4R2SA

Wilms tumor protein (wt1) q369p zinc fingers in complex with methylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
SEKPYQCDFKDCERRFSRSDPLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2sA00
2EPCA 4R2PA 2CTDA 2YTFA 2EOIA 1MEYC 2EQ0A 2E72A 4X9JA 2DGCA 1UN6B 2EOZA 2YTOA 2WBUA 2EOMA 1YUJA 1G2DC 1BBOA 2EMCA 2J7JA 2VRDA 3EPJA 4F2JC 3EPHA 2PRTA 2YRMA 1A1FA 2EN2A 1LLMC 2R1FA 2GHFA 1WJPA 2EOEA 2LT7A 1AAYA 2ENHA 2EN3A 2YTIA 4FK5C 1F2IG 2I13A 1NCSA 2EN8A 1A1IA 2EM0A 2EOFA 2EORA 1YSAC 2YU5A 1RMDA 2EOQA 2YSOA 2YTQA 2EMAA 2EMXA 2JPAA 2EMWA 3MHHC 1ZR9A 3M99B 1P47A 4R2QA 2A25A 2YTEA 3UK3C 2HGHA 2EMZA 2EQ3A 2WBSA 1TF6A 1X5WA 4R2EA 2EM2A 4IJDA 1A1HA 2EM5A 2EM9A 2EOSA 2NABA 2EM6A 2CSHA 2CT1A 2JP9A 4F6NA 2EPPA 2EMHA 2M9AA 2EOXA 4R2RA 2EMLA 4R2AA 2EPZA 2LO3A 1A1GA 2BB8A 2EMBA 1JK1A 2GLIA 1Z1BA 1DGCA 5KL7A 2YU8A 1TF3A 1B69A 1BB8A 2EL4A 2YRKA 1X6FA 2EQ1A 2ENAA 2EL6A 2EM4A 2DLQA 4R2SA 1ZAAC 2MDGA 2YTJA 2MKNA 2DLKA 3EPKA 2DRPA 2ENCA 1A1JA 2YTNA 3MHSC 2EMYA 2YSPA 2ELZA 1JK2A 1A1LA 2D9HA 3VHTB 2EM8A 2EMKA 2LV2A 1X3CA 2EMIA 2EPRA 2LVHA 5KL2A 1KJKA 1A1KA 2EM7A 2EM3A 2EMFA 2MKDA 2RPCA 2EOHA 2EN7A 4IS1C 2EOOA 2YRHA 1G2FC 3EPLA 2RSIA 2EE8A 2EOYA 2EPXA 1TN9A 5KL4A 4F6MA 4R2CA 2EMGA 2DMIA 2EPUA 2EN1A 2EOJA 2LCEA 1X6EA 2WCC3 2YTDA 4R2DA 2WBTA 4GZNC 2EN6A 1UBDC 1ZU1A 2ELYA 2EJ4A 1X6HA 5KL6A 5KL5A 2EN4A 2EP3A 2YTGA 4WSGA 5KL3A 2YTPA 2ADRA 2EL5A 1YUIA 2EPAA 4M9VC
chains in the Genus database with same CATH superfamily
3JTZA 2CTDA 2DGCA 1HNWE 2YTOA 2EOMA 3JAMC 2EMCA 4F2JC 1A1FA 4LU9A 2HHHE 5AE1A 2VQFE 2EN3A 4FK5C 1F2IG 1EH7A 2EN8A 2RQLA 2EORA 2YU5A 2NUFA 1WHNA 5AASA 2UXDE 2MDRA 4DUYE 2L2NA 2VE7C 4M0VA 1J5EE 2EMWA 2LBSB 4DR4E 4BHCA 3DF6A 1BBGA 4O4KA 5DNYA 1J26A 1P47A 4BBYA 4R2QA 4JI8E 1TF6A 2UUAE 3JU0A 2LJUA 1O0WA 3P1XA 2CT1A 4DV5E 1IBME 1PDAA 2EOXA 2ODRD 2EMLA 2V89A 2JYAA 5IT9C 3BGHA 4LF6E 2YU8A 2EWLA 4X65E 1WHQA 2UXCE 2EQ1A 2KOUA 4LF5E 4DR2E 2E5LE 4R8OA 4K0KE 3LMLA 4NXNE 2MKNA 5IXMB 5A69A 2DLKA 3EPKA 1SR9A 1MGTA 3AUZA 2EMYA 4BHBA 4WXCA 1IBLE 2EM8A 5IV8B 2LV2A 4LFBE 4B3SE 2DSYA 4J8ZA 1KJKA 1GQEA 4DR3E 2M1SA 1PKPA 2EM7A 1IMUA 3L00A 4GKJE 5TSEA 3VYYA 2JOBA 2LRSA 2EOHA 2EOOA 1G2FC 3DJWA 1TN9A 4MLVA 2DMIA 4DUZE 4DV2E 2DMYA 4WYQB 2L3JA 4GZNC 2EN6A 1ZU1A 2EJ4A 2YTGA 4WSGA 2N8XA 5ADZA 2RSMA 5IWAE 4BCAA 1XMOE 2EPAA 2DIXA 4JI4E 2JR1A 2EQ0A 4TUGA 1WXRA 2JOXA 3T1HE 4X9JA 4BMJA 2UXBE 2NA2A 1YUJA 1G2DC 4F9CB 2J7JA 3EPJA 3EPHA 3F6GA 2YRMA 4DR1E 4GEQB 2L2MA 3FIGA 5LL6R 5BR8E 2M4IA 4F54A 2LT7A 2BBGA 1AAYA 1FKAE 2YTIA 2HJJA 4WFTA 4X62E 3RMPA 2EM0A 3VYXA 1YSAC 2V87A 1T38A 2YSOA 2UUCE 2EMXA 2K4VA 5A2QC 2RS7A 3ADGA 3M99B 4BC7A 2LTRA 3UK3C 4JI7E 2EMZA 4JYAE 2EM2A 3LLHA 2EM5A 4L8NA 2EM6A 2NABA 4M30A 1GZ6A 2JP9A 4O5GA 4JI6E 2EPPA 4LF9E 2ZM6E 4R2RA 2UU9E 4N4RB 2V8QB 2GLIA 5KL7A 1B69A 1X6FA 2EL6A 2M7QA 4DR5E 1ZAAC 4O24A 4HEIA 2MDGA 2FV4B 2DRPA 4GKKE 3AV0A 1A1JA 1HR0E 1EKZA 2JY9A 2VQEE 3MHSC 5A6KA 2YSPA 1A1LA 2D9HA 2EMKA 4WPYA 1X3CA 4KHPE 5LMUE 5KL2A 2I9IA 1EH6A 2EM3A 4X66E 2EMFA 2LUPB 1IQSA 5LLQA 2EPKX 2L8TA 4HTGA 5AE2A 2EOYA 4JI0E 2EMGA 2EN1A 2EOJA 2WCC3 2YTDA 3J7Yp 4R2DA 4ZYEA 3KZZA 4YY3E 1X6HA 4DV7E 3KZYA 2EN4A 5KL5A 5A6AA 3HXLA 5KL3A 4I8OA 5F3WA 1YPNA 2CPNA 2MC6A 3HPZA 4M9VC 2EPCA 2EOIA 1MEYC 2E72A 1DI2A 4JI5E 4JV5E 1N34E 2YWQA 4Q35B 2GPIA 2EPOA 2R1FA 1N3GA 2GHFA 1RQ0A 1WJPA 1EH8A 2ENHA 1QNTA 2RS6A 1QU6A 4WXDA 2EOQA 2B7VA 1GTKA 2JPAA 4P78A 1N36E 1ZR9A 2F8BA 1N33E 2E1MA 2A25A 4AQYE 2YTEA 3C4TA 2DB2A 2HGHA 4JI1E 2WBSA 3C6MA 1X48A 1I94E 4R2EA 2K7IA 4IJDA 2R76A 1YYKA 2EM9A 2H36X 2M9AA 1XMQE 4X64E 2YPNA 2EPZA 4KWYA 5CFFE 2LO3A 3J7AG 4R03A 1A1GA 2BB8A 3ECRA 1JK1A 1BB8A 5A6BD 2EL4A 4LF8E 2YRKA 4DV6E 2ENAA 4DV4E 2EM4A 3J81C 2DLQA 1PJQA 2JXPA 4RH8A 3T1YE 4NXME 3ADIA 2EPNA 2YTJA 1T39A 2RTXA 2F4VE 1NEIA 1AH5A 2B7TA 2ENCA 4OOGC 3J80C 4F9BB 3KWRA 2FGGA 3BF2A 4F9AB 1T4NA 4DMIA 4Q28A 2EPRA 2EMIA 2VF1A 5AC5A 4MLQA 2V83A 1A1KA 1PJTA 4DR6E 1X49A 2EN7A 4IS1C 2YRHA 5A6BA 2EPXA 3HTXA 5KL4A 4R2CA 2EPUA 2IHR1 2LCEA 1ZBQA 2WBTA 2FTXB 3ZOQB 1UBDC 1WRJA 1YZ9A 4WSPA 2EP3A 4JI3E 2NUGA 4DR7E 4X8WA 2YTPA 2KHXA 4ZYDA 2L92A 2WBUA 2HC5A 3IWBA 1T4OA 4LFAE 2V86A 4R2PA 2YTFA 3BIDA 3THNA 1IBKE 1UN6B 2EOZA 2L33A 4YHHE 1HNXE 2LJHA 2V85A 1IQOA 1BBOA 4B3TE 2VRDA 2LTSA 2PRTA 5AE3A 1DQ3A 2EN2A 1T4LB 1LLMC 2EOEA 3OMLA 3MSWA 4WX9A 2I13A 1NCSA 1A1IA 2EOFA 2N3GA 2G7HA 1RMDA 2YTQA 4BC9A 3ADJA 2EMAA 1PJSA 4LF4E 3VK6A 3MHHC 1FJGE 2B9DA 3THOB 1YUIA 2L6MA 2LE2A 4DV0E 4P7DA 2EQ3A 4LF7E 2JVAA 4LFCE 1STUA 1X5WA 2YT4A 4B3RE 4NHRA 2EPLX 4M2ZA 5A6JA 1A1HA 1KYQA 2JWOA 2EOSA 2CSHA 4LTYA 3K6QA 3IWDA 4F6NA 4TUIA 2EMHA 4R2AA 3IWCA 2KONA 3F6HA 2EMBA 1Z1BA 1DGCA 2L2KB 4DV1E 4BS9A 3C6KA 3HPSA 1TF3A 2MC5A 2WZOA 3EQ1A 2EPMX 5T6JA 2N3HA 2LUQA 1XNRE 4ZYHA 4R2SA 3TQMA 4RHBB 3OTOE 1L4SA 1UHZA 4O43A 5LMNE 2NUEA 2YTNA 2EZ6A 2B3TB 2ELZA 4ZYGA 1JK2A 2L3CA 3H09A 4DKKA 3VHTB 2UUBE 2Q8UA 2LVHA 1X47A 2LMZA 3QG5C 4B3ME 2MKDA 2RPCA 3HQ1A 3EPLA 3BBGA 1ZBTA 2RSIA 2EE8A 4NZVA 4DV3E 1RC7A 1N32E 2V88A 4F6MA 3ADLA 1X6EA 3C4BA 5FLXC 4OX9E 2ELYA 2YZTA 5KL6A 4KZSA 1UILA 1YFHA 4L5NC 1YYWA 2ADRA 2EL5A 5AC4A 4JI2E 1YYOA 1HNZE 2ODRC 1SFEA 1XNQE
chains in the Genus database with same CATH topology
2EPCA 4R2PA 2CTDA 2YTFA 2EOIA 1MEYC 2EQ0A 2E72A 4X9JA 2DGCA 1UN6B 2EOZA 2YTOA 2WBUA 2EOMA 1YUJA 1G2DC 1BBOA 2EMCA 2J7JA 2VRDA 3EPJA 4F2JC 3EPHA 2PRTA 2YRMA 1A1FA 2EN2A 1LLMC 2R1FA 2GHFA 1WJPA 2EOEA 2LT7A 1AAYA 2ENHA 2EN3A 2YTIA 4FK5C 1F2IG 2I13A 1NCSA 2EN8A 1A1IA 2EM0A 2EOFA 2EORA 1YSAC 2YU5A 1RMDA 2EOQA 2YSOA 2YTQA 2EMAA 2EMXA 2JPAA 2EMWA 3MHHC 1ZR9A 3M99B 1P47A 4R2QA 2A25A 2YTEA 3UK3C 2HGHA 2EMZA 2EQ3A 2WBSA 1TF6A 1X5WA 4R2EA 2EM2A 4IJDA 1A1HA 2EM5A 2EM9A 2EOSA 2NABA 2EM6A 2CSHA 2CT1A 2JP9A 4F6NA 2EPPA 2EMHA 2M9AA 2EOXA 4R2RA 2EMLA 4R2AA 2EPZA 2LO3A 1A1GA 2BB8A 2EMBA 1JK1A 2GLIA 1Z1BA 1DGCA 5KL7A 2YU8A 1TF3A 1B69A 1BB8A 2EL4A 2YRKA 1X6FA 2EQ1A 2ENAA 2EL6A 2EM4A 2DLQA 4R2SA 1ZAAC 2MDGA 2YTJA 2MKNA 2DLKA 3EPKA 2DRPA 2ENCA 1A1JA 2YTNA 3MHSC 2EMYA 2YSPA 2ELZA 1JK2A 1A1LA 2D9HA 3VHTB 2EM8A 2EMKA 2LV2A 1X3CA 2EMIA 2EPRA 2LVHA 5KL2A 1KJKA 1A1KA 2EM7A 2EM3A 2EMFA 2MKDA 2RPCA 2EOHA 2EN7A 4IS1C 2EOOA 2YRHA 1G2FC 3EPLA 2RSIA 2EE8A 2EOYA 2EPXA 1TN9A 5KL4A 4F6MA 4R2CA 2EMGA 2DMIA 2EPUA 2EN1A 2EOJA 2LCEA 1X6EA 2WCC3 2YTDA 4R2DA 2WBTA 4GZNC 2EN6A 1UBDC 1ZU1A 2ELYA 2EJ4A 1X6HA 5KL6A 5KL5A 2EN4A 2EP3A 2YTGA 4WSGA 5KL3A 2YTPA 2ADRA 2EL5A 1YUIA 2EPAA 4M9VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPC A;  4R2P A;  2CTD A;  2YTF A;  2EOI A;  1MEY C;  2EQ0 A;  2E72 A;  4X9J A;  2DGC A;  1UN6 B;  2EOZ A;  2YTO A;  2WBU A;  2EOM A;  1YUJ A;  1G2D C;  1BBO A;  2EMC A;  2J7J A;  2VRD A;  3EPJ A;  4F2J C;  3EPH A;  2PRT A;  2YRM A;  1A1F A;  2EN2 A;  1LLM C;  2R1F A;  2GHF A;  1WJP A;  2EOE A;  2LT7 A;  1AAY A;  2ENH A;  2EN3 A;  2YTI A;  4FK5 C;  1F2I G;  2I13 A;  1NCS A;  2EN8 A;  1A1I A;  2EM0 A;  2EOF A;  2EOR A;  1YSA C;  2YU5 A;  1RMD A;  2EOQ A;  2YSO A;  2YTQ A;  2EMA A;  2EMX A;  2JPA A;  2EMW A;  3MHH C;  1ZR9 A;  3M99 B;  1P47 A;  4R2Q A;  2A25 A;  2YTE A;  3UK3 C;  2HGH A;  2EMZ A;  2EQ3 A;  2WBS A;  1TF6 A;  1X5W A;  4R2E A;  2EM2 A;  4IJD A;  1A1H A;  2EM5 A;  2EM9 A;  2EOS A;  2NAB A;  2EM6 A;  2CSH A;  2CT1 A;  2JP9 A;  4F6N A;  2EPP A;  2EMH A;  2M9A A;  2EOX A;  4R2R A;  2EML A;  4R2A A;  2EPZ A;  2LO3 A;  1A1G A;  2BB8 A;  2EMB A;  1JK1 A;  2GLI A;  1Z1B A;  1DGC A;  5KL7 A;  2YU8 A;  1TF3 A;  1B69 A;  1BB8 A;  2EL4 A;  2YRK A;  1X6F A;  2EQ1 A;  2ENA A;  2EL6 A;  2EM4 A;  2DLQ A;  4R2S A;  1ZAA C;  2MDG A;  2YTJ A;  2MKN A;  2DLK A;  3EPK A;  2DRP A;  2ENC A;  1A1J A;  2YTN A;  3MHS C;  2EMY A;  2YSP A;  2ELZ A;  1JK2 A;  1A1L A;  2D9H A;  3VHT B;  2EM8 A;  2EMK A;  2LV2 A;  1X3C A;  2EMI A;  2EPR A;  2LVH A;  5KL2 A;  1KJK A;  1A1K A;  2EM7 A;  2EM3 A;  2EMF A;  2MKD A;  2RPC A;  2EOH A;  2EN7 A;  4IS1 C;  2EOO A;  2YRH A;  1G2F C;  3EPL A;  2RSI A;  2EE8 A;  2EOY A;  2EPX A;  1TN9 A;  5KL4 A;  4F6M A;  4R2C A;  2EMG A;  2DMI A;  2EPU A;  2EN1 A;  2EOJ A;  2LCE A;  1X6E A;  2WCC 3;  2YTD A;  4R2D A;  2WBT A;  4GZN C;  2EN6 A;  1UBD C;  1ZU1 A;  2ELY A;  2EJ4 A;  1X6H A;  5KL6 A;  5KL5 A;  2EN4 A;  2EP3 A;  2YTG A;  4WSG A;  5KL3 A;  2YTP A;  2ADR A;  2EL5 A;  1YUI A;  2EPA A;  4M9V C; 
#chains in the Genus database with same CATH topology
 3JTZ A;  2CTD A;  2DGC A;  1HNW E;  2YTO A;  2EOM A;  3JAM C;  2EMC A;  4F2J C;  1A1F A;  4LU9 A;  2HHH E;  5AE1 A;  2VQF E;  2EN3 A;  4FK5 C;  1F2I G;  1EH7 A;  2EN8 A;  2RQL A;  2EOR A;  2YU5 A;  2NUF A;  1WHN A;  5AAS A;  2UXD E;  2MDR A;  4DUY E;  2L2N A;  2VE7 C;  4M0V A;  1J5E E;  2EMW A;  2LBS B;  4DR4 E;  4BHC A;  3DF6 A;  1BBG A;  4O4K A;  5DNY A;  1J26 A;  1P47 A;  4BBY A;  4R2Q A;  4JI8 E;  1TF6 A;  2UUA E;  3JU0 A;  2LJU A;  1O0W A;  3P1X A;  2CT1 A;  4DV5 E;  1IBM E;  1PDA A;  2EOX A;  2ODR D;  2EML A;  2V89 A;  2JYA A;  5IT9 C;  3BGH A;  4LF6 E;  2YU8 A;  2EWL A;  4X65 E;  1WHQ A;  2UXC E;  2EQ1 A;  2KOU A;  4LF5 E;  4DR2 E;  2E5L E;  4R8O A;  4K0K E;  3LML A;  4NXN E;  2MKN A;  5IXM B;  5A69 A;  2DLK A;  3EPK A;  1SR9 A;  1MGT A;  3AUZ A;  2EMY A;  4BHB A;  4WXC A;  1IBL E;  2EM8 A;  5IV8 B;  2LV2 A;  4LFB E;  4B3S E;  2DSY A;  4J8Z A;  1KJK A;  1GQE A;  4DR3 E;  2M1S A;  1PKP A;  2EM7 A;  1IMU A;  3L00 A;  4GKJ E;  5TSE A;  3VYY A;  2JOB A;  2LRS A;  2EOH A;  2EOO A;  1G2F C;  3DJW A;  1TN9 A;  4MLV A;  2DMI A;  4DUZ E;  4DV2 E;  2DMY A;  4WYQ B;  2L3J A;  4GZN C;  2EN6 A;  1ZU1 A;  2EJ4 A;  2YTG A;  4WSG A;  2N8X A;  5ADZ A;  2RSM A;  5IWA E;  4BCA A;  1XMO E;  2EPA A;  2DIX A;  4JI4 E;  2JR1 A;  2EQ0 A;  4TUG A;  1WXR A;  2JOX A;  3T1H E;  4X9J A;  4BMJ A;  2UXB E;  2NA2 A;  1YUJ A;  1G2D C;  4F9C B;  2J7J A;  3EPJ A;  3EPH A;  3F6G A;  2YRM A;  4DR1 E;  4GEQ B;  2L2M A;  3FIG A;  5LL6 R;  5BR8 E;  2M4I A;  4F54 A;  2LT7 A;  2BBG A;  1AAY A;  1FKA E;  2YTI A;  2HJJ A;  4WFT A;  4X62 E;  3RMP A;  2EM0 A;  3VYX A;  1YSA C;  2V87 A;  1T38 A;  2YSO A;  2UUC E;  2EMX A;  2K4V A;  5A2Q C;  2RS7 A;  3ADG A;  3M99 B;  4BC7 A;  2LTR A;  3UK3 C;  4JI7 E;  2EMZ A;  4JYA E;  2EM2 A;  3LLH A;  2EM5 A;  4L8N A;  2EM6 A;  2NAB A;  4M30 A;  1GZ6 A;  2JP9 A;  4O5G A;  4JI6 E;  2EPP A;  4LF9 E;  2ZM6 E;  4R2R A;  2UU9 E;  4N4R B;  2V8Q B;  2GLI A;  5KL7 A;  1B69 A;  1X6F A;  2EL6 A;  2M7Q A;  4DR5 E;  1ZAA C;  4O24 A;  4HEI A;  2MDG A;  2FV4 B;  2DRP A;  4GKK E;  3AV0 A;  1A1J A;  1HR0 E;  1EKZ A;  2JY9 A;  2VQE E;  3MHS C;  5A6K A;  2YSP A;  1A1L A;  2D9H A;  2EMK A;  4WPY A;  1X3C A;  4KHP E;  5LMU E;  5KL2 A;  2I9I A;  1EH6 A;  2EM3 A;  4X66 E;  2EMF A;  2LUP B;  1IQS A;  5LLQ A;  2EPK X;  2L8T A;  4HTG A;  5AE2 A;  2EOY A;  4JI0 E;  2EMG A;  2EN1 A;  2EOJ A;  2WCC 3;  2YTD A;  3J7Y p;  4R2D A;  4ZYE A;  3KZZ A;  4YY3 E;  1X6H A;  4DV7 E;  3KZY A;  2EN4 A;  5KL5 A;  5A6A A;  3HXL A;  5KL3 A;  4I8O A;  5F3W A;  1YPN A;  2CPN A;  2MC6 A;  3HPZ A;  4M9V C;  2EPC A;  2EOI A;  1MEY C;  2E72 A;  1DI2 A;  4JI5 E;  4JV5 E;  1N34 E;  2YWQ A;  4Q35 B;  2GPI A;  2EPO A;  2R1F A;  1N3G A;  2GHF A;  1RQ0 A;  1WJP A;  1EH8 A;  2ENH A;  1QNT A;  2RS6 A;  1QU6 A;  4WXD A;  2EOQ A;  2B7V A;  1GTK A;  2JPA A;  4P78 A;  1N36 E;  1ZR9 A;  2F8B A;  1N33 E;  2E1M A;  2A25 A;  4AQY E;  2YTE A;  3C4T A;  2DB2 A;  2HGH A;  4JI1 E;  2WBS A;  3C6M A;  1X48 A;  1I94 E;  4R2E A;  2K7I A;  4IJD A;  2R76 A;  1YYK A;  2EM9 A;  2H36 X;  2M9A A;  1XMQ E;  4X64 E;  2YPN A;  2EPZ A;  4KWY A;  5CFF E;  2LO3 A;  3J7A G;  4R03 A;  1A1G A;  2BB8 A;  3ECR A;  1JK1 A;  1BB8 A;  5A6B D;  2EL4 A;  4LF8 E;  2YRK A;  4DV6 E;  2ENA A;  4DV4 E;  2EM4 A;  3J81 C;  2DLQ A;  1PJQ A;  2JXP A;  4RH8 A;  3T1Y E;  4NXM E;  3ADI A;  2EPN A;  2YTJ A;  1T39 A;  2RTX A;  2F4V E;  1NEI A;  1AH5 A;  2B7T A;  2ENC A;  4OOG C;  3J80 C;  4F9B B;  3KWR A;  2FGG A;  3BF2 A;  4F9A B;  1T4N A;  4DMI A;  4Q28 A;  2EPR A;  2EMI A;  2VF1 A;  5AC5 A;  4MLQ A;  2V83 A;  1A1K A;  1PJT A;  4DR6 E;  1X49 A;  2EN7 A;  4IS1 C;  2YRH A;  5A6B A;  2EPX A;  3HTX A;  5KL4 A;  4R2C A;  2EPU A;  2IHR 1;  2LCE A;  1ZBQ A;  2WBT A;  2FTX B;  3ZOQ B;  1UBD C;  1WRJ A;  1YZ9 A;  4WSP A;  2EP3 A;  4JI3 E;  2NUG A;  4DR7 E;  4X8W A;  2YTP A;  2KHX A;  4ZYD A;  2L92 A;  2WBU A;  2HC5 A;  3IWB A;  1T4O A;  4LFA E;  2V86 A;  4R2P A;  2YTF A;  3BID A;  3THN A;  1IBK E;  1UN6 B;  2EOZ A;  2L33 A;  4YHH E;  1HNX E;  2LJH A;  2V85 A;  1IQO A;  1BBO A;  4B3T E;  2VRD A;  2LTS A;  2PRT A;  5AE3 A;  1DQ3 A;  2EN2 A;  1T4L B;  1LLM C;  2EOE A;  3OML A;  3MSW A;  4WX9 A;  2I13 A;  1NCS A;  1A1I A;  2EOF A;  2N3G A;  2G7H A;  1RMD A;  2YTQ A;  4BC9 A;  3ADJ A;  2EMA A;  1PJS A;  4LF4 E;  3VK6 A;  3MHH C;  1FJG E;  2B9D A;  3THO B;  1YUI A;  2L6M A;  2LE2 A;  4DV0 E;  4P7D A;  2EQ3 A;  4LF7 E;  2JVA A;  4LFC E;  1STU A;  1X5W A;  2YT4 A;  4B3R E;  4NHR A;  2EPL X;  4M2Z A;  5A6J A;  1A1H A;  1KYQ A;  2JWO A;  2EOS A;  2CSH A;  4LTY A;  3K6Q A;  3IWD A;  4F6N A;  4TUI A;  2EMH A;  4R2A A;  3IWC A;  2KON A;  3F6H A;  2EMB A;  1Z1B A;  1DGC A;  2L2K B;  4DV1 E;  4BS9 A;  3C6K A;  3HPS A;  1TF3 A;  2MC5 A;  2WZO A;  3EQ1 A;  2EPM X;  5T6J A;  2N3H A;  2LUQ A;  1XNR E;  4ZYH A;  4R2S A;  3TQM A;  4RHB B;  3OTO E;  1L4S A;  1UHZ A;  4O43 A;  5LMN E;  2NUE A;  2YTN A;  2EZ6 A;  2B3T B;  2ELZ A;  4ZYG A;  1JK2 A;  2L3C A;  3H09 A;  4DKK A;  3VHT B;  2UUB E;  2Q8U A;  2LVH A;  1X47 A;  2LMZ A;  3QG5 C;  4B3M E;  2MKD A;  2RPC A;  3HQ1 A;  3EPL A;  3BBG A;  1ZBT A;  2RSI A;  2EE8 A;  4NZV A;  4DV3 E;  1RC7 A;  1N32 E;  2V88 A;  4F6M A;  3ADL A;  1X6E A;  3C4B A;  5FLX C;  4OX9 E;  2ELY A;  2YZT A;  5KL6 A;  4KZS A;  1UIL A;  1YFH A;  4L5N C;  1YYW A;  2ADR A;  2EL5 A;  5AC4 A;  4JI2 E;  1YYO A;  1HNZ E;  2ODR C;  1SFE A;  1XNQ E; 
#chains in the Genus database with same CATH homology
 2EPC A;  4R2P A;  2CTD A;  2YTF A;  2EOI A;  1MEY C;  2EQ0 A;  2E72 A;  4X9J A;  2DGC A;  1UN6 B;  2EOZ A;  2YTO A;  2WBU A;  2EOM A;  1YUJ A;  1G2D C;  1BBO A;  2EMC A;  2J7J A;  2VRD A;  3EPJ A;  4F2J C;  3EPH A;  2PRT A;  2YRM A;  1A1F A;  2EN2 A;  1LLM C;  2R1F A;  2GHF A;  1WJP A;  2EOE A;  2LT7 A;  1AAY A;  2ENH A;  2EN3 A;  2YTI A;  4FK5 C;  1F2I G;  2I13 A;  1NCS A;  2EN8 A;  1A1I A;  2EM0 A;  2EOF A;  2EOR A;  1YSA C;  2YU5 A;  1RMD A;  2EOQ A;  2YSO A;  2YTQ A;  2EMA A;  2EMX A;  2JPA A;  2EMW A;  3MHH C;  1ZR9 A;  3M99 B;  1P47 A;  4R2Q A;  2A25 A;  2YTE A;  3UK3 C;  2HGH A;  2EMZ A;  2EQ3 A;  2WBS A;  1TF6 A;  1X5W A;  4R2E A;  2EM2 A;  4IJD A;  1A1H A;  2EM5 A;  2EM9 A;  2EOS A;  2NAB A;  2EM6 A;  2CSH A;  2CT1 A;  2JP9 A;  4F6N A;  2EPP A;  2EMH A;  2M9A A;  2EOX A;  4R2R A;  2EML A;  4R2A A;  2EPZ A;  2LO3 A;  1A1G A;  2BB8 A;  2EMB A;  1JK1 A;  2GLI A;  1Z1B A;  1DGC A;  5KL7 A;  2YU8 A;  1TF3 A;  1B69 A;  1BB8 A;  2EL4 A;  2YRK A;  1X6F A;  2EQ1 A;  2ENA A;  2EL6 A;  2EM4 A;  2DLQ A;  4R2S A;  1ZAA C;  2MDG A;  2YTJ A;  2MKN A;  2DLK A;  3EPK A;  2DRP A;  2ENC A;  1A1J A;  2YTN A;  3MHS C;  2EMY A;  2YSP A;  2ELZ A;  1JK2 A;  1A1L A;  2D9H A;  3VHT B;  2EM8 A;  2EMK A;  2LV2 A;  1X3C A;  2EMI A;  2EPR A;  2LVH A;  5KL2 A;  1KJK A;  1A1K A;  2EM7 A;  2EM3 A;  2EMF A;  2MKD A;  2RPC A;  2EOH A;  2EN7 A;  4IS1 C;  2EOO A;  2YRH A;  1G2F C;  3EPL A;  2RSI A;  2EE8 A;  2EOY A;  2EPX A;  1TN9 A;  5KL4 A;  4F6M A;  4R2C A;  2EMG A;  2DMI A;  2EPU A;  2EN1 A;  2EOJ A;  2LCE A;  1X6E A;  2WCC 3;  2YTD A;  4R2D A;  2WBT A;  4GZN C;  2EN6 A;  1UBD C;  1ZU1 A;  2ELY A;  2EJ4 A;  1X6H A;  5KL6 A;  5KL5 A;  2EN4 A;  2EP3 A;  2YTG A;  4WSG A;  5KL3 A;  2YTP A;  2ADR A;  2EL5 A;  1YUI A;  2EPA A;  4M9V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...