1IQOA

Solution structure of mth1880 from methanobacterium thermoautotrophicum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
LFIATLKGIFTLKDLPEEFRPFVDYKAGLEKKKLSDDDEIAIISIKGTQSNHVLFLSSYNSVDEIRKELEEAGAKINHTTLKILEGHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords HYPOTHETICAL PROTEIN MTH1880
publication title Solution structure of a novel calcium binding protein, MTH1880, from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05370 DUF749 Domain of unknown function (DUF749)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.120 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Hypothetical protein MTH1880 1iqoA00
1IQSA 1IQOA
chains in the Genus database with same CATH superfamily
2YT4A 2YSPA 1T38A 4KWYA 1HNXE 2BBGA 5KL5A 1PJSA 1MGTA 2B9DA 4NZVA 4WYQB 2N3GA 4P78A 2DSYA 3JTZA 2GPIA 1ZBTA 2I9IA 2YRKA 4DR2E 1J26A 2EMZA 1L4SA 4ZYHA 2R1FA 2N3HA 2EM2A 1EH8A 2EMXA 1YYKA 2LTSA 4DR3E 1UILA 1HR0E 4OX9E 4BCAA 2MC5A 2LO3A 3L00A 1X6EA 4R2QA 1O0WA 2EPXA 2GLIA 2MDRA 2LTRA 2EOEA 2UXCE 5KL4A 1SFEA 4F54A 4X66E 4LU9A 4F9BB 5IT9C 4DUYE 1SR9A 3ECRA 2V83A 2NUGA 2FTXB 2L2KB 2LBSB 1JK1A 3VYXA 2YTOA 2EPRA 2NABA 2LE2A 4DR4E 4MLVA 1X3CA 1PDAA 2EL6A 2EMFA 5A2QC 4DR5E 4WXCA 2FGGA 2JYAA 2YWQA 4DV1E 5F3WA 4LF7E 2DGCA 2YTJA 1IMUA 4F2JC 1ZBQA 5KL3A 3C4BA 2DMIA 2EPUA 2ENHA 2JY9A 2WCC3 4JI6E 2JR1A 2LJUA 4OOGC 2V85A 4M2ZA 2DMYA 2NUFA 2HGHA 1QU6A 4WXDA 4DV3E 2E1MA 2EOXA 2ELYA 1WXRA 4DKKA 2JXPA 1KYQA 4Q35B 2EPNA 2ZM6E 2EPOA 2D9HA 2EM4A 2G7HA 2EPCA 4WPYA 4YHHE 4X62E 3HPZA 1HNZE 2L2NA 4JI2E 2GHFA 2EPZA 2E72A 1A1JA 2EN6A 2L6MA 4X8WA 1Z1BA 5A6BA 4YY3E 3UK3C 2LV2A 4KZSA 2EMYA 1MEYC 4IJDA 4F6NA 2E5LE 2EOFA 2EN3A 4X9JA 5AE2A 1A1FA 3BGHA 4LF6E 3IWCA 3HTXA 5AASA 3HXLA 2EPLX 1BBOA 4AQYE 3VHTB 4F9AB 3ADGA 1X6HA 1FJGE 5AE1A 4B3ME 3MHSC 4L5NC 2UUBE 2EM7A 2EMKA 1A1KA 4O5GA 1KJKA 1A1GA 2ENCA 2M7QA 1F2IG 1X48A 1EKZA 2EORA 2RS7A 2VRDA 2A25A 2JWOA 3KWRA 4O24A 3VYYA 4B3RE 2J7JA 4RH8A 4JI1E 3EPJA 2EMWA 1AAYA 2EMAA 2V86A 2EOSA 4JV5E 2YSOA 4HTGA 1N33E 2YPNA 1IQOA 2YTIA 5KL2A 2L3JA 2Q8UA 1G2DC 2DLKA 2EQ3A 2RPCA 3HQ1A 1PJTA 4R2PA 4KHPE 4B3SE 1X47A 2MC6A 2CSHA 2EJ4A 1N34E 2UUAE 5AE3A 1P47A 4WX9A 1EH7A 3AV0A 2B7VA 3DJWA 3MSWA 3C6MA 2V87A 3KZYA 5ADZA 2L92A 2LMZA 5TSEA 2LJHA 2CTDA 4TUIA 4TUGA 1X5WA 4WSGA 4ZYEA 2YZTA 4FK5C 2I13A 2HJJA 2EM0A 5KL7A 1XMQE 4LFAE 2UXDE 2EM9A 1RQ0A 2EQ0A 2M4IA 2EOYA 3T1YE 2EM3A 2JP9A 3QG5C 4RHBB 2ELZA 2ENAA 2KHXA 1STUA 4O43A 1BBGA 1A1HA 2EPPA 2F4VE 4NXME 1ZU1A 4P7DA 4Q28A 3THOB 2NUEA 2CT1A 4JI5E 3EPKA 3BF2A 4DV2E 2EL4A 4HEIA 2EL5A 1GTKA 4B3TE 3BBGA 4JI7E 3IWBA 4DV4E 3ADLA 4LF5E 2LCEA 2UUCE 3DF6A 2LUQA 4BS9A 5A6KA 4O4KA 4X64E 3OTOE 4LTYA 5A6JA 2RTXA 5LL6R 2EE8A 2YTGA 1WHQA 5IXMB 2YTNA 2JOBA 4LFBE 2FV4B 1N36E 4NXNE 2DIXA 3J80C 3H09A 3EPLA 1WJPA 2LT7A 2JOXA 1DQ3A 4R03A 1T39A 3ADIA 4R2EA 4DV0E 4BBYA 2YTQA 4GKJE 3M99B 2ADRA 1T4LB 2EPAA 4LF4E 2YU5A 1DGCA 1N3GA 1X6FA 4JI3E 4LF9E 2RSMA 2EOQA 2MKDA 4DMIA 4JI0E 2F8BA 5T6JA 2EZ6A 2EM6A 5LMUE 1JK2A 3ADJA 1B69A 2EWLA 2YRHA 2EQ1A 4IS1C 2EN2A 2DRPA 2B7TA 1TF6A 4R2AA 1IQSA 2EN8A 1HNWE 5BR8E 4WSPA 1XNQE 4M30A 1J5EE 2EN1A 2B3TB 5AC4A 3JU0A 4DUZE 2JVAA 1PKPA 2EMLA 2K7IA 2YTFA 1XMOE 1T4NA 3RMPA 1YFHA 1G2FC 2RSIA 1YYOA 2WBUA 2L2MA 1IBME 2BB8A 1TF3A 3J7Yp 3T1HE 1LLMC 2KONA 1N32E 2ODRC 3VK6A 1GZ6A 5CFFE 1TN9A 2KOUA 1T4OA 4GEQB 4R2CA 2EMBA 2H36X 2EOJA 5IWAE 5KL6A 4ZYGA 2JPAA 2V88A 5IV8B 1YYWA 2CPNA 5DNYA 1AH5A 4MLQA 2L8TA 3JAMC 3EQ1A 3AUZA 3ZOQB 2M9AA 4JI4E 3P1XA 2EOIA 4R2SA 2EPKX 5LMNE 4GZNC 2RQLA 2VE7C 3TQMA 2VQEE 2YRMA 2EOMA 1UBDC 1UN6B 2N8XA 5A6BD 4DR7E 4N4RB 2M1SA 4LFCE 4GKKE 4ZYDA 1NCSA 5A69A 4F6MA 4L8NA 1EH6A 2EOZA 2LRSA 4JI8E 2EMIA 3THNA 2EM8A 4LF8E 3J81C 1A1LA 4R2DA 1YZ9A 2HHHE 1YPNA 5A6AA 3F6GA 1ZR9A 3FIGA 2V8QB 2EOOA 2EMGA 4DV7E 4DR6E 2WBSA 1YUJA 1DI2A 4JYAE 2MDGA 2V89A 2WBTA 2VF1A 2LUPB 4R8OA 2ODRD 1PJQA 1BB8A 2MKNA 4WFTA 1NEIA 4DR1E 2YU8A 3OMLA 2EM5A 2LVHA 1YUIA 3BIDA 4R2RA 3C6KA 1RMDA 3LLHA 1QNTA 3IWDA 2EOHA 2NA2A 3J7AG 4BHCA 3C4TA 2YTEA 5LLQA 1FKAE 3EPHA 3KZZA 4BC9A 2UU9E 2DB2A 2UXBE 4NHRA 4BC7A 4DV5E 2YTPA 4BHBA 3F6HA 5AC5A 2PRTA 2EN7A 4DV6E 2RS6A 2YTDA 2HC5A 1UHZA 1YSAC 4M9VC 2L33A 2K4VA 2L3CA 4X65E 3MHHC 1IBKE 2IHR1 1IBLE 4J8ZA 1X49A 2EP3A 1ZAAC 1WHNA 5FLXC 2R76A 2EMCA 4I8OA 1I94E 1A1IA 2EN4A 3LMLA 2DLQA 2EMHA 3HPSA 4K0KE 4F9CB 1RC7A 2WZOA 2EPMX 1WRJA 3K6QA 4BMJA 4M0VA 1XNRE 2VQFE 1GQEA
chains in the Genus database with same CATH topology
1IQSA 1IQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQS A;  1IQO A; 
#chains in the Genus database with same CATH topology
 2YT4 A;  2YSP A;  1T38 A;  4KWY A;  1HNX E;  2BBG A;  5KL5 A;  1PJS A;  1MGT A;  2B9D A;  4NZV A;  4WYQ B;  2N3G A;  4P78 A;  2DSY A;  3JTZ A;  2GPI A;  1ZBT A;  2I9I A;  2YRK A;  4DR2 E;  1J26 A;  2EMZ A;  1L4S A;  4ZYH A;  2R1F A;  2N3H A;  2EM2 A;  1EH8 A;  2EMX A;  1YYK A;  2LTS A;  4DR3 E;  1UIL A;  1HR0 E;  4OX9 E;  4BCA A;  2MC5 A;  2LO3 A;  3L00 A;  1X6E A;  4R2Q A;  1O0W A;  2EPX A;  2GLI A;  2MDR A;  2LTR A;  2EOE A;  2UXC E;  5KL4 A;  1SFE A;  4F54 A;  4X66 E;  4LU9 A;  4F9B B;  5IT9 C;  4DUY E;  1SR9 A;  3ECR A;  2V83 A;  2NUG A;  2FTX B;  2L2K B;  2LBS B;  1JK1 A;  3VYX A;  2YTO A;  2EPR A;  2NAB A;  2LE2 A;  4DR4 E;  4MLV A;  1X3C A;  1PDA A;  2EL6 A;  2EMF A;  5A2Q C;  4DR5 E;  4WXC A;  2FGG A;  2JYA A;  2YWQ A;  4DV1 E;  5F3W A;  4LF7 E;  2DGC A;  2YTJ A;  1IMU A;  4F2J C;  1ZBQ A;  5KL3 A;  3C4B A;  2DMI A;  2EPU A;  2ENH A;  2JY9 A;  2WCC 3;  4JI6 E;  2JR1 A;  2LJU A;  4OOG C;  2V85 A;  4M2Z A;  2DMY A;  2NUF A;  2HGH A;  1QU6 A;  4WXD A;  4DV3 E;  2E1M A;  2EOX A;  2ELY A;  1WXR A;  4DKK A;  2JXP A;  1KYQ A;  4Q35 B;  2EPN A;  2ZM6 E;  2EPO A;  2D9H A;  2EM4 A;  2G7H A;  2EPC A;  4WPY A;  4YHH E;  4X62 E;  3HPZ A;  1HNZ E;  2L2N A;  4JI2 E;  2GHF A;  2EPZ A;  2E72 A;  1A1J A;  2EN6 A;  2L6M A;  4X8W A;  1Z1B A;  5A6B A;  4YY3 E;  3UK3 C;  2LV2 A;  4KZS A;  2EMY A;  1MEY C;  4IJD A;  4F6N A;  2E5L E;  2EOF A;  2EN3 A;  4X9J A;  5AE2 A;  1A1F A;  3BGH A;  4LF6 E;  3IWC A;  3HTX A;  5AAS A;  3HXL A;  2EPL X;  1BBO A;  4AQY E;  3VHT B;  4F9A B;  3ADG A;  1X6H A;  1FJG E;  5AE1 A;  4B3M E;  3MHS C;  4L5N C;  2UUB E;  2EM7 A;  2EMK A;  1A1K A;  4O5G A;  1KJK A;  1A1G A;  2ENC A;  2M7Q A;  1F2I G;  1X48 A;  1EKZ A;  2EOR A;  2RS7 A;  2VRD A;  2A25 A;  2JWO A;  3KWR A;  4O24 A;  3VYY A;  4B3R E;  2J7J A;  4RH8 A;  4JI1 E;  3EPJ A;  2EMW A;  1AAY A;  2EMA A;  2V86 A;  2EOS A;  4JV5 E;  2YSO A;  4HTG A;  1N33 E;  2YPN A;  1IQO A;  2YTI A;  5KL2 A;  2L3J A;  2Q8U A;  1G2D C;  2DLK A;  2EQ3 A;  2RPC A;  3HQ1 A;  1PJT A;  4R2P A;  4KHP E;  4B3S E;  1X47 A;  2MC6 A;  2CSH A;  2EJ4 A;  1N34 E;  2UUA E;  5AE3 A;  1P47 A;  4WX9 A;  1EH7 A;  3AV0 A;  2B7V A;  3DJW A;  3MSW A;  3C6M A;  2V87 A;  3KZY A;  5ADZ A;  2L92 A;  2LMZ A;  5TSE A;  2LJH A;  2CTD A;  4TUI A;  4TUG A;  1X5W A;  4WSG A;  4ZYE A;  2YZT A;  4FK5 C;  2I13 A;  2HJJ A;  2EM0 A;  5KL7 A;  1XMQ E;  4LFA E;  2UXD E;  2EM9 A;  1RQ0 A;  2EQ0 A;  2M4I A;  2EOY A;  3T1Y E;  2EM3 A;  2JP9 A;  3QG5 C;  4RHB B;  2ELZ A;  2ENA A;  2KHX A;  1STU A;  4O43 A;  1BBG A;  1A1H A;  2EPP A;  2F4V E;  4NXM E;  1ZU1 A;  4P7D A;  4Q28 A;  3THO B;  2NUE A;  2CT1 A;  4JI5 E;  3EPK A;  3BF2 A;  4DV2 E;  2EL4 A;  4HEI A;  2EL5 A;  1GTK A;  4B3T E;  3BBG A;  4JI7 E;  3IWB A;  4DV4 E;  3ADL A;  4LF5 E;  2LCE A;  2UUC E;  3DF6 A;  2LUQ A;  4BS9 A;  5A6K A;  4O4K A;  4X64 E;  3OTO E;  4LTY A;  5A6J A;  2RTX A;  5LL6 R;  2EE8 A;  2YTG A;  1WHQ A;  5IXM B;  2YTN A;  2JOB A;  4LFB E;  2FV4 B;  1N36 E;  4NXN E;  2DIX A;  3J80 C;  3H09 A;  3EPL A;  1WJP A;  2LT7 A;  2JOX A;  1DQ3 A;  4R03 A;  1T39 A;  3ADI A;  4R2E A;  4DV0 E;  4BBY A;  2YTQ A;  4GKJ E;  3M99 B;  2ADR A;  1T4L B;  2EPA A;  4LF4 E;  2YU5 A;  1DGC A;  1N3G A;  1X6F A;  4JI3 E;  4LF9 E;  2RSM A;  2EOQ A;  2MKD A;  4DMI A;  4JI0 E;  2F8B A;  5T6J A;  2EZ6 A;  2EM6 A;  5LMU E;  1JK2 A;  3ADJ A;  1B69 A;  2EWL A;  2YRH A;  2EQ1 A;  4IS1 C;  2EN2 A;  2DRP A;  2B7T A;  1TF6 A;  4R2A A;  1IQS A;  2EN8 A;  1HNW E;  5BR8 E;  4WSP A;  1XNQ E;  4M30 A;  1J5E E;  2EN1 A;  2B3T B;  5AC4 A;  3JU0 A;  4DUZ E;  2JVA A;  1PKP A;  2EML A;  2K7I A;  2YTF A;  1XMO E;  1T4N A;  3RMP A;  1YFH A;  1G2F C;  2RSI A;  1YYO A;  2WBU A;  2L2M A;  1IBM E;  2BB8 A;  1TF3 A;  3J7Y p;  3T1H E;  1LLM C;  2KON A;  1N32 E;  2ODR C;  3VK6 A;  1GZ6 A;  5CFF E;  1TN9 A;  2KOU A;  1T4O A;  4GEQ B;  4R2C A;  2EMB A;  2H36 X;  2EOJ A;  5IWA E;  5KL6 A;  4ZYG A;  2JPA A;  2V88 A;  5IV8 B;  1YYW A;  2CPN A;  5DNY A;  1AH5 A;  4MLQ A;  2L8T A;  3JAM C;  3EQ1 A;  3AUZ A;  3ZOQ B;  2M9A A;  4JI4 E;  3P1X A;  2EOI A;  4R2S A;  2EPK X;  5LMN E;  4GZN C;  2RQL A;  2VE7 C;  3TQM A;  2VQE E;  2YRM A;  2EOM A;  1UBD C;  1UN6 B;  2N8X A;  5A6B D;  4DR7 E;  4N4R B;  2M1S A;  4LFC E;  4GKK E;  4ZYD A;  1NCS A;  5A69 A;  4F6M A;  4L8N A;  1EH6 A;  2EOZ A;  2LRS A;  4JI8 E;  2EMI A;  3THN A;  2EM8 A;  4LF8 E;  3J81 C;  1A1L A;  4R2D A;  1YZ9 A;  2HHH E;  1YPN A;  5A6A A;  3F6G A;  1ZR9 A;  3FIG A;  2V8Q B;  2EOO A;  2EMG A;  4DV7 E;  4DR6 E;  2WBS A;  1YUJ A;  1DI2 A;  4JYA E;  2MDG A;  2V89 A;  2WBT A;  2VF1 A;  2LUP B;  4R8O A;  2ODR D;  1PJQ A;  1BB8 A;  2MKN A;  4WFT A;  1NEI A;  4DR1 E;  2YU8 A;  3OML A;  2EM5 A;  2LVH A;  1YUI A;  3BID A;  4R2R A;  3C6K A;  1RMD A;  3LLH A;  1QNT A;  3IWD A;  2EOH A;  2NA2 A;  3J7A G;  4BHC A;  3C4T A;  2YTE A;  5LLQ A;  1FKA E;  3EPH A;  3KZZ A;  4BC9 A;  2UU9 E;  2DB2 A;  2UXB E;  4NHR A;  4BC7 A;  4DV5 E;  2YTP A;  4BHB A;  3F6H A;  5AC5 A;  2PRT A;  2EN7 A;  4DV6 E;  2RS6 A;  2YTD A;  2HC5 A;  1UHZ A;  1YSA C;  4M9V C;  2L33 A;  2K4V A;  2L3C A;  4X65 E;  3MHH C;  1IBK E;  2IHR 1;  1IBL E;  4J8Z A;  1X49 A;  2EP3 A;  1ZAA C;  1WHN A;  5FLX C;  2R76 A;  2EMC A;  4I8O A;  1I94 E;  1A1I A;  2EN4 A;  3LML A;  2DLQ A;  2EMH A;  3HPS A;  4K0K E;  4F9C B;  1RC7 A;  2WZO A;  2EPM X;  1WRJ A;  3K6Q A;  4BMJ A;  4M0V A;  1XNR E;  2VQF E;  1GQE A; 
#chains in the Genus database with same CATH homology
 1IQS A;  1IQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...