1IQOA

Solution structure of mth1880 from methanobacterium thermoautotrophicum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
LFIATLKGIFTLKDLPEEFRPFVDYKAGLEKKKLSDDDEIAIISIKGTQSNHVLFLSSYNSVDEIRKELEEAGAKINHTTLKILEGHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN MTH1880
publication title Solution structure of a novel calcium binding protein, MTH1880, from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter
molecule tags Metal binding protein
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05370 DUF749 Domain of unknown function (DUF749)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.120 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Hypothetical protein MTH1880 1iqoA00
1IQSA 1IQOA
chains in the Genus database with same CATH superfamily
4WX9A 1T39A 3LMLA 4DV2E 2UUCE 1FKAE 2EPLX 4KZSA 1UBDC 2EM2A 2YTGA 1KJKA 2ELYA 2EZ6A 2DRPA 1Z1BA 4DR3E 4NHRA 2EOHA 2N3HA 2K7IA 4O24A 1N33E 2VQEE 2LCEA 4WXCA 5A6AA 2EPAA 2KOUA 4R03A 2WBSA 2YTOA 4RH8A 4K0KE 2ADRA 3BGHA 5IT9C 1YFHA 3C4TA 3J7AG 3HXLA 2EOFA 3HQ1A 2IHR1 2WZOA 1STUA 2EPXA 3UK3C 4LF4E 4HTGA 4R2DA 2EPCA 2YU8A 3H09A 1A1IA 4DMIA 1ZAAC 2V8QB 1GTKA 4X65E 4IS1C 4GZNC 1EH7A 2EE8A 5AASA 1T4OA 4X66E 4LTYA 3J7Yp 3MHSC 4BBYA 5LLQA 2YTNA 1A1JA 1PDAA 5DNYA 2PRTA 1RC7A 1J5EE 2L6MA 4DR6E 2YRMA 4JI3E 2EMIA 1AH5A 4O5GA 2V86A 2JWOA 3DF6A 4B3TE 4BCAA 1X47A 2EN6A 1G2FC 4LF6E 4HEIA 3OTOE 2RQLA 2JPAA 4AQYE 5IWAE 2F8BA 4WSPA 2EM4A 2JR1A 2L3CA 1G2DC 1N36E 4BC9A 4MLQA 2EOZA 2K4VA 2DLQA 4LU9A 1QU6A 2E1MA 3HPSA 2EN1A 1T4NA 4GKJE 4F9AB 2RTXA 2V85A 1N34E 2VF1A 1IBME 2LUPB 1YZ9A 5LMNE 4BHCA 4DR4E 2EOJA 1GZ6A 5FLXC 2UU9E 2M4IA 3MSWA 5A69A 2WBTA 2DMYA 5KL6A 2EOYA 1X48A 1BBGA 2NUFA 2DB2A 2YTQA 2Q8UA 3F6GA 1YYWA 2CSHA 2L3JA 4DV5E 3IWCA 4X64E 4BS9A 2N3GA 2EWLA 4R2AA 3EPHA 2JOXA 2LT7A 2EOQA 2KHXA 2UXCE 2RSMA 3T1HE 2L8TA 4JI5E 4DKKA 1YUIA 2LBSB 4N4RB 2L2NA 2DGCA 5KL5A 3HTXA 1PJSA 1UHZA 2L2MA 3JTZA 2EM8A 2LTSA 4TUIA 5KL4A 1EKZA 4DR2E 1DI2A 1XMOE 4BMJA 3EPKA 1NCSA 5KL7A 1YSAC 4DV3E 2RS7A 3P1XA 4BHBA 4KHPE 3OMLA 1TN9A 1T4LB 1O0WA 3FIGA 4JI2E 4NXME 1RQ0A 2EMKA 2NA2A 2E72A 4F6NA 2V83A 4R2SA 1BBOA 3EPJA 3C4BA 2VE7C 4DV1E 1YUJA 4NXNE 2B9DA 3AV0A 2YU5A 4I8OA 1KYQA 2ODRC 4ZYHA 2EL4A 3ADLA 2EL5A 1MGTA 2MC5A 5A6BD 1AAYA 4YHHE 1A1GA 2ELZA 4MLVA 4KWYA 1T38A 1EH8A 2EMWA 2EMZA 2I9IA 2UUAE 4B3SE 2EMHA 2EMLA 1PJQA 4JI7E 3K6QA 4LF7E 4JI8E 4F2JC 2BB8A 2EP3A 1TF6A 4Q35B 1ZBTA 4M0VA 1WRJA 3QG5C 4DV7E 2GPIA 2LO3A 4M30A 3M99B 1PJTA 2EQ0A 5IXMB 1IMUA 2EQ1A 2DLKA 2J7JA 2KONA 5BR8E 2LV2A 1NEIA 4ZYDA 2ENAA 3C6MA 2LRSA 1HR0E 3VK6A 2EM7A 2FTXB 4M9VC 2NUGA 3J81C 3F6HA 2F4VE 2MC6A 2ENHA 2LJUA 4DR7E 3LLHA 2N8XA 2JYAA 2UXDE 2LUQA 2NABA 4R2RA 4R2EA 2EMAA 2HGHA 2EPNA 2YT4A 3KZZA 2LVHA 4B3RE 3EQ1A 2LJHA 5T6JA 2YTPA 1HNZE 4JI0E 2EPPA 4DV6E 2ODRD 2EL6A 2L92A 1SR9A 2R76A 4JI1E 2CTDA 2FV4B 4LF9E 4M2ZA 4GKKE 2EN8A 2LE2A 2YWQA 2EORA 2VRDA 4B3ME 4J8ZA 4JI6E 3IWBA 1YYOA 3VYXA 1A1FA 2GLIA 1IBKE 2EOOA 1J26A 2JY9A 2JOBA 2WBUA 2EJ4A 5KL3A 5TSEA 4F54A 2JVAA 1JK1A 1X49A 2EM3A 4LF5E 3AUZA 4BC7A 4JI4E 4OX9E 4WYQB 1MEYC 1UN6B 1ZR9A 2V87A 3KWRA 5A6KA 1DGCA 3KZYA 1A1LA 1UILA 1QNTA 2YPNA 1IQOA 2H36X 5F3WA 2BBGA 5ADZA 2DIXA 2EPZA 4NZVA 3ZOQB 3J80C 5IV8B 3DJWA 2EM9A 1WJPA 1GQEA 3ECRA 2RSIA 2YZTA 4WSGA 2EN2A 4JYAE 4GEQB 1WHNA 2MKNA 5AC5A 2YRKA 1X6FA 5A6BA 4X9JA 2EOXA 4WPYA 2CT1A 2YTIA 5A2QC 2LMZA 2YTDA 5CFFE 5LMUE 2L33A 1A1KA 1SFEA 4R2QA 5LL6R 2NUEA 2B3TB 2EM0A 2ZM6E 2UXBE 3BIDA 2EN3A 2HC5A 2EQ3A 3RMPA 1TF3A 2EMBA 1PKPA 2L2KB 4JV5E 1X6EA 3THOB 1LLMC 4ZYGA 2V89A 4IJDA 3C6KA 2RS6A 2M7QA 2V88A 4LF8E 5AC4A 4R8OA 2JP9A 2G7HA 2EMGA 5A6JA 2MDRA 4P7DA 3JAMC 5AE2A 1XMQE 2CPNA 4DV0E 3VHTB 2EMFA 4DR5E 2ENCA 4L5NC 1IQSA 1ZBQA 4YY3E 2E5LE 2B7VA 4L8NA 2RPCA 3BBGA 2DMIA 2EOMA 2EM6A 1A1HA 2I13A 2EOSA 2GHFA 3THNA 3MHHC 2D9HA 3TQMA 1DQ3A 4F6MA 2M1SA 4X8WA 4O43A 2YTEA 4TUGA 2EMXA 5AE3A 4R2CA 4LFBE 2EN7A 4R2PA 1N3GA 2MKDA 2YTJA 4WXDA 2EPUA 1N32E 1X5WA 2EOIA 3JU0A 4ZYEA 4LFCE 4FK5C 1WXRA 4Q28A 1F2IG 1XNRE 4DV4E 2A25A 2EPRA 5AE1A 3BF2A 2FGGA 2UUBE 2EM5A 2EOEA 2R1FA 1I94E 3ADGA 2EPMX 1WHQA 2YTFA 4F9BB 2JXPA 4X62E 3VYYA 3T1YE 1L4SA 2DSYA 1HNXE 2YRHA 4WFTA 3HPZA 3ADIA 4OOGC 4LFAE 5KL2A 2YSOA 4F9CB 1ZU1A 2HJJA 2LTRA 1EH6A 2YSPA 4DUYE 2M9AA 2B7TA 1HNWE 1YYKA 2MDGA 1RMDA 2HHHE 4O4KA 1P47A 3IWDA 2EN4A 4P78A 4DR1E 3EPLA 1BB8A 1JK2A 3L00A 3ADJA 1X3CA 2EMYA 1FJGE 1YPNA 2WCC3 2EPOA 1IBLE 4RHBB 1X6HA 2EPKX 1B69A 1XNQE 2EMCA 2VQFE 4DUZE
chains in the Genus database with same CATH topology
1IQSA 1IQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQS A;  1IQO A; 
#chains in the Genus database with same CATH topology
 4WX9 A;  1T39 A;  3LML A;  4DV2 E;  2UUC E;  1FKA E;  2EPL X;  4KZS A;  1UBD C;  2EM2 A;  2YTG A;  1KJK A;  2ELY A;  2EZ6 A;  2DRP A;  1Z1B A;  4DR3 E;  4NHR A;  2EOH A;  2N3H A;  2K7I A;  4O24 A;  1N33 E;  2VQE E;  2LCE A;  4WXC A;  5A6A A;  2EPA A;  2KOU A;  4R03 A;  2WBS A;  2YTO A;  4RH8 A;  4K0K E;  2ADR A;  3BGH A;  5IT9 C;  1YFH A;  3C4T A;  3J7A G;  3HXL A;  2EOF A;  3HQ1 A;  2IHR 1;  2WZO A;  1STU A;  2EPX A;  3UK3 C;  4LF4 E;  4HTG A;  4R2D A;  2EPC A;  2YU8 A;  3H09 A;  1A1I A;  4DMI A;  1ZAA C;  2V8Q B;  1GTK A;  4X65 E;  4IS1 C;  4GZN C;  1EH7 A;  2EE8 A;  5AAS A;  1T4O A;  4X66 E;  4LTY A;  3J7Y p;  3MHS C;  4BBY A;  5LLQ A;  2YTN A;  1A1J A;  1PDA A;  5DNY A;  2PRT A;  1RC7 A;  1J5E E;  2L6M A;  4DR6 E;  2YRM A;  4JI3 E;  2EMI A;  1AH5 A;  4O5G A;  2V86 A;  2JWO A;  3DF6 A;  4B3T E;  4BCA A;  1X47 A;  2EN6 A;  1G2F C;  4LF6 E;  4HEI A;  3OTO E;  2RQL A;  2JPA A;  4AQY E;  5IWA E;  2F8B A;  4WSP A;  2EM4 A;  2JR1 A;  2L3C A;  1G2D C;  1N36 E;  4BC9 A;  4MLQ A;  2EOZ A;  2K4V A;  2DLQ A;  4LU9 A;  1QU6 A;  2E1M A;  3HPS A;  2EN1 A;  1T4N A;  4GKJ E;  4F9A B;  2RTX A;  2V85 A;  1N34 E;  2VF1 A;  1IBM E;  2LUP B;  1YZ9 A;  5LMN E;  4BHC A;  4DR4 E;  2EOJ A;  1GZ6 A;  5FLX C;  2UU9 E;  2M4I A;  3MSW A;  5A69 A;  2WBT A;  2DMY A;  5KL6 A;  2EOY A;  1X48 A;  1BBG A;  2NUF A;  2DB2 A;  2YTQ A;  2Q8U A;  3F6G A;  1YYW A;  2CSH A;  2L3J A;  4DV5 E;  3IWC A;  4X64 E;  4BS9 A;  2N3G A;  2EWL A;  4R2A A;  3EPH A;  2JOX A;  2LT7 A;  2EOQ A;  2KHX A;  2UXC E;  2RSM A;  3T1H E;  2L8T A;  4JI5 E;  4DKK A;  1YUI A;  2LBS B;  4N4R B;  2L2N A;  2DGC A;  5KL5 A;  3HTX A;  1PJS A;  1UHZ A;  2L2M A;  3JTZ A;  2EM8 A;  2LTS A;  4TUI A;  5KL4 A;  1EKZ A;  4DR2 E;  1DI2 A;  1XMO E;  4BMJ A;  3EPK A;  1NCS A;  5KL7 A;  1YSA C;  4DV3 E;  2RS7 A;  3P1X A;  4BHB A;  4KHP E;  3OML A;  1TN9 A;  1T4L B;  1O0W A;  3FIG A;  4JI2 E;  4NXM E;  1RQ0 A;  2EMK A;  2NA2 A;  2E72 A;  4F6N A;  2V83 A;  4R2S A;  1BBO A;  3EPJ A;  3C4B A;  2VE7 C;  4DV1 E;  1YUJ A;  4NXN E;  2B9D A;  3AV0 A;  2YU5 A;  4I8O A;  1KYQ A;  2ODR C;  4ZYH A;  2EL4 A;  3ADL A;  2EL5 A;  1MGT A;  2MC5 A;  5A6B D;  1AAY A;  4YHH E;  1A1G A;  2ELZ A;  4MLV A;  4KWY A;  1T38 A;  1EH8 A;  2EMW A;  2EMZ A;  2I9I A;  2UUA E;  4B3S E;  2EMH A;  2EML A;  1PJQ A;  4JI7 E;  3K6Q A;  4LF7 E;  4JI8 E;  4F2J C;  2BB8 A;  2EP3 A;  1TF6 A;  4Q35 B;  1ZBT A;  4M0V A;  1WRJ A;  3QG5 C;  4DV7 E;  2GPI A;  2LO3 A;  4M30 A;  3M99 B;  1PJT A;  2EQ0 A;  5IXM B;  1IMU A;  2EQ1 A;  2DLK A;  2J7J A;  2KON A;  5BR8 E;  2LV2 A;  1NEI A;  4ZYD A;  2ENA A;  3C6M A;  2LRS A;  1HR0 E;  3VK6 A;  2EM7 A;  2FTX B;  4M9V C;  2NUG A;  3J81 C;  3F6H A;  2F4V E;  2MC6 A;  2ENH A;  2LJU A;  4DR7 E;  3LLH A;  2N8X A;  2JYA A;  2UXD E;  2LUQ A;  2NAB A;  4R2R A;  4R2E A;  2EMA A;  2HGH A;  2EPN A;  2YT4 A;  3KZZ A;  2LVH A;  4B3R E;  3EQ1 A;  2LJH A;  5T6J A;  2YTP A;  1HNZ E;  4JI0 E;  2EPP A;  4DV6 E;  2ODR D;  2EL6 A;  2L92 A;  1SR9 A;  2R76 A;  4JI1 E;  2CTD A;  2FV4 B;  4LF9 E;  4M2Z A;  4GKK E;  2EN8 A;  2LE2 A;  2YWQ A;  2EOR A;  2VRD A;  4B3M E;  4J8Z A;  4JI6 E;  3IWB A;  1YYO A;  3VYX A;  1A1F A;  2GLI A;  1IBK E;  2EOO A;  1J26 A;  2JY9 A;  2JOB A;  2WBU A;  2EJ4 A;  5KL3 A;  5TSE A;  4F54 A;  2JVA A;  1JK1 A;  1X49 A;  2EM3 A;  4LF5 E;  3AUZ A;  4BC7 A;  4JI4 E;  4OX9 E;  4WYQ B;  1MEY C;  1UN6 B;  1ZR9 A;  2V87 A;  3KWR A;  5A6K A;  1DGC A;  3KZY A;  1A1L A;  1UIL A;  1QNT A;  2YPN A;  1IQO A;  2H36 X;  5F3W A;  2BBG A;  5ADZ A;  2DIX A;  2EPZ A;  4NZV A;  3ZOQ B;  3J80 C;  5IV8 B;  3DJW A;  2EM9 A;  1WJP A;  1GQE A;  3ECR A;  2RSI A;  2YZT A;  4WSG A;  2EN2 A;  4JYA E;  4GEQ B;  1WHN A;  2MKN A;  5AC5 A;  2YRK A;  1X6F A;  5A6B A;  4X9J A;  2EOX A;  4WPY A;  2CT1 A;  2YTI A;  5A2Q C;  2LMZ A;  2YTD A;  5CFF E;  5LMU E;  2L33 A;  1A1K A;  1SFE A;  4R2Q A;  5LL6 R;  2NUE A;  2B3T B;  2EM0 A;  2ZM6 E;  2UXB E;  3BID A;  2EN3 A;  2HC5 A;  2EQ3 A;  3RMP A;  1TF3 A;  2EMB A;  1PKP A;  2L2K B;  4JV5 E;  1X6E A;  3THO B;  1LLM C;  4ZYG A;  2V89 A;  4IJD A;  3C6K A;  2RS6 A;  2M7Q A;  2V88 A;  4LF8 E;  5AC4 A;  4R8O A;  2JP9 A;  2G7H A;  2EMG A;  5A6J A;  2MDR A;  4P7D A;  3JAM C;  5AE2 A;  1XMQ E;  2CPN A;  4DV0 E;  3VHT B;  2EMF A;  4DR5 E;  2ENC A;  4L5N C;  1IQS A;  1ZBQ A;  4YY3 E;  2E5L E;  2B7V A;  4L8N A;  2RPC A;  3BBG A;  2DMI A;  2EOM A;  2EM6 A;  1A1H A;  2I13 A;  2EOS A;  2GHF A;  3THN A;  3MHH C;  2D9H A;  3TQM A;  1DQ3 A;  4F6M A;  2M1S A;  4X8W A;  4O43 A;  2YTE A;  4TUG A;  2EMX A;  5AE3 A;  4R2C A;  4LFB E;  2EN7 A;  4R2P A;  1N3G A;  2MKD A;  2YTJ A;  4WXD A;  2EPU A;  1N32 E;  1X5W A;  2EOI A;  3JU0 A;  4ZYE A;  4LFC E;  4FK5 C;  1WXR A;  4Q28 A;  1F2I G;  1XNR E;  4DV4 E;  2A25 A;  2EPR A;  5AE1 A;  3BF2 A;  2FGG A;  2UUB E;  2EM5 A;  2EOE A;  2R1F A;  1I94 E;  3ADG A;  2EPM X;  1WHQ A;  2YTF A;  4F9B B;  2JXP A;  4X62 E;  3VYY A;  3T1Y E;  1L4S A;  2DSY A;  1HNX E;  2YRH A;  4WFT A;  3HPZ A;  3ADI A;  4OOG C;  4LFA E;  5KL2 A;  2YSO A;  4F9C B;  1ZU1 A;  2HJJ A;  2LTR A;  1EH6 A;  2YSP A;  4DUY E;  2M9A A;  2B7T A;  1HNW E;  1YYK A;  2MDG A;  1RMD A;  2HHH E;  4O4K A;  1P47 A;  3IWD A;  2EN4 A;  4P78 A;  4DR1 E;  3EPL A;  1BB8 A;  1JK2 A;  3L00 A;  3ADJ A;  1X3C A;  2EMY A;  1FJG E;  1YPN A;  2WCC 3;  2EPO A;  1IBL E;  4RHB B;  1X6H A;  2EPK X;  1B69 A;  1XNQ E;  2EMC A;  2VQF E;  4DUZ E; 
#chains in the Genus database with same CATH homology
 1IQS A;  1IQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...