK A;  2LCE A;  1KJK A;  1JK1 A;  2EML A;  2EOJ A;  2J7J A;  2YTJ A;  2EMW A;  2E72 A;  2YSO A;  1ZAA C;  2EMA A;  2GHF A;  2EPU A;  1YUI A;  2M9A A;  5KL2 A;  2EMH A;  2EL5 A;  2EMK A;  1G2F C;  4F6M A;  2YSP A;  5KL3 A; 
#chains in the Genus database with same CATH topology
 2YZT A;  4HTG A;  1HNZ E;  2YTI A;  3VHT B;  2YTF A;  4JV5 E;  4P7D A;  1T39 A;  1IBK E;  5T6J A;  2EN3 A;  4R2R A;  1ZBT A;  3DJW A;  5KL7 A;  4R03 A;  3THN A;  1GTK A;  1XNQ E;  1WJP A;  4OOG C;  2HHH E;  1YSA C;  2R76 A;  1NEI A;  2LV2 A;  2EN2 A;  2V87 A;  4MLV A;  1UHZ A;  4O24 A;  2G7H A;  4KZS A;  2KHX A;  2V88 A;  2M1S A;  4L5N C;  2JOX A;  2EN8 A;  2EMX A;  4YY3 E;  3HTX A;  2JWO A;  4F6N A;  1A1G A;  2V89 A;  2JXP A;  2GLI A;  4DR6 E;  2Q8U A;  2N8X A;  2YTO A;  1ZBQ A;  2DLQ A;  2ZM6 E;  2JPA A;  1FJG E;  2EOM A;  4WSP A;  4R2C A;  1A1H A;  2LTR A;  4BHB A;  2JY9 A;  2EMY A;  2L2K B;  1BBO A;  3BID A;  4F9B B;  2VQE E;  2NUG A;  1EH7 A;  1BBG A;  2WCC 3;  1DI2 A;  4X65 E;  4WXD A;  2VF1 A;  4R2Q A;  4TUI A;  1X6E A;  5AC4 A;  2NAB A;  3BGH A;  2DRP A;  2EPL X;  2LVH A;  1O0W A;  3F6G A;  2ELZ A;  3RMP A;  2GPI A;  4BHC A;  2EZ6 A;  4BC9 A;  4BCA A;  4F54 A;  2EPP A;  2LUQ A;  5KL6 A;  5AE2 A;  1PJS A;  3EPJ A;  1TF3 A;  4WSG A;  2YU8 A;  5DNY A;  2YT4 A;  2EN4 A;  1ZR9 A;  2VE7 C;  2UXC E;  4X9J A;  2ELY A;  1N36 E;  3BBG A;  1J5E E;  2EM2 A;  2YU5 A;  1A1F A;  3FIG A;  2EPO A;  1TF6 A;  2EJ4 A;  2M7Q A;  3ADG A;  2L3C A;  2MKN A;  5A6A A;  5LMU E;  4BC7 A;  5IXM B;  1A1K A;  1JK1 A;  2B9D A;  2L6M A;  2YSO A;  2L3J A;  2GHF A;  4LF8 E;  4RHB B;  2M9A A;  2B3T B;  4DV1 E;  1PJQ A;  2H36 X;  4LF4 E;  2EMF A;  1T4L B;  4GKJ E;  4M2Z A;  2HGH A;  4GZN C;  2EPZ A;  2EOH A;  3OTO E;  2UXD E;  1BB8 A;  1JK2 A;  2DB2 A;  2YRK A;  5A6B D;  1WRJ A;  4FK5 C;  4IJD A;  5A69 A;  3JAM C;  3IWD A;  2V8Q B;  3THO B;  4JI4 E;  1YYW A;  2YTG A;  1N33 E;  2UUA E;  2EM7 A;  2F4V E;  1EH6 A;  2EOE A;  2EOZ A;  4NXN E;  2MKD A;  2DGC A;  2EPC A;  2EQ0 A;  2DIX A;  1SFE A;  1YUJ A;  2EOQ A;  2JVA A;  5A6J A;  2V83 A;  2B7V A;  4TUG A;  2RS7 A;  4BS9 A;  1WXR A;  2EN1 A;  4NHR A;  2EWL A;  4P78 A;  4DR3 E;  5KL5 A;  1IQO A;  1HR0 E;  1X6F A;  2WZO A;  4DR1 E;  4DR2 E;  1UIL A;  3J80 C;  2L92 A;  4DR7 E;  4WX9 A;  4LTY A;  1PDA A;  1XNR E;  1F2I G;  3EQ1 A;  1ZU1 A;  5A6K A;  1FKA E;  4B3S E;  4O4K A;  4R8O A;  2UUB E;  1HNX E;  2ENH A;  2EM6 A;  1X5W A;  1A1J A;  1N34 E;  4LFB E;  1X3C A;  2DMI A;  2EQ1 A;  2ADR A;  1T4N A;  2RTX A;  2VQF E;  4DMI A;  5TSE A;  4YHH E;  4LF6 E;  1WHN A;  3JTZ A;  4JI8 E;  3LML A;  2UUC E;  2EMG A;  2YTN A;  5LMN E;  4BBY A;  3T1H E;  2B7T A;  2CPN A;  2ODR D;  2LT7 A;  3LLH A;  2HC5 A;  4O43 A;  4B3R E;  2PRT A;  1Z1B A;  2F8B A;  3EPK A;  1KJK A;  4DV2 E;  5LLQ A;  3KWR A;  1X49 A;  2J7J A;  4NZV A;  2E72 A;  3ADL A;  2EMH A;  2EL5 A;  2EMK A;  4X66 E;  1G2F C;  2YSP A;  2BBG A;  3VK6 A;  1A1L A;  1T4O A;  2V85 A;  1LLM C;  4KWY A;  2UU9 E;  2N3G A;  2EMB A;  1KYQ A;  5ADZ A;  3VYX A;  3J81 C;  5BR8 E;  2EM9 A;  3UK3 C;  2MC5 A;  2EOS A;  4K0K E;  4IS1 C;  2JP9 A;  3BF2 A;  2LRS A;  2WBS A;  2M4I A;  2BB8 A;  2EN6 A;  5IT9 C;  4I8O A;  2NUE A;  2ENC A;  2EMI A;  1SR9 A;  2EP3 A;  2EOI A;  4LFA E;  2ENA A;  1WHQ A;  4DV3 E;  2FGG A;  2EMZ A;  2CT1 A;  2L8T A;  2YWQ A;  4WFT A;  5CFF E;  4DV4 E;  2YRH A;  4N4R B;  3MHS C;  4DV6 E;  4GEQ B;  3JU0 A;  2EOO A;  5KL4 A;  4JI1 E;  1X6H A;  2CSH A;  3L00 A;  4DR5 E;  2MC6 A;  4DV0 E;  2EPK X;  4DV7 E;  5AE3 A;  4ZYD A;  2EM0 A;  5F3W A;  2RSI A;  4M0V A;  4O5G A;  1DQ3 A;  4HEI A;  1PKP A;  2EOY A;  4DKK A;  1P47 A;  4LF7 E;  2LMZ A;  3KZY A;  3HXL A;  2EPR A;  2HJJ A;  2L2N A;  2WBU A;  2EMC A;  4JI2 E;  4DV5 E;  2DLK A;  4JI7 E;  3OML A;  4F9A B;  3ADI A;  1J26 A;  1G2D C;  3ECR A;  2MDR A;  4DR4 E;  5IV8 B;  4OX9 E;  3DF6 A;  5AE1 A;  2V86 A;  2N3H A;  2RQL A;  4R2A A;  2YTQ A;  2LUP B;  1QNT A;  4M30 A;  3EPH A;  3C6M A;  4RH8 A;  4DUY E;  1I94 E;  1UN6 B;  2YTE A;  1GZ6 A;  5A2Q C;  3IWC A;  1IMU A;  2EPX A;  4WYQ B;  1EKZ A;  4MLQ A;  3MSW A;  2R1F A;  2WBT A;  1AH5 A;  2E1M A;  4ZYE A;  4AQY E;  3KZZ A;  4L8N A;  4M9V C;  2K4V A;  3K6Q A;  1A1I A;  2ODR C;  4JI3 E;  3AUZ A;  2EML A;  4X62 E;  2YTJ A;  2EMW A;  5AAS A;  1IBL E;  2EPU A;  2DMY A;  3C6K A;  1UBD C;  4F6M A;  5KL3 A;  2MDG A;  1N32 E;  2LTS A;  2YRM A;  2LJU A;  2FTX B;  2EM5 A;  3AV0 A;  4LF9 E;  3M99 B;  3EPL A;  2L33 A;  4F2J C;  4B3M E;  4JYA E;  1GQE A;  4R2D A;  1YPN A;  4JI0 E;  2K7I A;  2FV4 B;  4J8Z A;  1B69 A;  2UXB E;  4JI5 E;  2VRD A;  2RSM A;  1IBM E;  1YZ9 A;  2EPN A;  4X8W A;  4JI6 E;  4WPY A;  2I13 A;  2RPC A;  5FLX C;  1T38 A;  1IQS A;  4R2S A;  5LL6 R;  3MHH C;  1YYK A;  1NCS A;  3TQM A;  1QU6 A;  1TN9 A;  2EOF A;  4F9C B;  5AC5 A;  2EOX A;  2YTP A;  3C4T A;  1N3G A;  3HQ1 A;  3QG5 C;  2EOR A;  4LU9 A;  3HPZ A;  3VYY A;  2NUF A;  4B3T E;  3T1Y E;  1EH8 A;  3ADJ A;  3J7A G;  3IWB A;  2EM3 A;  2JR1 A;  3J7Y p;  1MEY C;  1MGT A;  2D9H A;  2LE2 A;  3P1X A;  2EPA A;  2A25 A;  2EM8 A;  2KOU A;  1L4S A;  2EN7 A;  4ZYG A;  4X64 E;  2YTD A;  2EQ3 A;  2EM4 A;  3HPS A;  4Q35 B;  5A6B A;  1YYO A;  4R2P A;  2I9I A;  2EE8 A;  4KHP E;  1X47 A;  3ZOQ B;  2EL6 A;  2JYA A;  4NXM E;  1PJT A;  2IHR 1;  1YFH A;  4GKK E;  2DSY A;  2NA2 A;  1DGC A;  2EL4 A;  4LF5 E;  4R2E A;  3F6H A;  1X48 A;  3C4B A;  1AAY A;  4ZYH A;  2EPM X;  2KON A;  1XMO E;  4LFC E;  2LO3 A;  1RMD A;  1RC7 A;  1HNW E;  2CTD A;  4BMJ A;  2LBS B;  3H09 A;  4DUZ E;  1XMQ E;  4WXC A;  2JOB A;  4Q28 A;  2LCE A;  1STU A;  2LJH A;  2EOJ A;  1RQ0 A;  2RS6 A;  1ZAA C;  2EMA A;  5IWA E;  2E5L E;  1YUI A;  2L2M A;  5KL2 A;  2YPN A; 
#chains in the Genus database with same CATH homology
 2MDG A;  1A1L A;  2YRM A;  2YTI A;  1LLM C;  2EM5 A;  2EMF A;  3VHT B;  2EMB A;  3M99 B;  2HGH A;  4GZN C;  2EPZ A;  2YTF A;  2EOH A;  3EPL A;  4F2J C;  4R2D A;  1BB8 A;  2EN3 A;  1JK2 A;  2EM9 A;  4R2R A;  3UK3 C;  2YRK A;  2EOS A;  4IS1 C;  2JP9 A;  2WBS A;  4FK5 C;  2BB8 A;  4IJD A;  5KL7 A;  2EN6 A;  1B69 A;  2VRD A;  2ENC A;  2EMI A;  1WJP A;  2EP3 A;  1YSA C;  2EOI A;  2YTG A;  2ENA A;  2EM7 A;  2LV2 A;  2EMZ A;  2CT1 A;  2EN2 A;  2EOE A;  2YRH A;  2EOZ A;  3MHS C;  2I13 A;  2RPC A;  2EOO A;  2MKD A;  5KL4 A;  4R2S A;  2DGC A;  1X6H A;  2EPC A;  2EN8 A;  2CSH A;  2EMX A;  2EQ0 A;  3MHH C;  1YUJ A;  2EOQ A;  1NCS A;  4F6N A;  1A1G A;  2EM0 A;  2RSI A;  2GLI A;  2EN1 A;  1TN9 A;  2EOF A;  2YTO A;  5KL5 A;  2DLQ A;  2JPA A;  1X6F A;  2EOM A;  2EOX A;  4R2C A;  1A1H A;  2YTP A;  2EOY A;  2EOR A;  2EMY A;  1P47 A;  1BBO A;  2WCC 3;  2EM3 A;  1MEY C;  4R2Q A;  2D9H A;  2EPR A;  2EPA A;  2A25 A;  2WBU A;  1X6E A;  2NAB A;  2EMC A;  1F2I G;  2DRP A;  2EM8 A;  2LVH A;  2DLK A;  2EN7 A;  2ELZ A;  2YTD A;  1ZU1 A;  2EQ3 A;  1G2D C;  2EM4 A;  4R2A A;  4R2P A;  2YTQ A;  2EE8 A;  2ENH A;  2EM6 A;  1X5W A;  3EPH A;  1A1J A;  2EPP A;  1X3C A;  1UN6 B;  2EL6 A;  5KL6 A;  2YTE A;  3EPJ A;  1TF3 A;  2DMI A;  2EQ1 A;  4WSG A;  2ADR A;  2YU8 A;  2EPX A;  1DGC A;  2EL4 A;  2EN4 A;  4R2E A;  1ZR9 A;  2R1F A;  4X9J A;  2ELY A;  2WBT A;  1AAY A;  2EM2 A;  2YU5 A;  1A1F A;  2EMG A;  2YTN A;  2LO3 A;  1RMD A;  2CTD A;  1TF6 A;  2EJ4 A;  2LT7 A;  4M9V C;  1A1I A;  2MKN A;  1UBD C;  2PRT A;  1Z1B A;  1A1K A;  3EPK A;  2LCE A;  1KJK A;  1JK1 A;  2EML A;  2EOJ A;  2J7J A;  2YTJ A;  2EMW A;  2E72 A;  2YSO A;  1ZAA C;  2EMA A;  2GHF A;  2EPU A;  1YUI A;  2M9A A;  5KL2 A;  2EMH A;  2EL5 A;  2EMK A;  1G2F C;  4F6M A;  2YSP A;  5KL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...