2JOBA

Solution structure of an antilipopolysaccharide factor from shrimp and its possible lipid a binding site
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
102
structure length
102
Chain Sequence
EAYVQGWEAVAAAVASKIVGLWRNEKTELLGHECKFTVKPYLKRFQVYYKGRMWCPGWTAIRGEASTRSQSGVAGKTAKDFVRKAFQKGLISQQEANQWLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antilipopolysaccharide factor
publication title NMR structure of rALF-Pm3, an anti-lipopolysaccharide factor from shrimp: Model of the possible lipid A-binding site
pubmed doi rcsb
source organism Penaeus monodon
molecule tags Lipid binding protein
total genus 24
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11630 DUF3254 Protein of unknown function (DUF3254)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.320 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jobA00
2JOBA
chains in the Genus database with same CATH superfamily
2LJHA 3IWCA 2CSHA 1N32E 1A1KA 2B3TB 3THNA 2DMYA 2EN6A 3EQ1A 2B7TA 3MSWA 1WXRA 3HPZA 3M99B 1HR0E 5AE1A 3ZOQB 5LMUE 4F9BB 2EOJA 1UN6B 3JTZA 1QNTA 2MDGA 2LE2A 2WBTA 4DV7E 5T6JA 3BF2A 2EL4A 2LBSB 2ENCA 2EMWA 4F54A 4NXNE 1X6FA 2VF1A 2EM0A 2ENAA 2EWLA 2EZ6A 3EPHA 4R2DA 2JYAA 5A6BD 2RSMA 3JU0A 2EM9A 2N3GA 5IV8B 2M9AA 1X5WA 1X6EA 2EOQA 3MHSC 1YYKA 4DV0E 1NCSA 2LMZA 2YTJA 4X64E 2NABA 1UBDC 2F8BA 1STUA 3BGHA 2EMGA 1FKAE 1J5EE 1RMDA 3L00A 3VYXA 1A1JA 2BB8A 2EPZA 4O43A 1EKZA 1G2DC 2DRPA 3MHHC 3AUZA 5DNYA 4F6MA 5IT9C 5A69A 1LLMC 3J80C 2RTXA 2MC6A 2YRHA 4WYQB 4DR5E 1I94E 1WHQA 2YZTA 4DMIA 2K7IA 1XMOE 2F4VE 2I13A 2EMXA 2DSYA 2EMFA 2YTNA 4O5GA 4ZYGA 4DV3E 2GPIA 2CT1A 2H36X 2M7QA 2EP3A 4GEQB 2EPOA 2EN1A 3AV0A 2EMCA 4MLQA 3HQ1A 2EM2A 4ZYEA 3VYYA 4M2ZA 1UILA 2EM3A 2WBSA 3KWRA 4JI8E 1IBME 2NUEA 2EOHA 3OTOE 2EORA 1Z1BA 4RHBB 4R2CA 5KL5A 2UUCE 2L3CA 3THOB 2DMIA 1T4LB 3IWDA 4R2QA 4DV5E 2V86A 4ZYHA 4J8ZA 2CPNA 4R8OA 4L8NA 4IS1C 3T1YE 2EOIA 2V85A 2DGCA 2L2MA 4K0KE 5A2QC 4B3SE 2UXBE 1PJSA 2B9DA 2GLIA 3C4TA 4R2SA 1X49A 3DJWA 2EOYA 1GTKA 2NUGA 4X9JA 2LUPB 2YSOA 5LL6R 2YSPA 4JI0E 3C6KA 1HNZE 4X8WA 1DI2A 1GQEA 2YU8A 4DR2E 1BBOA 4KWYA 1TF3A 2E5LE 5F3WA 1ZBTA 4JI3E 4F9AB 2EPAA 2DLQA 1T4NA 2EM5A 1RC7A 1XNRE 2JOBA 4BCAA 2JVAA 1FJGE 4JI2E 2LO3A 4JI6E 4BC7A 1T39A 3LMLA 1GZ6A 2EPUA 1RQ0A 2ADRA 3QG5C 1DQ3A 2V87A 4M30A 2EM8A 1YPNA 2WZOA 2PRTA 4Q35B 2EL5A 4WX9A 2Q8UA 2EMAA 1T4OA 4O24A 1PJQA 4L5NC 4DV4E 2YTGA 4LF8E 1A1IA 3JAMC 5AC4A 4GKKE 2HGHA 4WPYA 4JV5E 4BS9A 1TN9A 4R2PA 4WSGA 2EPMX 4DR1E 1BB8A 2G7HA 2EJ4A 5KL2A 1PDAA 2EMKA 1IBLE 5IXMB 1BBGA 1A1FA 1WRJA 2YU5A 5KL6A 3HPSA 4WFTA 4LU9A 2MKDA 4JYAE 1ZAAC 2MDRA 4X66E 2EMLA 1O0WA 2DIXA 2EE8A 4O4KA 2JOXA 2EMIA 1JK2A 2ODRC 4DV6E 2RQLA 1J26A 2WCC3 2L92A 5BR8E 1ZBQA 2GHFA 4I8OA 1B69A 2EMYA 4BHBA 4TUIA 2VE7C 1YYWA 2ODRD 2YTEA 4R2RA 4WXDA 3ADGA 1YSAC 2YWQA 2YPNA 2EQ1A 4P78A 4HTGA 2K4VA 2I9IA 2YTDA 4HEIA 3P1XA 2FV4B 2DLKA 1IMUA 1UHZA 1SR9A 2R1FA 2WBUA 2VQFE 4LF5E 2EQ0A 2LV2A 4YY3E 4DR6E 2JWOA 1N33E 2FTXB 1YUIA 2EL6A 4DV2E 2RS6A 3FIGA 4M9VC 2EOMA 1PJTA 3C4BA 2EPRA 4X62E 4LF6E 3VK6A 2IHR1 2EMBA 4JI5E 1QU6A 5ADZA 2JPAA 1IQOA 2EN2A 2LTSA 3ADIA 1KYQA 2KHXA 1AAYA 2UXCE 2L8TA 2YT4A 2VRDA 4WXCA 2ELZA 3IWBA 2YRKA 5LMNE 4LF4E 2RSIA 2BBGA 4BC9A 4DUYE 2E1MA 2LCEA 4R2AA 2EPLX 4LFBE 3HXLA 2EPPA 3BIDA 1WJPA 4X65E 2LRSA 4TUGA 1YUJA 4WSPA 5A6BA 4DKKA 2L3JA 2EOXA 4BMJA 5A6KA 4BBYA 2LT7A 1HNXE 3EPKA 4B3ME 2V83A 3T1HE 1X48A 2YTOA 1MEYC 4JI7E 4LF9E 2EN7A 3BBGA 2M1SA 4P7DA 2EOZA 2EPXA 4KHPE 2VQEE 4Q28A 3EPJA 2L6MA 3C6MA 3VHTB 4LFCE 1IBKE 2JP9A 2EM6A 3KZYA 5KL3A 1JK1A 3ADJA 4N4RB 1YZ9A 5A6JA 1WHNA 2EOFA 2YTIA 2YTPA 4JI4E 3F6GA 1TF6A 4OX9E 1X47A 2YRMA 2MC5A 1AH5A 4NZVA 1P47A 2YTQA 2V88A 4NHRA 2LUQA 2NUFA 4JI1E 4AQYE 2EOOA 2HC5A 5A6AA 2E72A 2N3HA 3DF6A 2HHHE 2EMHA 3ADLA 4R03A 2EN3A 1ZR9A 1A1GA 4ZYDA 2MKNA 2EPNA 4KZSA 2JY9A 4LFAE 4R2EA 3J81C 3J7Yp 2EM7A 2YTFA 4B3RE 4B3TE 1KJKA 1DGCA 4IJDA 2EN8A 1EH6A 4F2JC 1HNWE 1ZU1A 2EMZA 5CFFE 2B7VA 4F9CB 1PKPA 2RPCA 4GKJE 3OMLA 4F6NA 2EOEA 5AC5A 1A1HA 2EPKX 3H09A 4NXME 2DB2A 4MLVA 2UUBE 2HJJA 2J7JA 3HTXA 4GZNC 1YFHA 2V89A 4DR3E 1MGTA 1G2FC 3EPLA 1SFEA 2NA2A 5AE2A 4DV1E 5AASA 4LF7E 1A1LA 1XNQE 2N8XA 5FLXC 2UXDE 1N36E 2M4IA 2KONA 1EH7A 2ZM6E 4BHCA 2EN4A 3J7AG 2CTDA 2FGGA 3UK3C 2JR1A 3RMPA 2UUAE 2RS7A 5KL4A 2EM4A 5KL7A 2L2KB 1YYOA 2EQ3A 1F2IG 4LTYA 2KOUA 4M0VA 2L33A 2ENHA 1X6HA 1N3GA 3LLHA 4YHHE 2L2NA 4DR4E 2LJUA 2JXPA 3ECRA 3TQMA 5TSEA 4DUZE 1L4SA 2EPCA 5LLQA 2ELYA 5AE3A 3F6HA 2LTRA 2UU9E 5IWAE 2V8QB 4OOGC 2D9HA 1EH8A 1T38A 1N34E 4FK5C 1IQSA 1XMQE 3KZZA 1NEIA 2EOSA 2LVHA 2A25A 2R76A 3K6QA 1X3CA 4RH8A 4DR7E
chains in the Genus database with same CATH topology
2LJHA 2N3HA 3ADGA 3DF6A 3IWCA 2HHHE 4P78A 4R03A 1T4LB 3ADLA 2K4VA 3IWDA 4DV5E 2V86A 2FV4B 3P1XA 4J8ZA 2CPNA 1N32E 4KZSA 2B3TB 4R8OA 2JY9A 4L8NA 4LFAE 3J81C 1UHZA 3J7Yp 1SR9A 3T1YE 2V85A 2VQFE 4B3TE 4B3RE 4LF5E 2DMYA 2L2MA 4DR7E 2B7TA 4K0KE 3MSWA 5A2QC 4YY3E 1WXRA 4B3SE 2UXBE 4DR6E 2JWOA 2B9DA 3HPZA 3C4TA 1HR0E 5AE1A 2FTXB 1X49A 1N33E 3DJWA 3ZOQB 1HNWE 4DV2E 2NUGA 5CFFE 2B7VA 2RS6A 3FIGA 2LUPB 3C4BA 5LMUE 4F9CB 1PKPA 5LL6R 4F9BB 4X62E 4LF6E 4GKJE 3VK6A 2IHR1 3OMLA 4JI0E 4JI5E 3JTZA 1QU6A 4X8WA 5ADZA 1HNZE 1GQEA 1DI2A 4DR2E 3H09A 2LE2A 4DV7E 4NXME 2DB2A 2UUBE 5T6JA 2E5LE 2LBSB 5F3WA 2LTSA 3ADIA 1ZBTA 4JI3E 4F9AB 2KHXA 2UXCE 2L8TA 2YT4A 1T4NA 1RC7A 1XNRE 2JOBA 4F54A 4BCAA 3HTXA 2JVAA 4NXNE 2V89A 2VF1A 3IWBA 5LMNE 4DR3E 4LF4E 1FJGE 4JI2E 2EWLA 4BC7A 4BC9A 4DUYE 4JI6E 3LMLA 2NA2A 1GZ6A 2EZ6A 5AE2A 2E1MA 4DV1E 1RQ0A 5AASA 4LF7E 2RSMA 1XNQE 3JU0A 4M30A 1DQ3A 2V87A 2N3GA 5FLXC 4LFBE 2WZOA 2UXDE 1N36E 2M4IA 2KONA 2ZM6E 3HXLA 1YYKA 1T4OA 3J7AG 4DV0E 2FGGA 4X65E 2LMZA 2LRSA 4TUGA 4WSPA 4L5NC 4DV4E 4X64E 4DKKA 2F8BA 2L3JA 2JR1A 1STUA 3RMPA 4LF8E 4BMJA 1FKAE 1J5EE 2UUAE 2RS7A 3JAMC 4GKKE 4BBYA 1HNXE 4B3ME 3VYXA 2L2KB 2V83A 4WPYA 4JV5E 1YYOA 1EKZA 4BS9A 1X48A 3T1HE 3AUZA 4LTYA 2KOUA 4M0VA 4JI7E 4LF9E 2L33A 5DNYA 4DR1E 5IT9C 3J80C 2RTXA 2MC6A 2M1SA 4WYQB 4DR5E 3LLHA 1I94E 2G7HA 4P7DA 1WHQA 4YHHE 1IBLE 2YZTA 4DMIA 2L2NA 1XMOE 4DR4E 2VQEE 4KHPE 4Q28A 2L6MA 2F4VE 3HPSA 2DSYA 4DUZE 4DV3E 4WFTA 4LU9A 4LFCE 1IBKE 4JYAE 2H36X 3ADJA 2MDRA 2M7QA 4X66E 1YZ9A 1WHNA 4GEQB 1O0WA 3AV0A 2DIXA 5AE3A 4JI4E 3F6HA 2LTRA 2UU9E 3F6GA 2UUCE 3HQ1A 2JOXA 3VYYA 5IWAE 1UILA 4M2ZA 4OX9E 2ODRC 1X47A 2V8QB 4OOGC 4DV6E 2MC5A 3KWRA 4JI8E 1IBME 1J26A 2L92A 5BR8E 2V88A 2NUEA 1ZBQA 2LUQA 1N34E 2NUFA 4JI1E 4I8OA 1XMQE 3OTOE 4AQYE 4TUIA 2VE7C 1YYWA 2ODRD 3K6QA 2L3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOB A; 
#chains in the Genus database with same CATH topology
 2LJH A;  3IWC A;  2CSH A;  1N32 E;  1A1K A;  2B3T B;  3THN A;  2DMY A;  2EN6 A;  3EQ1 A;  2B7T A;  3MSW A;  1WXR A;  3HPZ A;  3M99 B;  1HR0 E;  5AE1 A;  3ZOQ B;  5LMU E;  4F9B B;  2EOJ A;  1UN6 B;  3JTZ A;  1QNT A;  2MDG A;  2LE2 A;  2WBT A;  4DV7 E;  5T6J A;  3BF2 A;  2EL4 A;  2LBS B;  2ENC A;  2EMW A;  4F54 A;  4NXN E;  1X6F A;  2VF1 A;  2EM0 A;  2ENA A;  2EWL A;  2EZ6 A;  3EPH A;  4R2D A;  2JYA A;  5A6B D;  2RSM A;  3JU0 A;  2EM9 A;  2N3G A;  5IV8 B;  2M9A A;  1X5W A;  1X6E A;  2EOQ A;  3MHS C;  1YYK A;  4DV0 E;  1NCS A;  2LMZ A;  2YTJ A;  4X64 E;  2NAB A;  1UBD C;  2F8B A;  1STU A;  3BGH A;  2EMG A;  1FKA E;  1J5E E;  1RMD A;  3L00 A;  3VYX A;  1A1J A;  2BB8 A;  2EPZ A;  4O43 A;  1EKZ A;  1G2D C;  2DRP A;  3MHH C;  3AUZ A;  5DNY A;  4F6M A;  5IT9 C;  5A69 A;  1LLM C;  3J80 C;  2RTX A;  2MC6 A;  2YRH A;  4WYQ B;  4DR5 E;  1I94 E;  1WHQ A;  2YZT A;  4DMI A;  2K7I A;  1XMO E;  2F4V E;  2I13 A;  2EMX A;  2DSY A;  2EMF A;  2YTN A;  4O5G A;  4ZYG A;  4DV3 E;  2GPI A;  2CT1 A;  2H36 X;  2M7Q A;  2EP3 A;  4GEQ B;  2EPO A;  2EN1 A;  3AV0 A;  2EMC A;  4MLQ A;  3HQ1 A;  2EM2 A;  4ZYE A;  3VYY A;  4M2Z A;  1UIL A;  2EM3 A;  2WBS A;  3KWR A;  4JI8 E;  1IBM E;  2NUE A;  2EOH A;  3OTO E;  2EOR A;  1Z1B A;  4RHB B;  4R2C A;  5KL5 A;  2UUC E;  2L3C A;  3THO B;  2DMI A;  1T4L B;  3IWD A;  4R2Q A;  4DV5 E;  2V86 A;  4ZYH A;  4J8Z A;  2CPN A;  4R8O A;  4L8N A;  4IS1 C;  3T1Y E;  2EOI A;  2V85 A;  2DGC A;  2L2M A;  4K0K E;  5A2Q C;  4B3S E;  2UXB E;  1PJS A;  2B9D A;  2GLI A;  3C4T A;  4R2S A;  1X49 A;  3DJW A;  2EOY A;  1GTK A;  2NUG A;  4X9J A;  2LUP B;  2YSO A;  5LL6 R;  2YSP A;  4JI0 E;  3C6K A;  1HNZ E;  4X8W A;  1DI2 A;  1GQE A;  2YU8 A;  4DR2 E;  1BBO A;  4KWY A;  1TF3 A;  2E5L E;  5F3W A;  1ZBT A;  4JI3 E;  4F9A B;  2EPA A;  2DLQ A;  1T4N A;  2EM5 A;  1RC7 A;  1XNR E;  2JOB A;  4BCA A;  2JVA A;  1FJG E;  4JI2 E;  2LO3 A;  4JI6 E;  4BC7 A;  1T39 A;  3LML A;  1GZ6 A;  2EPU A;  1RQ0 A;  2ADR A;  3QG5 C;  1DQ3 A;  2V87 A;  4M30 A;  2EM8 A;  1YPN A;  2WZO A;  2PRT A;  4Q35 B;  2EL5 A;  4WX9 A;  2Q8U A;  2EMA A;  1T4O A;  4O24 A;  1PJQ A;  4L5N C;  4DV4 E;  2YTG A;  4LF8 E;  1A1I A;  3JAM C;  5AC4 A;  4GKK E;  2HGH A;  4WPY A;  4JV5 E;  4BS9 A;  1TN9 A;  4R2P A;  4WSG A;  2EPM X;  4DR1 E;  1BB8 A;  2G7H A;  2EJ4 A;  5KL2 A;  1PDA A;  2EMK A;  1IBL E;  5IXM B;  1BBG A;  1A1F A;  1WRJ A;  2YU5 A;  5KL6 A;  3HPS A;  4WFT A;  4LU9 A;  2MKD A;  4JYA E;  1ZAA C;  2MDR A;  4X66 E;  2EML A;  1O0W A;  2DIX A;  2EE8 A;  4O4K A;  2JOX A;  2EMI A;  1JK2 A;  2ODR C;  4DV6 E;  2RQL A;  1J26 A;  2WCC 3;  2L92 A;  5BR8 E;  1ZBQ A;  2GHF A;  4I8O A;  1B69 A;  2EMY A;  4BHB A;  4TUI A;  2VE7 C;  1YYW A;  2ODR D;  2YTE A;  4R2R A;  4WXD A;  3ADG A;  1YSA C;  2YWQ A;  2YPN A;  2EQ1 A;  4P78 A;  4HTG A;  2K4V A;  2I9I A;  2YTD A;  4HEI A;  3P1X A;  2FV4 B;  2DLK A;  1IMU A;  1UHZ A;  1SR9 A;  2R1F A;  2WBU A;  2VQF E;  4LF5 E;  2EQ0 A;  2LV2 A;  4YY3 E;  4DR6 E;  2JWO A;  1N33 E;  2FTX B;  1YUI A;  2EL6 A;  4DV2 E;  2RS6 A;  3FIG A;  4M9V C;  2EOM A;  1PJT A;  3C4B A;  2EPR A;  4X62 E;  4LF6 E;  3VK6 A;  2IHR 1;  2EMB A;  4JI5 E;  1QU6 A;  5ADZ A;  2JPA A;  1IQO A;  2EN2 A;  2LTS A;  3ADI A;  1KYQ A;  2KHX A;  1AAY A;  2UXC E;  2L8T A;  2YT4 A;  2VRD A;  4WXC A;  2ELZ A;  3IWB A;  2YRK A;  5LMN E;  4LF4 E;  2RSI A;  2BBG A;  4BC9 A;  4DUY E;  2E1M A;  2LCE A;  4R2A A;  2EPL X;  4LFB E;  3HXL A;  2EPP A;  3BID A;  1WJP A;  4X65 E;  2LRS A;  4TUG A;  1YUJ A;  4WSP A;  5A6B A;  4DKK A;  2L3J A;  2EOX A;  4BMJ A;  5A6K A;  4BBY A;  2LT7 A;  1HNX E;  3EPK A;  4B3M E;  2V83 A;  3T1H E;  1X48 A;  2YTO A;  1MEY C;  4JI7 E;  4LF9 E;  2EN7 A;  3BBG A;  2M1S A;  4P7D A;  2EOZ A;  2EPX A;  4KHP E;  2VQE E;  4Q28 A;  3EPJ A;  2L6M A;  3C6M A;  3VHT B;  4LFC E;  1IBK E;  2JP9 A;  2EM6 A;  3KZY A;  5KL3 A;  1JK1 A;  3ADJ A;  4N4R B;  1YZ9 A;  5A6J A;  1WHN A;  2EOF A;  2YTI A;  2YTP A;  4JI4 E;  3F6G A;  1TF6 A;  4OX9 E;  1X47 A;  2YRM A;  2MC5 A;  1AH5 A;  4NZV A;  1P47 A;  2YTQ A;  2V88 A;  4NHR A;  2LUQ A;  2NUF A;  4JI1 E;  4AQY E;  2EOO A;  2HC5 A;  5A6A A;  2E72 A;  2N3H A;  3DF6 A;  2HHH E;  2EMH A;  3ADL A;  4R03 A;  2EN3 A;  1ZR9 A;  1A1G A;  4ZYD A;  2MKN A;  2EPN A;  4KZS A;  2JY9 A;  4LFA E;  4R2E A;  3J81 C;  3J7Y p;  2EM7 A;  2YTF A;  4B3R E;  4B3T E;  1KJK A;  1DGC A;  4IJD A;  2EN8 A;  1EH6 A;  4F2J C;  1HNW E;  1ZU1 A;  2EMZ A;  5CFF E;  2B7V A;  4F9C B;  1PKP A;  2RPC A;  4GKJ E;  3OML A;  4F6N A;  2EOE A;  5AC5 A;  1A1H A;  2EPK X;  3H09 A;  4NXM E;  2DB2 A;  4MLV A;  2UUB E;  2HJJ A;  2J7J A;  3HTX A;  4GZN C;  1YFH A;  2V89 A;  4DR3 E;  1MGT A;  1G2F C;  3EPL A;  1SFE A;  2NA2 A;  5AE2 A;  4DV1 E;  5AAS A;  4LF7 E;  1A1L A;  1XNQ E;  2N8X A;  5FLX C;  2UXD E;  1N36 E;  2M4I A;  2KON A;  1EH7 A;  2ZM6 E;  4BHC A;  2EN4 A;  3J7A G;  2CTD A;  2FGG A;  3UK3 C;  2JR1 A;  3RMP A;  2UUA E;  2RS7 A;  5KL4 A;  2EM4 A;  5KL7 A;  2L2K B;  1YYO A;  2EQ3 A;  1F2I G;  4LTY A;  2KOU A;  4M0V A;  2L33 A;  2ENH A;  1X6H A;  1N3G A;  3LLH A;  4YHH E;  2L2N A;  4DR4 E;  2LJU A;  2JXP A;  3ECR A;  3TQM A;  5TSE A;  4DUZ E;  1L4S A;  2EPC A;  5LLQ A;  2ELY A;  5AE3 A;  3F6H A;  2LTR A;  2UU9 E;  5IWA E;  2V8Q B;  4OOG C;  2D9H A;  1EH8 A;  1T38 A;  1N34 E;  4FK5 C;  1IQS A;  1XMQ E;  3KZZ A;  1NEI A;  2EOS A;  2LVH A;  2A25 A;  2R76 A;  3K6Q A;  1X3C A;  4RH8 A;  4DR7 E; 
#chains in the Genus database with same CATH homology
 2LJH A;  2N3H A;  3ADG A;  3DF6 A;  3IWC A;  2HHH E;  4P78 A;  4R03 A;  1T4L B;  3ADL A;  2K4V A;  3IWD A;  4DV5 E;  2V86 A;  2FV4 B;  3P1X A;  4J8Z A;  2CPN A;  1N32 E;  4KZS A;  2B3T B;  4R8O A;  2JY9 A;  4L8N A;  4LFA E;  3J81 C;  1UHZ A;  3J7Y p;  1SR9 A;  3T1Y E;  2V85 A;  2VQF E;  4B3T E;  4B3R E;  4LF5 E;  2DMY A;  2L2M A;  4DR7 E;  2B7T A;  4K0K E;  3MSW A;  5A2Q C;  4YY3 E;  1WXR A;  4B3S E;  2UXB E;  4DR6 E;  2JWO A;  2B9D A;  3HPZ A;  3C4T A;  1HR0 E;  5AE1 A;  2FTX B;  1X49 A;  1N33 E;  3DJW A;  3ZOQ B;  1HNW E;  4DV2 E;  2NUG A;  5CFF E;  2B7V A;  2RS6 A;  3FIG A;  2LUP B;  3C4B A;  5LMU E;  4F9C B;  1PKP A;  5LL6 R;  4F9B B;  4X62 E;  4LF6 E;  4GKJ E;  3VK6 A;  2IHR 1;  3OML A;  4JI0 E;  4JI5 E;  3JTZ A;  1QU6 A;  4X8W A;  5ADZ A;  1HNZ E;  1GQE A;  1DI2 A;  4DR2 E;  3H09 A;  2LE2 A;  4DV7 E;  4NXM E;  2DB2 A;  2UUB E;  5T6J A;  2E5L E;  2LBS B;  5F3W A;  2LTS A;  3ADI A;  1ZBT A;  4JI3 E;  4F9A B;  2KHX A;  2UXC E;  2L8T A;  2YT4 A;  1T4N A;  1RC7 A;  1XNR E;  2JOB A;  4F54 A;  4BCA A;  3HTX A;  2JVA A;  4NXN E;  2V89 A;  2VF1 A;  3IWB A;  5LMN E;  4DR3 E;  4LF4 E;  1FJG E;  4JI2 E;  2EWL A;  4BC7 A;  4BC9 A;  4DUY E;  4JI6 E;  3LML A;  2NA2 A;  1GZ6 A;  2EZ6 A;  5AE2 A;  2E1M A;  4DV1 E;  1RQ0 A;  5AAS A;  4LF7 E;  2RSM A;  1XNQ E;  3JU0 A;  4M30 A;  1DQ3 A;  2V87 A;  2N3G A;  5FLX C;  4LFB E;  2WZO A;  2UXD E;  1N36 E;  2M4I A;  2KON A;  2ZM6 E;  3HXL A;  1YYK A;  1T4O A;  3J7A G;  4DV0 E;  2FGG A;  4X65 E;  2LMZ A;  2LRS A;  4TUG A;  4WSP A;  4L5N C;  4DV4 E;  4X64 E;  4DKK A;  2F8B A;  2L3J A;  2JR1 A;  1STU A;  3RMP A;  4LF8 E;  4BMJ A;  1FKA E;  1J5E E;  2UUA E;  2RS7 A;  3JAM C;  4GKK E;  4BBY A;  1HNX E;  4B3M E;  3VYX A;  2L2K B;  2V83 A;  4WPY A;  4JV5 E;  1YYO A;  1EKZ A;  4BS9 A;  1X48 A;  3T1H E;  3AUZ A;  4LTY A;  2KOU A;  4M0V A;  4JI7 E;  4LF9 E;  2L33 A;  5DNY A;  4DR1 E;  5IT9 C;  3J80 C;  2RTX A;  2MC6 A;  2M1S A;  4WYQ B;  4DR5 E;  3LLH A;  1I94 E;  2G7H A;  4P7D A;  1WHQ A;  4YHH E;  1IBL E;  2YZT A;  4DMI A;  2L2N A;  1XMO E;  4DR4 E;  2VQE E;  4KHP E;  4Q28 A;  2L6M A;  2F4V E;  3HPS A;  2DSY A;  4DUZ E;  4DV3 E;  4WFT A;  4LU9 A;  4LFC E;  1IBK E;  4JYA E;  2H36 X;  3ADJ A;  2MDR A;  2M7Q A;  4X66 E;  1YZ9 A;  1WHN A;  4GEQ B;  1O0W A;  3AV0 A;  2DIX A;  5AE3 A;  4JI4 E;  3F6H A;  2LTR A;  2UU9 E;  3F6G A;  2UUC E;  3HQ1 A;  2JOX A;  3VYY A;  5IWA E;  1UIL A;  4M2Z A;  4OX9 E;  2ODR C;  1X47 A;  2V8Q B;  4OOG C;  4DV6 E;  2MC5 A;  3KWR A;  4JI8 E;  1IBM E;  1J26 A;  2L92 A;  5BR8 E;  2V88 A;  2NUE A;  1ZBQ A;  2LUQ A;  1N34 E;  2NUF A;  4JI1 E;  4I8O A;  1XMQ E;  3OTO E;  4AQY E;  4TUI A;  2VE7 C;  1YYW A;  2ODR D;  3K6Q A;  2L3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...