4R2SA

Wilms tumor protein (wt1) q369p zinc fingers in complex with methylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
SEKPYQCDFKDCERRFSRSDPLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2sA00
2EOIA 1NCSA 2EMYA 2LT7A 1Z1BA 1BB8A 2DLKA 4F6MA 2EM5A 2EL5A 2YU5A 2EQ3A 4IJDA 2HGHA 2EJ4A 2EL6A 3MHSC 1A1LA 2ENCA 1LLMC 1BBOA 1UBDC 2EMFA 1UN6B 2EOEA 2GLIA 2EPAA 1DGCA 2DGCA 2WBTA 2YU8A 1F2IG 2YTPA 2CT1A 2EMZA 2RPCA 2EN3A 2NABA 1YSAC 2EMAA 1AAYA 2EPUA 2YTJA 2EMLA 2WBSA 2ELYA 2EM0A 2YRHA 3MHHC 2EOMA 4FK5C 4R2RA 4R2EA 2EMXA 2YRKA 1TF6A 2EOHA 2MKDA 5KL5A 2EOJA 2YSOA 2EM3A 1G2DC 2EOXA 4R2AA 2MDGA 4GZNC 2MKNA 2ADRA 1ZU1A 2ELZA 2EPXA 1B69A 2R1FA 2EE8A 2EMGA 2EMBA 2EP3A 2DLQA 4WSGA 1A1GA 2YTNA 2EOZA 4F2JC 2EPPA 3UK3C 1JK2A 2JPAA 1KJKA 2ENAA 4R2DA 4X9JA 2EPCA 2EN7A 1RMDA 2RSIA 2LO3A 3VHTB 2YTDA 2EN2A 3EPHA 3EPJA 3EPLA 2WBUA 2EOYA 1X6FA 2EOOA 2M9AA 4M9VC 2CSHA 5KL2A 2EOQA 2EORA 2YTIA 1ZAAC 2EQ1A 4R2SA 2EOSA 1ZR9A 2J7JA 2PRTA 2YTOA 1G2FC 2LVHA 2JP9A 2LCEA 1TN9A 2EMIA 1X6EA 2BB8A 2EMWA 2LV2A 2EN8A 4IS1C 2DRPA 1X5WA 2YTEA 1WJPA 2EMCA 2EM2A 2YSPA 2EM9A 2EN1A 2EM8A 2DMIA 2EN6A 1A1IA 4R2PA 2VRDA 5KL7A 1A1HA 2YRMA 5KL3A 4F6NA 2EPRA 1A1KA 1MEYC 2D9HA 2YTFA 1X6HA 2EOFA 2EM4A 2EN4A 2EPZA 3M99B 2I13A 1X3CA 2EM7A 2EQ0A 1YUIA 2EM6A 1YUJA 2EMHA 2A25A 2YTQA 3EPKA 2ENHA 1JK1A 1A1FA 2CTDA 4R2CA 5KL4A 2WCC3 4R2QA 2YTGA 1A1JA 2GHFA 1TF3A 2EL4A 5KL6A 1P47A 2E72A 2EMKA
chains in the Genus database with same CATH superfamily
1NCSA 3JU0A 1Z1BA 2H36X 1FJGE 2KONA 4P78A 2RQLA 3HPZA 3J7AG 2JYAA 1UILA 2ENCA 4DV1E 1LLMC 1STUA 3C6MA 1ZBQA 2GLIA 4X66E 1DGCA 2YU8A 1PDAA 2EN3A 4LFAE 2NABA 1T39A 4OOGC 4P7DA 1UHZA 2EPUA 2YPNA 2CPNA 4X65E 2RS7A 2B7VA 4O5GA 2DSYA 4LF6E 5LMNE 2RS6A 1DQ3A 1TF6A 5AE1A 2JWOA 2EOJA 4GZNC 1N36E 2MKNA 1ZU1A 2UUCE 2EPXA 1IBKE 1B69A 5T6JA 4DR4E 5A6BD 3TQMA 4YY3E 2LRSA 3ZOQB 3AUZA 2KHXA 4B3RE 1PKPA 4F2JC 1QU6A 2EPPA 3ADJA 1NEIA 2ENAA 2DIXA 4JI6E 2EN7A 1PJTA 1RMDA 3KWRA 2LO3A 3K6QA 3VHTB 2YTDA 2EN2A 3EPJA 3EPLA 2WBUA 1YYOA 2EOOA 4LF8E 2M9AA 4DKKA 4M9VC 5KL2A 4NXME 4LF5E 4WXDA 4F54A 2EOSA 4I8OA 2LVHA 1J5EE 4J8ZA 2N8XA 4WSPA 2BB8A 2B9DA 2LV2A 2DRPA 2Q8UA 2V83A 3BBGA 2UU9E 3LLHA 4MLQA 2DMIA 4R2PA 2ODRC 5KL7A 1A1HA 3ECRA 5DNYA 2B3TB 2D9HA 2EM4A 4X8WA 1X3CA 4B3ME 1XNQE 4L5NC 4KHPE 2ENHA 1IQOA 1A1JA 3C4TA 5LMUE 2E72A 2K7IA 4IS1C 4WFTA 2EMYA 1BB8A 4BBYA 4DR2E 2L33A 4F6MA 4IJDA 2EJ4A 2LJUA 3MHSC 1A1LA 5CFFE 1UBDC 4NHRA 1KYQA 3JTZA 5A6KA 4BHCA 3VYYA 5IWAE 2N3GA 1F2IG 5AC5A 2YTPA 2EMZA 4HEIA 2RPCA 1GQEA 5A69A 2EPLX 2FTXB 1WRJA 2WBSA 2ELYA 2L3CA 2YRHA 1PJSA 3DF6A 1FKAE 4M30A 4R2RA 4R2EA 4JI8E 5AC4A 1YPNA 3F6HA 4GKJE 2EM3A 2MDGA 3QG5C 4DR6E 2ADRA 4ZYHA 2F4VE 2M4IA 3T1YE 4DV3E 2EMBA 5IXMB 5AASA 2EP3A 4WSGA 2LBSB 1A1GA 4DUZE 3VK6A 2EOZA 2K4VA 4LF9E 4JI3E 4R2DA 1EH8A 1PJQA 2RSIA 4K0KE 4F9BB 3EPHA 2LMZA 2EOYA 1HNWE 4RHBB 4B3SE 2YZTA 2HHHE 3DJWA 2LJHA 1X48A 3J80C 3ADIA 2JP9A 2LCEA 2M1SA 2L6MA 2UUAE 2EMIA 3BGHA 2EMWA 1XMOE 1YYKA 4O43A 2YTEA 1YZ9A 1MGTA 5ADZA 1WJPA 2EM9A 4DV4E 2EWLA 2EN6A 3HXLA 4DR7E 1DI2A 4WX9A 1A1KA 1MEYC 2L2MA 3M99B 2EOFA 2L92A 2EN4A 2VE7C 2LE2A 2M7QA 2VQEE 3HPSA 4BHBA 2I13A 2EM7A 4GEQB 2A25A 1A1FA 4Q35B 2DMYA 2NUGA 4DV0E 2MDRA 2NUFA 2L8TA 2FV4B 2EMKA 3HQ1A 2EOIA 2LUPB 2LT7A 2ODRD 2UXCE 2N3HA 3ADGA 2EM5A 5A6BA 2EL5A 2EZ6A 1ZBTA 2EQ3A 2HGHA 4HTGA 5IT9C 5BR8E 4B3TE 1UN6B 2EOEA 3LMLA 2RTXA 2DGCA 2EPMX 2WBTA 3IWCA 2HJJA 1YSAC 2UXBE 2EMAA 1AAYA 2YTJA 2YWQA 4DV6E 3BIDA 2V88A 2EM0A 3OTOE 2LUQA 2JOXA 4GKKE 3THNA 1XNRE 1XMQE 2EMXA 2YRKA 2YT4A 5A6AA 2EOHA 2MKDA 4F9CB 4R8OA 2R76A 2UXDE 2YSOA 4LF4E 1G2DC 2EOXA 5A6JA 4R2AA 2ELZA 4X62E 1IMUA 1T4LB 2VF1A 4M0VA 2LTRA 2R1FA 4LU9A 4NXNE 4ZYGA 2YTNA 2V85A 4NZVA 4BC9A 3UK3C 1X47A 1JK2A 2JPAA 1KJKA 2VQFE 4JI7E 3KZZA 4BCAA 2EPCA 1WXRA 1QNTA 2G7HA 2EPOA 1HNZE 2JVAA 2WZOA 3T1HE 4JI0E 1HR0E 1T4NA 4LFCE 4DV7E 1GZ6A 1ZAAC 1I94E 2EQ1A 2RSMA 1IQSA 1WHQA 2YTOA 3AV0A 2JY9A 2KOUA 1YFHA 1TN9A 2IHR1 5IV8B 4Q28A 4DR3E 2EN8A 1X5WA 4RH8A 5AE3A 2EMCA 4ZYDA 1EH6A 2EM8A 4WYQB 4OX9E 3C4BA 3H09A 2E1MA 5KL3A 4F6NA 2FGGA 2NUEA 4X64E 4DMIA 4DR5E 2EQ0A 4DR1E 1YUJA 4R03A 2L3JA 2JXPA 3L00A 1JK1A 1O0WA 4BC7A 5KL4A 4JI2E 2GHFA 3JAMC 3P1XA 2EM2A 4N4RB 4JI1E 5F3WA 2DB2A 4AQYE 4ZYEA 2V89A 2DLKA 3EQ1A 4TUGA 2UUBE 4TUIA 4M2ZA 2YU5A 2B7TA 3FIGA 2EL6A 1N34E 3IWDA 1BBOA 1N3GA 2EMFA 2L2KB 4JI5E 2EPAA 1RQ0A 3IWBA 4O4KA 1SFEA 2CT1A 4JI4E 1HNXE 4WXCA 4LFBE 3OMLA 5LLQA 4L8NA 2EMLA 3THOB 5FLXC 1BBGA 2HC5A 3MHHC 3J81C 2EOMA 4DV2E 2MC5A 4FK5C 1T38A 4BMJA 2E5LE 3HTXA 2EPKX 4YHHE 5KL5A 4DUYE 1RC7A 3VYXA 3MSWA 2EE8A 1EKZA 2EMGA 1IBME 2DLQA 3RMPA 3C6KA 5TSEA 5AE2A 1YYWA 3F6GA 4X9JA 2LTSA 2ZM6E 4LTYA 2MC6A 2V86A 1J26A 3ADLA 2I9IA 4KZSA 1X6FA 1T4OA 4KWYA 4F9AB 4DV5E 2CSHA 2F8BA 2EOQA 2EORA 2YTIA 3BF2A 4R2SA 4WPYA 1ZR9A 2J7JA 2PRTA 1G2FC 1WHNA 1X6EA 2EPNA 4BS9A 1IBLE 3KZYA 2L2NA 1X49A 4JYAE 1SR9A 2YSPA 2NA2A 1N32E 2EN1A 2GPIA 1A1IA 4JV5E 2V87A 2VRDA 2BBGA 2JOBA 2YRMA 3J7Yp 2EPRA 2YTFA 1X6HA 2EPZA 4MLVA 4O24A 1YUIA 5A2QC 2EM6A 2EMHA 2YTQA 1EH7A 3EPKA 1L4SA 1N33E 2CTDA 4LF7E 4R2CA 2WCC3 4R2QA 1GTKA 2YTGA 2JR1A 1TF3A 2EL4A 1AH5A 5KL6A 5LL6R 2V8QB 1P47A
chains in the Genus database with same CATH topology
2EOIA 1NCSA 2EMYA 2LT7A 1Z1BA 1BB8A 2DLKA 4F6MA 2EM5A 2EL5A 2YU5A 2EQ3A 4IJDA 2HGHA 2EJ4A 2EL6A 3MHSC 1A1LA 2ENCA 1LLMC 1BBOA 1UBDC 2EMFA 1UN6B 2EOEA 2GLIA 2EPAA 1DGCA 2DGCA 2WBTA 2YU8A 1F2IG 2YTPA 2CT1A 2EMZA 2RPCA 2EN3A 2NABA 1YSAC 2EMAA 1AAYA 2EPUA 2YTJA 2EMLA 2WBSA 2ELYA 2EM0A 2YRHA 3MHHC 2EOMA 4FK5C 4R2RA 4R2EA 2EMXA 2YRKA 1TF6A 2EOHA 2MKDA 5KL5A 2EOJA 2YSOA 2EM3A 1G2DC 2EOXA 4R2AA 2MDGA 4GZNC 2MKNA 2ADRA 1ZU1A 2ELZA 2EPXA 1B69A 2R1FA 2EE8A 2EMGA 2EMBA 2EP3A 2DLQA 4WSGA 1A1GA 2YTNA 2EOZA 4F2JC 2EPPA 3UK3C 1JK2A 2JPAA 1KJKA 2ENAA 4R2DA 4X9JA 2EPCA 2EN7A 1RMDA 2RSIA 2LO3A 3VHTB 2YTDA 2EN2A 3EPHA 3EPJA 3EPLA 2WBUA 2EOYA 1X6FA 2EOOA 2M9AA 4M9VC 2CSHA 5KL2A 2EOQA 2EORA 2YTIA 1ZAAC 2EQ1A 4R2SA 2EOSA 1ZR9A 2J7JA 2PRTA 2YTOA 1G2FC 2LVHA 2JP9A 2LCEA 1TN9A 2EMIA 1X6EA 2BB8A 2EMWA 2LV2A 2EN8A 4IS1C 2DRPA 1X5WA 2YTEA 1WJPA 2EMCA 2EM2A 2YSPA 2EM9A 2EN1A 2EM8A 2DMIA 2EN6A 1A1IA 4R2PA 2VRDA 5KL7A 1A1HA 2YRMA 5KL3A 4F6NA 2EPRA 1A1KA 1MEYC 2D9HA 2YTFA 1X6HA 2EOFA 2EM4A 2EN4A 2EPZA 3M99B 2I13A 1X3CA 2EM7A 2EQ0A 1YUIA 2EM6A 1YUJA 2EMHA 2A25A 2YTQA 3EPKA 2ENHA 1JK1A 1A1FA 2CTDA 4R2CA 5KL4A 2WCC3 4R2QA 2YTGA 1A1JA 2GHFA 1TF3A 2EL4A 5KL6A 1P47A 2E72A 2EMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOI A;  1NCS A;  2EMY A;  2LT7 A;  1Z1B A;  1BB8 A;  2DLK A;  4F6M A;  2EM5 A;  2EL5 A;  2YU5 A;  2EQ3 A;  4IJD A;  2HGH A;  2EJ4 A;  2EL6 A;  3MHS C;  1A1L A;  2ENC A;  1LLM C;  1BBO A;  1UBD C;  2EMF A;  1UN6 B;  2EOE A;  2GLI A;  2EPA A;  1DGC A;  2DGC A;  2WBT A;  2YU8 A;  1F2I G;  2YTP A;  2CT1 A;  2EMZ A;  2RPC A;  2EN3 A;  2NAB A;  1YSA C;  2EMA A;  1AAY A;  2EPU A;  2YTJ A;  2EML A;  2WBS A;  2ELY A;  2EM0 A;  2YRH A;  3MHH C;  2EOM A;  4FK5 C;  4R2R A;  4R2E A;  2EMX A;  2YRK A;  1TF6 A;  2EOH A;  2MKD A;  5KL5 A;  2EOJ A;  2YSO A;  2EM3 A;  1G2D C;  2EOX A;  4R2A A;  2MDG A;  4GZN C;  2MKN A;  2ADR A;  1ZU1 A;  2ELZ A;  2EPX A;  1B69 A;  2R1F A;  2EE8 A;  2EMG A;  2EMB A;  2EP3 A;  2DLQ A;  4WSG A;  1A1G A;  2YTN A;  2EOZ A;  4F2J C;  2EPP A;  3UK3 C;  1JK2 A;  2JPA A;  1KJK A;  2ENA A;  4R2D A;  4X9J A;  2EPC A;  2EN7 A;  1RMD A;  2RSI A;  2LO3 A;  3VHT B;  2YTD A;  2EN2 A;  3EPH A;  3EPJ A;  3EPL A;  2WBU A;  2EOY A;  1X6F A;  2EOO A;  2M9A A;  4M9V C;  2CSH A;  5KL2 A;  2EOQ A;  2EOR A;  2YTI A;  1ZAA C;  2EQ1 A;  4R2S A;  2EOS A;  1ZR9 A;  2J7J A;  2PRT A;  2YTO A;  1G2F C;  2LVH A;  2JP9 A;  2LCE A;  1TN9 A;  2EMI A;  1X6E A;  2BB8 A;  2EMW A;  2LV2 A;  2EN8 A;  4IS1 C;  2DRP A;  1X5W A;  2YTE A;  1WJP A;  2EMC A;  2EM2 A;  2YSP A;  2EM9 A;  2EN1 A;  2EM8 A;  2DMI A;  2EN6 A;  1A1I A;  4R2P A;  2VRD A;  5KL7 A;  1A1H A;  2YRM A;  5KL3 A;  4F6N A;  2EPR A;  1A1K A;  1MEY C;  2D9H A;  2YTF A;  1X6H A;  2EOF A;  2EM4 A;  2EN4 A;  2EPZ A;  3M99 B;  2I13 A;  1X3C A;  2EM7 A;  2EQ0 A;  1YUI A;  2EM6 A;  1YUJ A;  2EMH A;  2A25 A;  2YTQ A;  3EPK A;  2ENH A;  1JK1 A;  1A1F A;  2CTD A;  4R2C A;  5KL4 A;  2WCC 3;  4R2Q A;  2YTG A;  1A1J A;  2GHF A;  1TF3 A;  2EL4 A;  5KL6 A;  1P47 A;  2E72 A;  2EMK A; 
#chains in the Genus database with same CATH topology
 1NCS A;  3JU0 A;  1Z1B A;  2H36 X;  1FJG E;  2KON A;  4P78 A;  2RQL A;  3HPZ A;  3J7A G;  2JYA A;  1UIL A;  2ENC A;  4DV1 E;  1LLM C;  1STU A;  3C6M A;  1ZBQ A;  2GLI A;  4X66 E;  1DGC A;  2YU8 A;  1PDA A;  2EN3 A;  4LFA E;  2NAB A;  1T39 A;  4OOG C;  4P7D A;  1UHZ A;  2EPU A;  2YPN A;  2CPN A;  4X65 E;  2RS7 A;  2B7V A;  4O5G A;  2DSY A;  4LF6 E;  5LMN E;  2RS6 A;  1DQ3 A;  1TF6 A;  5AE1 A;  2JWO A;  2EOJ A;  4GZN C;  1N36 E;  2MKN A;  1ZU1 A;  2UUC E;  2EPX A;  1IBK E;  1B69 A;  5T6J A;  4DR4 E;  5A6B D;  3TQM A;  4YY3 E;  2LRS A;  3ZOQ B;  3AUZ A;  2KHX A;  4B3R E;  1PKP A;  4F2J C;  1QU6 A;  2EPP A;  3ADJ A;  1NEI A;  2ENA A;  2DIX A;  4JI6 E;  2EN7 A;  1PJT A;  1RMD A;  3KWR A;  2LO3 A;  3K6Q A;  3VHT B;  2YTD A;  2EN2 A;  3EPJ A;  3EPL A;  2WBU A;  1YYO A;  2EOO A;  4LF8 E;  2M9A A;  4DKK A;  4M9V C;  5KL2 A;  4NXM E;  4LF5 E;  4WXD A;  4F54 A;  2EOS A;  4I8O A;  2LVH A;  1J5E E;  4J8Z A;  2N8X A;  4WSP A;  2BB8 A;  2B9D A;  2LV2 A;  2DRP A;  2Q8U A;  2V83 A;  3BBG A;  2UU9 E;  3LLH A;  4MLQ A;  2DMI A;  4R2P A;  2ODR C;  5KL7 A;  1A1H A;  3ECR A;  5DNY A;  2B3T B;  2D9H A;  2EM4 A;  4X8W A;  1X3C A;  4B3M E;  1XNQ E;  4L5N C;  4KHP E;  2ENH A;  1IQO A;  1A1J A;  3C4T A;  5LMU E;  2E72 A;  2K7I A;  4IS1 C;  4WFT A;  2EMY A;  1BB8 A;  4BBY A;  4DR2 E;  2L33 A;  4F6M A;  4IJD A;  2EJ4 A;  2LJU A;  3MHS C;  1A1L A;  5CFF E;  1UBD C;  4NHR A;  1KYQ A;  3JTZ A;  5A6K A;  4BHC A;  3VYY A;  5IWA E;  2N3G A;  1F2I G;  5AC5 A;  2YTP A;  2EMZ A;  4HEI A;  2RPC A;  1GQE A;  5A69 A;  2EPL X;  2FTX B;  1WRJ A;  2WBS A;  2ELY A;  2L3C A;  2YRH A;  1PJS A;  3DF6 A;  1FKA E;  4M30 A;  4R2R A;  4R2E A;  4JI8 E;  5AC4 A;  1YPN A;  3F6H A;  4GKJ E;  2EM3 A;  2MDG A;  3QG5 C;  4DR6 E;  2ADR A;  4ZYH A;  2F4V E;  2M4I A;  3T1Y E;  4DV3 E;  2EMB A;  5IXM B;  5AAS A;  2EP3 A;  4WSG A;  2LBS B;  1A1G A;  4DUZ E;  3VK6 A;  2EOZ A;  2K4V A;  4LF9 E;  4JI3 E;  4R2D A;  1EH8 A;  1PJQ A;  2RSI A;  4K0K E;  4F9B B;  3EPH A;  2LMZ A;  2EOY A;  1HNW E;  4RHB B;  4B3S E;  2YZT A;  2HHH E;  3DJW A;  2LJH A;  1X48 A;  3J80 C;  3ADI A;  2JP9 A;  2LCE A;  2M1S A;  2L6M A;  2UUA E;  2EMI A;  3BGH A;  2EMW A;  1XMO E;  1YYK A;  4O43 A;  2YTE A;  1YZ9 A;  1MGT A;  5ADZ A;  1WJP A;  2EM9 A;  4DV4 E;  2EWL A;  2EN6 A;  3HXL A;  4DR7 E;  1DI2 A;  4WX9 A;  1A1K A;  1MEY C;  2L2M A;  3M99 B;  2EOF A;  2L92 A;  2EN4 A;  2VE7 C;  2LE2 A;  2M7Q A;  2VQE E;  3HPS A;  4BHB A;  2I13 A;  2EM7 A;  4GEQ B;  2A25 A;  1A1F A;  4Q35 B;  2DMY A;  2NUG A;  4DV0 E;  2MDR A;  2NUF A;  2L8T A;  2FV4 B;  2EMK A;  3HQ1 A;  2EOI A;  2LUP B;  2LT7 A;  2ODR D;  2UXC E;  2N3H A;  3ADG A;  2EM5 A;  5A6B A;  2EL5 A;  2EZ6 A;  1ZBT A;  2EQ3 A;  2HGH A;  4HTG A;  5IT9 C;  5BR8 E;  4B3T E;  1UN6 B;  2EOE A;  3LML A;  2RTX A;  2DGC A;  2EPM X;  2WBT A;  3IWC A;  2HJJ A;  1YSA C;  2UXB E;  2EMA A;  1AAY A;  2YTJ A;  2YWQ A;  4DV6 E;  3BID A;  2V88 A;  2EM0 A;  3OTO E;  2LUQ A;  2JOX A;  4GKK E;  3THN A;  1XNR E;  1XMQ E;  2EMX A;  2YRK A;  2YT4 A;  5A6A A;  2EOH A;  2MKD A;  4F9C B;  4R8O A;  2R76 A;  2UXD E;  2YSO A;  4LF4 E;  1G2D C;  2EOX A;  5A6J A;  4R2A A;  2ELZ A;  4X62 E;  1IMU A;  1T4L B;  2VF1 A;  4M0V A;  2LTR A;  2R1F A;  4LU9 A;  4NXN E;  4ZYG A;  2YTN A;  2V85 A;  4NZV A;  4BC9 A;  3UK3 C;  1X47 A;  1JK2 A;  2JPA A;  1KJK A;  2VQF E;  4JI7 E;  3KZZ A;  4BCA A;  2EPC A;  1WXR A;  1QNT A;  2G7H A;  2EPO A;  1HNZ E;  2JVA A;  2WZO A;  3T1H E;  4JI0 E;  1HR0 E;  1T4N A;  4LFC E;  4DV7 E;  1GZ6 A;  1ZAA C;  1I94 E;  2EQ1 A;  2RSM A;  1IQS A;  1WHQ A;  2YTO A;  3AV0 A;  2JY9 A;  2KOU A;  1YFH A;  1TN9 A;  2IHR 1;  5IV8 B;  4Q28 A;  4DR3 E;  2EN8 A;  1X5W A;  4RH8 A;  5AE3 A;  2EMC A;  4ZYD A;  1EH6 A;  2EM8 A;  4WYQ B;  4OX9 E;  3C4B A;  3H09 A;  2E1M A;  5KL3 A;  4F6N A;  2FGG A;  2NUE A;  4X64 E;  4DMI A;  4DR5 E;  2EQ0 A;  4DR1 E;  1YUJ A;  4R03 A;  2L3J A;  2JXP A;  3L00 A;  1JK1 A;  1O0W A;  4BC7 A;  5KL4 A;  4JI2 E;  2GHF A;  3JAM C;  3P1X A;  2EM2 A;  4N4R B;  4JI1 E;  5F3W A;  2DB2 A;  4AQY E;  4ZYE A;  2V89 A;  2DLK A;  3EQ1 A;  4TUG A;  2UUB E;  4TUI A;  4M2Z A;  2YU5 A;  2B7T A;  3FIG A;  2EL6 A;  1N34 E;  3IWD A;  1BBO A;  1N3G A;  2EMF A;  2L2K B;  4JI5 E;  2EPA A;  1RQ0 A;  3IWB A;  4O4K A;  1SFE A;  2CT1 A;  4JI4 E;  1HNX E;  4WXC A;  4LFB E;  3OML A;  5LLQ A;  4L8N A;  2EML A;  3THO B;  5FLX C;  1BBG A;  2HC5 A;  3MHH C;  3J81 C;  2EOM A;  4DV2 E;  2MC5 A;  4FK5 C;  1T38 A;  4BMJ A;  2E5L E;  3HTX A;  2EPK X;  4YHH E;  5KL5 A;  4DUY E;  1RC7 A;  3VYX A;  3MSW A;  2EE8 A;  1EKZ A;  2EMG A;  1IBM E;  2DLQ A;  3RMP A;  3C6K A;  5TSE A;  5AE2 A;  1YYW A;  3F6G A;  4X9J A;  2LTS A;  2ZM6 E;  4LTY A;  2MC6 A;  2V86 A;  1J26 A;  3ADL A;  2I9I A;  4KZS A;  1X6F A;  1T4O A;  4KWY A;  4F9A B;  4DV5 E;  2CSH A;  2F8B A;  2EOQ A;  2EOR A;  2YTI A;  3BF2 A;  4R2S A;  4WPY A;  1ZR9 A;  2J7J A;  2PRT A;  1G2F C;  1WHN A;  1X6E A;  2EPN A;  4BS9 A;  1IBL E;  3KZY A;  2L2N A;  1X49 A;  4JYA E;  1SR9 A;  2YSP A;  2NA2 A;  1N32 E;  2EN1 A;  2GPI A;  1A1I A;  4JV5 E;  2V87 A;  2VRD A;  2BBG A;  2JOB A;  2YRM A;  3J7Y p;  2EPR A;  2YTF A;  1X6H A;  2EPZ A;  4MLV A;  4O24 A;  1YUI A;  5A2Q C;  2EM6 A;  2EMH A;  2YTQ A;  1EH7 A;  3EPK A;  1L4S A;  1N33 E;  2CTD A;  4LF7 E;  4R2C A;  2WCC 3;  4R2Q A;  1GTK A;  2YTG A;  2JR1 A;  1TF3 A;  2EL4 A;  1AH5 A;  5KL6 A;  5LL6 R;  2V8Q B;  1P47 A; 
#chains in the Genus database with same CATH homology
 2EOI A;  1NCS A;  2EMY A;  2LT7 A;  1Z1B A;  1BB8 A;  2DLK A;  4F6M A;  2EM5 A;  2EL5 A;  2YU5 A;  2EQ3 A;  4IJD A;  2HGH A;  2EJ4 A;  2EL6 A;  3MHS C;  1A1L A;  2ENC A;  1LLM C;  1BBO A;  1UBD C;  2EMF A;  1UN6 B;  2EOE A;  2GLI A;  2EPA A;  1DGC A;  2DGC A;  2WBT A;  2YU8 A;  1F2I G;  2YTP A;  2CT1 A;  2EMZ A;  2RPC A;  2EN3 A;  2NAB A;  1YSA C;  2EMA A;  1AAY A;  2EPU A;  2YTJ A;  2EML A;  2WBS A;  2ELY A;  2EM0 A;  2YRH A;  3MHH C;  2EOM A;  4FK5 C;  4R2R A;  4R2E A;  2EMX A;  2YRK A;  1TF6 A;  2EOH A;  2MKD A;  5KL5 A;  2EOJ A;  2YSO A;  2EM3 A;  1G2D C;  2EOX A;  4R2A A;  2MDG A;  4GZN C;  2MKN A;  2ADR A;  1ZU1 A;  2ELZ A;  2EPX A;  1B69 A;  2R1F A;  2EE8 A;  2EMG A;  2EMB A;  2EP3 A;  2DLQ A;  4WSG A;  1A1G A;  2YTN A;  2EOZ A;  4F2J C;  2EPP A;  3UK3 C;  1JK2 A;  2JPA A;  1KJK A;  2ENA A;  4R2D A;  4X9J A;  2EPC A;  2EN7 A;  1RMD A;  2RSI A;  2LO3 A;  3VHT B;  2YTD A;  2EN2 A;  3EPH A;  3EPJ A;  3EPL A;  2WBU A;  2EOY A;  1X6F A;  2EOO A;  2M9A A;  4M9V C;  2CSH A;  5KL2 A;  2EOQ A;  2EOR A;  2YTI A;  1ZAA C;  2EQ1 A;  4R2S A;  2EOS A;  1ZR9 A;  2J7J A;  2PRT A;  2YTO A;  1G2F C;  2LVH A;  2JP9 A;  2LCE A;  1TN9 A;  2EMI A;  1X6E A;  2BB8 A;  2EMW A;  2LV2 A;  2EN8 A;  4IS1 C;  2DRP A;  1X5W A;  2YTE A;  1WJP A;  2EMC A;  2EM2 A;  2YSP A;  2EM9 A;  2EN1 A;  2EM8 A;  2DMI A;  2EN6 A;  1A1I A;  4R2P A;  2VRD A;  5KL7 A;  1A1H A;  2YRM A;  5KL3 A;  4F6N A;  2EPR A;  1A1K A;  1MEY C;  2D9H A;  2YTF A;  1X6H A;  2EOF A;  2EM4 A;  2EN4 A;  2EPZ A;  3M99 B;  2I13 A;  1X3C A;  2EM7 A;  2EQ0 A;  1YUI A;  2EM6 A;  1YUJ A;  2EMH A;  2A25 A;  2YTQ A;  3EPK A;  2ENH A;  1JK1 A;  1A1F A;  2CTD A;  4R2C A;  5KL4 A;  2WCC 3;  4R2Q A;  2YTG A;  1A1J A;  2GHF A;  1TF3 A;  2EL4 A;  5KL6 A;  1P47 A;  2E72 A;  2EMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...