1IQOA

Solution structure of mth1880 from methanobacterium thermoautotrophicum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
b'LFIATLKGIFTLKDLPEEFRPFVDYKAGLEKKKLSDDDEIAIISIKGTQSNHVLFLSSYNSVDEIRKELEEAGAKINHTTLKILEGHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN MTH1880
publication title Solution structure of a novel calcium binding protein, MTH1880, from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter
molecule tags Metal binding protein
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05370 DUF749 Domain of unknown function (DUF749)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.120 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Hypothetical protein MTH1880 1iqoA00
1IQSA 1IQOA
chains in the Genus database with same CATH superfamily
2MKDA 2EM6A 4BCAA 2J7JA 2EQ1A 2LUPB 1YFHA 2L3CA 1QNTA 2JOBA 2CPNA 4R2QA 2LE2A 3F6GA 2LMZA 2WBTA 4BC9A 4LF5E 1A1HA 3JTZA 2R76A 2YTEA 1X6HA 4R2DA 2NUFA 1XNRE 3EPJA 4RH8A 3THNA 4DV7E 2LVHA 2EOJA 3F6HA 2EL6A 3J7AG 2EOXA 1TN9A 2YPNA 2K4VA 4BBYA 1IQOA 2B3TB 2WBUA 1UBDC 1BBOA 1G2FC 1TF6A 1EH7A 4KZSA 4P78A 4X66E 2VQFE 5F3WA 2YRMA 2EOYA 2KONA 1FKAE 2V87A 1YUIA 1T4NA 4M9VC 1N34E 4IJDA 3C4BA 2EMLA 4ZYHA 5A6KA 1TF3A 2YTJA 4DR1E 2EPPA 1DQ3A 1PJTA 2JYAA 5AE1A 3BF2A 5LMUE 2UXDE 4WPYA 4B3TE 4LFAE 4DV0E 4TUIA 5IXMB 5LMNE 4WSGA 4WFTA 2FV4B 2EM4A 2NA2A 5AE3A 2EWLA 2YTGA 2UUAE 1N3GA 2FGGA 4WSPA 4MLVA 3IWBA 2FTXB 2ELZA 1WJPA 2EQ0A 2ZM6E 2D9HA 4IS1C 3MSWA 2YSOA 2EPMX 4L8NA 1J26A 1PJQA 2EM7A 1HNWE 2E5LE 3MHHC 2GHFA 2DIXA 4LTYA 4X62E 3EPLA 2CSHA 3L00A 2MC5A 5FLXC 5AC5A 1G2DC 1UN6B 2YZTA 5IV8B 2E1MA 3C6MA 1WXRA 1RC7A 4NZVA 1I94E 4DR7E 1L4SA 4DR2E 1IBLE 2JP9A 1UHZA 1Z1BA 2LTSA 2ENCA 2UU9E 2EOSA 2EM5A 1PKPA 1A1LA 2EOOA 4Q28A 2HHHE 4NXME 1XMQE 1N32E 2EN2A 2EORA 4DV6E 4X65E 4LF8E 4LF6E 2N3GA 1KYQA 2YT4A 2YWQA 3AV0A 2ELYA 4P7DA 5IWAE 2LBSB 4WXCA 2F8BA 2M4IA 1GTKA 2IHR1 4JI7E 2A25A 3RMPA 1HNZE 4OOGC 2NUEA 1IMUA 5A2QC 4JI4E 2EMHA 2EPUA 2ODRC 3DJWA 2WCC3 2ADRA 3FIGA 3THOB 1X6FA 2YU5A 1X6EA 2EPNA 4F9CB 4O4KA 1EKZA 4JI1E 4F9BB 4F6NA 4DV2E 2M1SA 1EH8A 2N8XA 2NABA 4BC7A 3J81C 2EM3A 3TQMA 4NHRA 4DR3E 2V88A 3IWCA 4GZNC 4NXNE 4DR5E 2EJ4A 2CT1A 3UK3C 2N3HA 2YTDA 3T1HE 4DUYE 5LLQA 2EN6A 2VF1A 5A6BD 3J7Yp 2UUBE 1ZBTA 1X3CA 2EPRA 2YTOA 5A6JA 4HTGA 2DLKA 2EMXA 3HPSA 5AASA 4HEIA 1NCSA 4BHBA 2VRDA 4BHCA 1A1FA 2LJUA 1QU6A 2JXPA 2DMYA 3ECRA 2LV2A 2YU8A 1XNQE 1ZR9A 2RSIA 4K0KE 4DV3E 4O5GA 1YPNA 1ZBQA 4DV1E 1KJKA 2NUGA 2YRKA 3ADLA 4R8OA 4MLQA 1UILA 3K6QA 1XMOE 2M9AA 2EQ3A 4ZYDA 1F2IG 2EN8A 4R2CA 2EMBA 2EZ6A 4DV4E 2ENHA 5AC4A 3C6KA 2BBGA 2EPLX 2EN1A 2L92A 4JI5E 1YYWA 2PRTA 2DRPA 3P1XA 2K7IA 3IWDA 5KL3A 4DKKA 4DV5E 2V86A 5T6JA 1EH6A 1YSAC 1YUJA 2YTIA 3EPKA 2L33A 2EOIA 2EPKX 2L6MA 2HGHA 2EM0A 2EM2A 2EPZA 2B9DA 1AH5A 3LLHA 4F6MA 4JV5E 2EN4A 4R03A 3DF6A 5A69A 4YHHE 2V85A 2EE8A 2EMKA 4JI0E 4KWYA 1WHNA 2EMAA 3J80C 1YYKA 3MHSC 2EOZA 3OMLA 1GQEA 4O24A 3KWRA 1DI2A 4I8OA 2UXCE 2EM9A 2HJJA 2DMIA 3EPHA 4BS9A 2MDRA 1STUA 2L2NA 4M30A 4LF9E 2EPAA 2WZOA 2EMWA 1NEIA 2KHXA 4GKJE 4TUGA 2CTDA 1T39A 1PJSA 3ADGA 4JYAE 3JU0A 4R2RA 4LF7E 1B69A 2VQEE 2RPCA 2GPIA 4KHPE 3T1YE 2ODRD 5BR8E 2EL4A 1A1JA 2I13A 2EMFA 1LLMC 5KL4A 2EM8A 2I9IA 3OTOE 1PDAA 2L2KB 2DLQA 1IQSA 4RHBB 4AQYE 4BMJA 1AAYA 2JOXA 5AE2A 2EOFA 3HTXA 2JY9A 4F9AB 2MKNA 4B3ME 2YTQA 4M2ZA 5DNYA 3HPZA 2JVAA 4R2SA 2F4VE 1O0WA 3C4TA 2MC6A 4JI6E 2YTPA 3JAMC 1GZ6A 4DMIA 4OX9E 1A1GA 4J8ZA 4LFCE 2EL5A 2RS6A 3AUZA 4WYQB 5KL2A 3KZZA 2DSYA 2E72A 2BB8A 2JR1A 4B3SE 2HC5A 2EOQA 3ADJA 4FK5C 4X9JA 4N4RB 2EN7A 1X47A 2EMYA 2L8TA 3ZOQB 3LMLA 2L2MA 4L5NC 1MGTA 2EOHA 3H09A 1BBGA 1X5WA 2EPOA 5IT9C 2H36X 2LCEA 2LJHA 3QG5C 2EMZA 3HQ1A 5A6BA 1FJGE 1BB8A 4DR6E 2V83A 3BIDA 1HNXE 2M7QA 2EPXA 4LFBE 2RS7A 2V8QB 2WBSA 1RQ0A 2EP3A 3BBGA 2EPCA 2UXBE 4GKKE 1A1IA 2GLIA 2L3JA 4JI8E 1JK1A 4DR4E 4LF4E 4WXDA 2YSPA 5ADZA 2Q8UA 1HR0E 1MEYC 2ENAA 3ADIA 2LRSA 1J5EE 3VYXA 1WHQA 5CFFE 4F2JC 2RTXA 1N36E 4F54A 2EMGA 2R1FA 2LUQA 2G7HA 4M0VA 1YZ9A 2B7VA 5KL5A 5LL6R 1ZAAC 1X49A 3VK6A 4JI3E 4B3RE 4WX9A 1IBME 2B7TA 1T38A 1SR9A 4R2PA 3KZYA 2EMCA 1X48A 1ZU1A 3VHTB 4R2AA 5KL6A 1T4OA 4YY3E 3EQ1A 2RQLA 3M99B 4LU9A 1IBKE 2EN3A 4GEQB 2EMIA 4ZYEA 2MDGA 2DB2A 2EOEA 1T4LB 1RMDA 2LT7A 4DUZE 3BGHA 2YTNA 2V89A 2EOMA 2LO3A 1WRJA 1SFEA 3VYYA 1P47A 2KOUA 1YYOA 2YTFA 2VE7C 4X64E 1A1KA 2LTRA 2YRHA 2JPAA 3HXLA 4JI2E 5TSEA 4Q35B 5A6AA 2DGCA 1DGCA 2UUCE 4ZYGA 1N33E 1JK2A 4O43A 2JWOA 4X8WA 4R2EA 2RSMA 5KL7A
chains in the Genus database with same CATH topology
1IQSA 1IQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQS A;  1IQO A; 
#chains in the Genus database with same CATH topology
 2MKD A;  2EM6 A;  4BCA A;  2J7J A;  2EQ1 A;  2LUP B;  1YFH A;  2L3C A;  1QNT A;  2JOB A;  2CPN A;  4R2Q A;  2LE2 A;  3F6G A;  2LMZ A;  2WBT A;  4BC9 A;  4LF5 E;  1A1H A;  3JTZ A;  2R76 A;  2YTE A;  1X6H A;  4R2D A;  2NUF A;  1XNR E;  3EPJ A;  4RH8 A;  3THN A;  4DV7 E;  2LVH A;  2EOJ A;  3F6H A;  2EL6 A;  3J7A G;  2EOX A;  1TN9 A;  2YPN A;  2K4V A;  4BBY A;  1IQO A;  2B3T B;  2WBU A;  1UBD C;  1BBO A;  1G2F C;  1TF6 A;  1EH7 A;  4KZS A;  4P78 A;  4X66 E;  2VQF E;  5F3W A;  2YRM A;  2EOY A;  2KON A;  1FKA E;  2V87 A;  1YUI A;  1T4N A;  4M9V C;  1N34 E;  4IJD A;  3C4B A;  2EML A;  4ZYH A;  5A6K A;  1TF3 A;  2YTJ A;  4DR1 E;  2EPP A;  1DQ3 A;  1PJT A;  2JYA A;  5AE1 A;  3BF2 A;  5LMU E;  2UXD E;  4WPY A;  4B3T E;  4LFA E;  4DV0 E;  4TUI A;  5IXM B;  5LMN E;  4WSG A;  4WFT A;  2FV4 B;  2EM4 A;  2NA2 A;  5AE3 A;  2EWL A;  2YTG A;  2UUA E;  1N3G A;  2FGG A;  4WSP A;  4MLV A;  3IWB A;  2FTX B;  2ELZ A;  1WJP A;  2EQ0 A;  2ZM6 E;  2D9H A;  4IS1 C;  3MSW A;  2YSO A;  2EPM X;  4L8N A;  1J26 A;  1PJQ A;  2EM7 A;  1HNW E;  2E5L E;  3MHH C;  2GHF A;  2DIX A;  4LTY A;  4X62 E;  3EPL A;  2CSH A;  3L00 A;  2MC5 A;  5FLX C;  5AC5 A;  1G2D C;  1UN6 B;  2YZT A;  5IV8 B;  2E1M A;  3C6M A;  1WXR A;  1RC7 A;  4NZV A;  1I94 E;  4DR7 E;  1L4S A;  4DR2 E;  1IBL E;  2JP9 A;  1UHZ A;  1Z1B A;  2LTS A;  2ENC A;  2UU9 E;  2EOS A;  2EM5 A;  1PKP A;  1A1L A;  2EOO A;  4Q28 A;  2HHH E;  4NXM E;  1XMQ E;  1N32 E;  2EN2 A;  2EOR A;  4DV6 E;  4X65 E;  4LF8 E;  4LF6 E;  2N3G A;  1KYQ A;  2YT4 A;  2YWQ A;  3AV0 A;  2ELY A;  4P7D A;  5IWA E;  2LBS B;  4WXC A;  2F8B A;  2M4I A;  1GTK A;  2IHR 1;  4JI7 E;  2A25 A;  3RMP A;  1HNZ E;  4OOG C;  2NUE A;  1IMU A;  5A2Q C;  4JI4 E;  2EMH A;  2EPU A;  2ODR C;  3DJW A;  2WCC 3;  2ADR A;  3FIG A;  3THO B;  1X6F A;  2YU5 A;  1X6E A;  2EPN A;  4F9C B;  4O4K A;  1EKZ A;  4JI1 E;  4F9B B;  4F6N A;  4DV2 E;  2M1S A;  1EH8 A;  2N8X A;  2NAB A;  4BC7 A;  3J81 C;  2EM3 A;  3TQM A;  4NHR A;  4DR3 E;  2V88 A;  3IWC A;  4GZN C;  4NXN E;  4DR5 E;  2EJ4 A;  2CT1 A;  3UK3 C;  2N3H A;  2YTD A;  3T1H E;  4DUY E;  5LLQ A;  2EN6 A;  2VF1 A;  5A6B D;  3J7Y p;  2UUB E;  1ZBT A;  1X3C A;  2EPR A;  2YTO A;  5A6J A;  4HTG A;  2DLK A;  2EMX A;  3HPS A;  5AAS A;  4HEI A;  1NCS A;  4BHB A;  2VRD A;  4BHC A;  1A1F A;  2LJU A;  1QU6 A;  2JXP A;  2DMY A;  3ECR A;  2LV2 A;  2YU8 A;  1XNQ E;  1ZR9 A;  2RSI A;  4K0K E;  4DV3 E;  4O5G A;  1YPN A;  1ZBQ A;  4DV1 E;  1KJK A;  2NUG A;  2YRK A;  3ADL A;  4R8O A;  4MLQ A;  1UIL A;  3K6Q A;  1XMO E;  2M9A A;  2EQ3 A;  4ZYD A;  1F2I G;  2EN8 A;  4R2C A;  2EMB A;  2EZ6 A;  4DV4 E;  2ENH A;  5AC4 A;  3C6K A;  2BBG A;  2EPL X;  2EN1 A;  2L92 A;  4JI5 E;  1YYW A;  2PRT A;  2DRP A;  3P1X A;  2K7I A;  3IWD A;  5KL3 A;  4DKK A;  4DV5 E;  2V86 A;  5T6J A;  1EH6 A;  1YSA C;  1YUJ A;  2YTI A;  3EPK A;  2L33 A;  2EOI A;  2EPK X;  2L6M A;  2HGH A;  2EM0 A;  2EM2 A;  2EPZ A;  2B9D A;  1AH5 A;  3LLH A;  4F6M A;  4JV5 E;  2EN4 A;  4R03 A;  3DF6 A;  5A69 A;  4YHH E;  2V85 A;  2EE8 A;  2EMK A;  4JI0 E;  4KWY A;  1WHN A;  2EMA A;  3J80 C;  1YYK A;  3MHS C;  2EOZ A;  3OML A;  1GQE A;  4O24 A;  3KWR A;  1DI2 A;  4I8O A;  2UXC E;  2EM9 A;  2HJJ A;  2DMI A;  3EPH A;  4BS9 A;  2MDR A;  1STU A;  2L2N A;  4M30 A;  4LF9 E;  2EPA A;  2WZO A;  2EMW A;  1NEI A;  2KHX A;  4GKJ E;  4TUG A;  2CTD A;  1T39 A;  1PJS A;  3ADG A;  4JYA E;  3JU0 A;  4R2R A;  4LF7 E;  1B69 A;  2VQE E;  2RPC A;  2GPI A;  4KHP E;  3T1Y E;  2ODR D;  5BR8 E;  2EL4 A;  1A1J A;  2I13 A;  2EMF A;  1LLM C;  5KL4 A;  2EM8 A;  2I9I A;  3OTO E;  1PDA A;  2L2K B;  2DLQ A;  1IQS A;  4RHB B;  4AQY E;  4BMJ A;  1AAY A;  2JOX A;  5AE2 A;  2EOF A;  3HTX A;  2JY9 A;  4F9A B;  2MKN A;  4B3M E;  2YTQ A;  4M2Z A;  5DNY A;  3HPZ A;  2JVA A;  4R2S A;  2F4V E;  1O0W A;  3C4T A;  2MC6 A;  4JI6 E;  2YTP A;  3JAM C;  1GZ6 A;  4DMI A;  4OX9 E;  1A1G A;  4J8Z A;  4LFC E;  2EL5 A;  2RS6 A;  3AUZ A;  4WYQ B;  5KL2 A;  3KZZ A;  2DSY A;  2E72 A;  2BB8 A;  2JR1 A;  4B3S E;  2HC5 A;  2EOQ A;  3ADJ A;  4FK5 C;  4X9J A;  4N4R B;  2EN7 A;  1X47 A;  2EMY A;  2L8T A;  3ZOQ B;  3LML A;  2L2M A;  4L5N C;  1MGT A;  2EOH A;  3H09 A;  1BBG A;  1X5W A;  2EPO A;  5IT9 C;  2H36 X;  2LCE A;  2LJH A;  3QG5 C;  2EMZ A;  3HQ1 A;  5A6B A;  1FJG E;  1BB8 A;  4DR6 E;  2V83 A;  3BID A;  1HNX E;  2M7Q A;  2EPX A;  4LFB E;  2RS7 A;  2V8Q B;  2WBS A;  1RQ0 A;  2EP3 A;  3BBG A;  2EPC A;  2UXB E;  4GKK E;  1A1I A;  2GLI A;  2L3J A;  4JI8 E;  1JK1 A;  4DR4 E;  4LF4 E;  4WXD A;  2YSP A;  5ADZ A;  2Q8U A;  1HR0 E;  1MEY C;  2ENA A;  3ADI A;  2LRS A;  1J5E E;  3VYX A;  1WHQ A;  5CFF E;  4F2J C;  2RTX A;  1N36 E;  4F54 A;  2EMG A;  2R1F A;  2LUQ A;  2G7H A;  4M0V A;  1YZ9 A;  2B7V A;  5KL5 A;  5LL6 R;  1ZAA C;  1X49 A;  3VK6 A;  4JI3 E;  4B3R E;  4WX9 A;  1IBM E;  2B7T A;  1T38 A;  1SR9 A;  4R2P A;  3KZY A;  2EMC A;  1X48 A;  1ZU1 A;  3VHT B;  4R2A A;  5KL6 A;  1T4O A;  4YY3 E;  3EQ1 A;  2RQL A;  3M99 B;  4LU9 A;  1IBK E;  2EN3 A;  4GEQ B;  2EMI A;  4ZYE A;  2MDG A;  2DB2 A;  2EOE A;  1T4L B;  1RMD A;  2LT7 A;  4DUZ E;  3BGH A;  2YTN A;  2V89 A;  2EOM A;  2LO3 A;  1WRJ A;  1SFE A;  3VYY A;  1P47 A;  2KOU A;  1YYO A;  2YTF A;  2VE7 C;  4X64 E;  1A1K A;  2LTR A;  2YRH A;  2JPA A;  3HXL A;  4JI2 E;  5TSE A;  4Q35 B;  5A6A A;  2DGC A;  1DGC A;  2UUC E;  4ZYG A;  1N33 E;  1JK2 A;  4O43 A;  2JWO A;  4X8W A;  4R2E A;  2RSM A;  5KL7 A; 
#chains in the Genus database with same CATH homology
 1IQS A;  1IQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...