2JOBA

Solution structure of an antilipopolysaccharide factor from shrimp and its possible lipid a binding site
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
102
structure length
102
Chain Sequence
EAYVQGWEAVAAAVASKIVGLWRNEKTELLGHECKFTVKPYLKRFQVYYKGRMWCPGWTAIRGEASTRSQSGVAGKTAKDFVRKAFQKGLISQQEANQWLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of rALF-Pm3, an anti-lipopolysaccharide factor from shrimp: Model of the possible lipid A-binding site
pubmed doi rcsb
source organism Penaeus monodon
molecule tags Lipid binding protein
molecule keywords antilipopolysaccharide factor
total genus 24
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11630 DUF3254 Protein of unknown function (DUF3254)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.320 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jobA00
2JOBA
chains in the Genus database with same CATH superfamily
4DR2E 5LMNE 1PKPA 2E1MA 4WSPA 2EOHA 3AUZA 1EH7A 1HNXE 1J5EE 2V86A 2EMZA 2UUBE 1JK1A 4LF8E 2EN4A 1PDAA 4ZYEA 4F2JC 1T38A 3MHSC 3EPLA 2EOXA 4DR4E 2EM7A 3JAMC 2EN3A 4X9JA 4M9VC 2EMKA 3VYYA 1ZU1A 4WSGA 1YZ9A 4I8OA 2L33A 4BC9A 4KHPE 5KL7A 2EN1A 2PRTA 2N3GA 4ZYHA 1QNTA 2EOOA 4O4KA 2NUEA 1YUJA 2M4IA 2JP9A 2EPKX 2EOMA 3JTZA 2UU9E 2EM0A 2LUPB 4BC7A 2G7HA 3KZZA 1Z1BA 2YTEA 2DMYA 4DR5E 2YRHA 2EMAA 4BHBA 3ECRA 1KJKA 4R2RA 1T39A 2V8QB 1KYQA 5AC5A 1XNRE 2EOFA 4R2AA 2YRKA 4B3ME 4JI8E 2B7TA 1TF6A 2KHXA 4F9BB 1A1GA 1UN6B 4JI7E 2CTDA 2EMHA 2DGCA 2L92A 2YZTA 2GHFA 2YTJA 4LFAE 2R1FA 1IMUA 2LCEA 2DIXA 1BBOA 4O5GA 4DV2E 2LUQA 3TQMA 2EN2A 3KZYA 4K0KE 4FK5C 2EM2A 3L00A 2YTPA 3ZOQB 2EM9A 2HHHE 1X48A 4M30A 5KL4A 2EN7A 4TUGA 1PJSA 2J7JA 2V83A 3M99B 2EP3A 1YFHA 1ZR9A 2MDRA 2M1SA 2FTXB 2B7VA 4KWYA 2B3TB 2YTIA 2I9IA 4NHRA 4MLQA 1TN9A 1XNQE 3DF6A 4BCAA 2YTOA 4R03A 2A25A 4DV7E 4WFTA 2EMIA 2EPXA 4KZSA 3VK6A 4DV6E 2EOJA 2EJ4A 1HR0E 1GZ6A 3BIDA 3UK3C 1UBDC 3IWCA 3BGHA 4DV3E 2HJJA 2YT4A 5A6AA 1LLMC 4Q28A 1X6FA 2EL5A 3HTXA 1X6EA 1P47A 2CSHA 1GTKA 1EKZA 2MKDA 2E5LE 3KWRA 2EMGA 2EPOA 2K7IA 1YYKA 1A1KA 2EOZA 2CT1A 5DNYA 4BS9A 2RQLA 5AASA 4F6NA 2YWQA 4JI2E 2VQEE 3LMLA 3HXLA 2EOYA 2WBUA 1RMDA 2RSIA 2E72A 2GLIA 5F3WA 1T4OA 4AQYE 1RC7A 2EL4A 2ELYA 4JI6E 1F2IG 3MHHC 2LJUA 5AE1A 4X65E 2EPZA 2UXBE 2EPNA 4DV4E 3THOB 2N3HA 2YTDA 3F6HA 1XMQE 2EWLA 1N3GA 1STUA 4DR7E 1A1FA 1FKAE 5AE3A 2DLQA 3VHTB 1AAYA 3EPKA 2CPNA 4DKKA 2HGHA 1XMOE 2YTFA 4LF7E 4B3TE 1WHNA 1WXRA 1HNZE 1RQ0A 5KL5A 2HC5A 1X6HA 4OOGC 1ZAAC 5IV8B 5A2QC 1AH5A 2EPMX 2JXPA 4GZNC 3IWBA 1A1HA 4JI0E 5A6BA 4WPYA 2V88A 4F6MA 1O0WA 2JYAA 2EQ0A 3BBGA 4DR1E 3OTOE 3C6MA 4LF9E 4DV5E 4X66E 2YSPA 2BBGA 2LTRA 3J80C 2LMZA 2EMXA 4DR3E 4B3RE 4L5NC 2LT7A 2LV2A 2L8TA 2JR1A 3FIGA 2EN6A 5A6BD 1DQ3A 2ODRD 2VE7C 2F4VE 2EM8A 2LVHA 3IWDA 1WHQA 2RTXA 5ADZA 2JOXA 2YPNA 1A1LA 3THNA 4F9CB 2Q8UA 3C4BA 2ENHA 5IT9C 3AV0A 3ADJA 4WYQB 2I13A 1DGCA 3HPSA 3T1HE 5BR8E 3ADGA 1G2FC 2ENAA 3C6KA 4IS1C 4HTGA 3EPHA 1UILA 2UUAE 2EQ1A 2EMWA 4TUIA 1IBKE 2EN8A 5T6JA 2IHR1 5AC4A 1JK2A 3JU0A 1X3CA 4F54A 5KL2A 5AE2A 2YTQA 2KONA 1T4LB 4RHBB 1PJTA 2EQ3A 2EPLX 2JOBA 4GEQB 2RS6A 2RSMA 4DR6E 2YU5A 4GKJE 4LFBE 2V87A 1N32E 1N36E 4BHCA 4R2DA 2L3CA 2LBSB 2EMBA 2EORA 1EH6A 4J8ZA 1IBLE 2DB2A 3J7Yp 1YSAC 1I94E 2EOSA 1EH8A 1YPNA 2DLKA 1MGTA 1WRJA 5TSEA 4NXNE 4LF5E 4JV5E 3J81C 1IQSA 1QU6A 2MDGA 2RPCA 5A6JA 2JWOA 2EM5A 2DSYA 3HQ1A 4LF4E 2MC6A 4MLVA 4NZVA 2EM4A 2EPRA 4JI3E 4DMIA 3T1YE 4JI4E 4DV1E 2EOIA 4YY3E 5FLXC 2MC5A 2EOQA 1J26A 3EQ1A 4P78A 1BB8A 1SFEA 4O43A 2LJHA 4M2ZA 2RS7A 2EM3A 2NUFA 1T4NA 1NEIA 3F6GA 4JYAE 3DJWA 1YYOA 3P1XA 4NXME 4WXCA 4LTYA 1ZBQA 4R2CA 2EPUA 3VYXA 2FV4B 4L8NA 4DV0E 4ZYGA 3BF2A 1GQEA 5KL3A 2L2MA 2FGGA 2K4VA 2VRDA 2YU8A 2EMFA 2JVAA 1YYWA 1A1JA 2JPAA 4ZYDA 2LTSA 2F8BA 4JI1E 1N34E 4DUYE 2D9HA 4R2PA 3RMPA 4F9AB 4Q35B 2YRMA 5LMUE 2MKNA 3ADLA 1WJPA 4X8WA 3J7AG 2N8XA 4RH8A 2EPPA 2VF1A 3QG5C 4X64E 3MSWA 2EPCA 1YUIA 5A69A 4R2EA 2VQFE 1TF3A 2EMCA 4IJDA 4JI5E 2LO3A 1IQOA 2NABA 1G2DC 2DRPA 5IWAE 1PJQA 2WCC3 2V85A 4YHHE 2KOUA 2ELZA 1A1IA 4R2SA 1NCSA 1X47A 2R76A 4HEIA 2YSOA 2L2NA 2L6MA 5CFFE 2YTGA 2V89A 1ZBTA 2EZ6A 2WBTA 2ZM6E 4R8OA 4BMJA 2EE8A 2DMIA 2M9AA 2EOEA 5LL6R 2NA2A 2L2KB 2LRSA 2WBSA 4WXDA 2L3JA 1X5WA 2GPIA 2EL6A 1UHZA 2H36X 5IXMB 3OMLA 1IBME 4LF6E 2B9DA 4B3SE 2WZOA 2LE2A 4R2QA 5LLQA 1N33E 4LFCE 2BB8A 3LLHA 4LU9A 4GKKE 2UXDE 5A6KA 1X49A 4WX9A 1DI2A 4M0VA 2YTNA 5KL6A 2EM6A 4DUZE 1MEYC 1BBGA 2ODRC 1FJGE 2ENCA 2NUGA 1SR9A 3K6QA 3EPJA 3H09A 2M7QA 4X62E 2UXCE 2EPAA 3C4TA 2JY9A 2UUCE 2EMYA 4OX9E 4N4RB 4O24A 1HNWE 4P7DA 3HPZA 1B69A 2EMLA 2ADRA 4BBYA 1L4SA 3ADIA
chains in the Genus database with same CATH topology
2L2MA 2FGGA 5LMNE 4WFTA 4F9CB 4DV7E 4KZSA 1PKPA 4DR2E 2E1MA 4WSPA 3C4BA 3VK6A 2K4VA 4DV6E 2JVAA 3AUZA 1HNXE 1YYWA 5IT9C 3AV0A 1HR0E 1J5EE 1GZ6A 3ADJA 4WYQB 2V86A 3HPSA 3T1HE 3IWCA 3ADGA 5BR8E 4DV3E 2YT4A 2LTSA 4Q28A 2UUBE 2F8BA 4JI1E 4LF8E 1N34E 4DUYE 3HTXA 4DR4E 1UILA 1EKZA 2E5LE 3KWRA 3RMPA 4F9AB 3JAMC 2UUAE 4TUIA 1IBKE 5LMUE 3VYYA 1YYKA 3ADLA 1YZ9A 5DNYA 4I8OA 2L33A 4X8WA 4BC9A 5T6JA 4BS9A 2IHR1 2N3GA 3J7AG 4KHPE 3JU0A 5AASA 4F54A 4JI2E 2VF1A 2VQEE 4X64E 2NUEA 2M4IA 3LMLA 3HXLA 5AE2A 3MSWA 3JTZA 2UU9E 2KONA 2LUPB 1T4LB 4BC7A 2G7HA 2VQFE 5F3WA 1T4OA 4AQYE 1RC7A 2DMYA 2JOBA 4GEQB 2RS6A 2RSMA 5AE1A 4X65E 4DR5E 4JI5E 2V87A 5IWAE 1N32E 4DR6E 4GKJE 4LFBE 2UXBE 1N36E 4DV4E 2V85A 2N3HA 3F6HA 4YHHE 2V8QB 2L3CA 2EWLA 1STUA 2KOUA 1XMQE 2LBSB 1XNRE 4DR7E 1FKAE 5AE3A 4J8ZA 1IBLE 2DB2A 1X47A 4JI8E 3J7Yp 2B7TA 4B3ME 1I94E 2L2NA 2L6MA 2KHXA 5CFFE 2CPNA 4DKKA 4F9BB 4JI7E 2V89A 1ZBTA 1XMOE 2EZ6A 2ZM6E 4R8OA 4BMJA 4NXNE 4LF5E 4LF7E 4B3TE 1WHNA 4JV5E 3J81C 1WXRA 1HNZE 1QU6A 1RQ0A 2L92A 2YZTA 5LL6R 2JWOA 4OOGC 2NA2A 2L2KB 2LRSA 2DSYA 3HQ1A 4LF4E 4LFAE 5A2QC 2L3JA 2MC6A 2DIXA 4DV2E 3IWBA 2LUQA 4JI0E 1HNWE 4WPYA 4JI3E 1UHZA 2H36X 4DMIA 3OMLA 3T1YE 2V88A 1IBME 4JI4E 4LF6E 4K0KE 4DV1E 1O0WA 2B9DA 4B3SE 2WZOA 4DR1E 4YY3E 2LE2A 5FLXC 3OTOE 1N33E 3ZOQB 4LFCE 2HHHE 1X48A 3LLHA 4LU9A 2MC5A 4LF9E 4M30A 4DV5E 4X66E 4JI6E 4P78A 4GKKE 2UXDE 2LTRA 1J26A 1X49A 1DI2A 4M0VA 3J80C 4TUGA 2LMZA 4DR3E 2LJHA 4B3RE 4DUZE 2V83A 2ODRC 4L5NC 1FJGE 2L8TA 2NUGA 4M2ZA 1SR9A 2MDRA 2RS7A 2JR1A 2M1SA 3K6QA 1T4NA 2NUFA 3FIGA 3H09A 1DQ3A 2FTXB 2ODRD 2VE7C 3F6GA 2M7QA 4X62E 2F4VE 2B7VA 2UXCE 4JYAE 3DJWA 1YYOA 3P1XA 3C4TA 4NXME 2JY9A 2B3TB 2UUCE 4OX9E 3IWDA 4LTYA 1ZBQA 1WHQA 2RTXA 3VYXA 4P7DA 3DF6A 2JOXA 3HPZA 4BCAA 2FV4B 5ADZA 1XNQE 4L8NA 4R03A 4BBYA 4DV0E 3ADIA 1GQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOB A; 
#chains in the Genus database with same CATH topology
 4DR2 E;  5LMN E;  1PKP A;  2E1M A;  4WSP A;  2EOH A;  3AUZ A;  1EH7 A;  1HNX E;  1J5E E;  2V86 A;  2EMZ A;  2UUB E;  1JK1 A;  4LF8 E;  2EN4 A;  1PDA A;  4ZYE A;  4F2J C;  1T38 A;  3MHS C;  3EPL A;  2EOX A;  4DR4 E;  2EM7 A;  3JAM C;  2EN3 A;  4X9J A;  4M9V C;  2EMK A;  3VYY A;  1ZU1 A;  4WSG A;  1YZ9 A;  4I8O A;  2L33 A;  4BC9 A;  4KHP E;  5KL7 A;  2EN1 A;  2PRT A;  2N3G A;  4ZYH A;  1QNT A;  2EOO A;  4O4K A;  2NUE A;  1YUJ A;  2M4I A;  2JP9 A;  2EPK X;  2EOM A;  3JTZ A;  2UU9 E;  2EM0 A;  2LUP B;  4BC7 A;  2G7H A;  3KZZ A;  1Z1B A;  2YTE A;  2DMY A;  4DR5 E;  2YRH A;  2EMA A;  4BHB A;  3ECR A;  1KJK A;  4R2R A;  1T39 A;  2V8Q B;  1KYQ A;  5AC5 A;  1XNR E;  2EOF A;  4R2A A;  2YRK A;  4B3M E;  4JI8 E;  2B7T A;  1TF6 A;  2KHX A;  4F9B B;  1A1G A;  1UN6 B;  4JI7 E;  2CTD A;  2EMH A;  2DGC A;  2L92 A;  2YZT A;  2GHF A;  2YTJ A;  4LFA E;  2R1F A;  1IMU A;  2LCE A;  2DIX A;  1BBO A;  4O5G A;  4DV2 E;  2LUQ A;  3TQM A;  2EN2 A;  3KZY A;  4K0K E;  4FK5 C;  2EM2 A;  3L00 A;  2YTP A;  3ZOQ B;  2EM9 A;  2HHH E;  1X48 A;  4M30 A;  5KL4 A;  2EN7 A;  4TUG A;  1PJS A;  2J7J A;  2V83 A;  3M99 B;  2EP3 A;  1YFH A;  1ZR9 A;  2MDR A;  2M1S A;  2FTX B;  2B7V A;  4KWY A;  2B3T B;  2YTI A;  2I9I A;  4NHR A;  4MLQ A;  1TN9 A;  1XNQ E;  3DF6 A;  4BCA A;  2YTO A;  4R03 A;  2A25 A;  4DV7 E;  4WFT A;  2EMI A;  2EPX A;  4KZS A;  3VK6 A;  4DV6 E;  2EOJ A;  2EJ4 A;  1HR0 E;  1GZ6 A;  3BID A;  3UK3 C;  1UBD C;  3IWC A;  3BGH A;  4DV3 E;  2HJJ A;  2YT4 A;  5A6A A;  1LLM C;  4Q28 A;  1X6F A;  2EL5 A;  3HTX A;  1X6E A;  1P47 A;  2CSH A;  1GTK A;  1EKZ A;  2MKD A;  2E5L E;  3KWR A;  2EMG A;  2EPO A;  2K7I A;  1YYK A;  1A1K A;  2EOZ A;  2CT1 A;  5DNY A;  4BS9 A;  2RQL A;  5AAS A;  4F6N A;  2YWQ A;  4JI2 E;  2VQE E;  3LML A;  3HXL A;  2EOY A;  2WBU A;  1RMD A;  2RSI A;  2E72 A;  2GLI A;  5F3W A;  1T4O A;  4AQY E;  1RC7 A;  2EL4 A;  2ELY A;  4JI6 E;  1F2I G;  3MHH C;  2LJU A;  5AE1 A;  4X65 E;  2EPZ A;  2UXB E;  2EPN A;  4DV4 E;  3THO B;  2N3H A;  2YTD A;  3F6H A;  1XMQ E;  2EWL A;  1N3G A;  1STU A;  4DR7 E;  1A1F A;  1FKA E;  5AE3 A;  2DLQ A;  3VHT B;  1AAY A;  3EPK A;  2CPN A;  4DKK A;  2HGH A;  1XMO E;  2YTF A;  4LF7 E;  4B3T E;  1WHN A;  1WXR A;  1HNZ E;  1RQ0 A;  5KL5 A;  2HC5 A;  1X6H A;  4OOG C;  1ZAA C;  5IV8 B;  5A2Q C;  1AH5 A;  2EPM X;  2JXP A;  4GZN C;  3IWB A;  1A1H A;  4JI0 E;  5A6B A;  4WPY A;  2V88 A;  4F6M A;  1O0W A;  2JYA A;  2EQ0 A;  3BBG A;  4DR1 E;  3OTO E;  3C6M A;  4LF9 E;  4DV5 E;  4X66 E;  2YSP A;  2BBG A;  2LTR A;  3J80 C;  2LMZ A;  2EMX A;  4DR3 E;  4B3R E;  4L5N C;  2LT7 A;  2LV2 A;  2L8T A;  2JR1 A;  3FIG A;  2EN6 A;  5A6B D;  1DQ3 A;  2ODR D;  2VE7 C;  2F4V E;  2EM8 A;  2LVH A;  3IWD A;  1WHQ A;  2RTX A;  5ADZ A;  2JOX A;  2YPN A;  1A1L A;  3THN A;  4F9C B;  2Q8U A;  3C4B A;  2ENH A;  5IT9 C;  3AV0 A;  3ADJ A;  4WYQ B;  2I13 A;  1DGC A;  3HPS A;  3T1H E;  5BR8 E;  3ADG A;  1G2F C;  2ENA A;  3C6K A;  4IS1 C;  4HTG A;  3EPH A;  1UIL A;  2UUA E;  2EQ1 A;  2EMW A;  4TUI A;  1IBK E;  2EN8 A;  5T6J A;  2IHR 1;  5AC4 A;  1JK2 A;  3JU0 A;  1X3C A;  4F54 A;  5KL2 A;  5AE2 A;  2YTQ A;  2KON A;  1T4L B;  4RHB B;  1PJT A;  2EQ3 A;  2EPL X;  2JOB A;  4GEQ B;  2RS6 A;  2RSM A;  4DR6 E;  2YU5 A;  4GKJ E;  4LFB E;  2V87 A;  1N32 E;  1N36 E;  4BHC A;  4R2D A;  2L3C A;  2LBS B;  2EMB A;  2EOR A;  1EH6 A;  4J8Z A;  1IBL E;  2DB2 A;  3J7Y p;  1YSA C;  1I94 E;  2EOS A;  1EH8 A;  1YPN A;  2DLK A;  1MGT A;  1WRJ A;  5TSE A;  4NXN E;  4LF5 E;  4JV5 E;  3J81 C;  1IQS A;  1QU6 A;  2MDG A;  2RPC A;  5A6J A;  2JWO A;  2EM5 A;  2DSY A;  3HQ1 A;  4LF4 E;  2MC6 A;  4MLV A;  4NZV A;  2EM4 A;  2EPR A;  4JI3 E;  4DMI A;  3T1Y E;  4JI4 E;  4DV1 E;  2EOI A;  4YY3 E;  5FLX C;  2MC5 A;  2EOQ A;  1J26 A;  3EQ1 A;  4P78 A;  1BB8 A;  1SFE A;  4O43 A;  2LJH A;  4M2Z A;  2RS7 A;  2EM3 A;  2NUF A;  1T4N A;  1NEI A;  3F6G A;  4JYA E;  3DJW A;  1YYO A;  3P1X A;  4NXM E;  4WXC A;  4LTY A;  1ZBQ A;  4R2C A;  2EPU A;  3VYX A;  2FV4 B;  4L8N A;  4DV0 E;  4ZYG A;  3BF2 A;  1GQE A;  5KL3 A;  2L2M A;  2FGG A;  2K4V A;  2VRD A;  2YU8 A;  2EMF A;  2JVA A;  1YYW A;  1A1J A;  2JPA A;  4ZYD A;  2LTS A;  2F8B A;  4JI1 E;  1N34 E;  4DUY E;  2D9H A;  4R2P A;  3RMP A;  4F9A B;  4Q35 B;  2YRM A;  5LMU E;  2MKN A;  3ADL A;  1WJP A;  4X8W A;  3J7A G;  2N8X A;  4RH8 A;  2EPP A;  2VF1 A;  3QG5 C;  4X64 E;  3MSW A;  2EPC A;  1YUI A;  5A69 A;  4R2E A;  2VQF E;  1TF3 A;  2EMC A;  4IJD A;  4JI5 E;  2LO3 A;  1IQO A;  2NAB A;  1G2D C;  2DRP A;  5IWA E;  1PJQ A;  2WCC 3;  2V85 A;  4YHH E;  2KOU A;  2ELZ A;  1A1I A;  4R2S A;  1NCS A;  1X47 A;  2R76 A;  4HEI A;  2YSO A;  2L2N A;  2L6M A;  5CFF E;  2YTG A;  2V89 A;  1ZBT A;  2EZ6 A;  2WBT A;  2ZM6 E;  4R8O A;  4BMJ A;  2EE8 A;  2DMI A;  2M9A A;  2EOE A;  5LL6 R;  2NA2 A;  2L2K B;  2LRS A;  2WBS A;  4WXD A;  2L3J A;  1X5W A;  2GPI A;  2EL6 A;  1UHZ A;  2H36 X;  5IXM B;  3OML A;  1IBM E;  4LF6 E;  2B9D A;  4B3S E;  2WZO A;  2LE2 A;  4R2Q A;  5LLQ A;  1N33 E;  4LFC E;  2BB8 A;  3LLH A;  4LU9 A;  4GKK E;  2UXD E;  5A6K A;  1X49 A;  4WX9 A;  1DI2 A;  4M0V A;  2YTN A;  5KL6 A;  2EM6 A;  4DUZ E;  1MEY C;  1BBG A;  2ODR C;  1FJG E;  2ENC A;  2NUG A;  1SR9 A;  3K6Q A;  3EPJ A;  3H09 A;  2M7Q A;  4X62 E;  2UXC E;  2EPA A;  3C4T A;  2JY9 A;  2UUC E;  2EMY A;  4OX9 E;  4N4R B;  4O24 A;  1HNW E;  4P7D A;  3HPZ A;  1B69 A;  2EML A;  2ADR A;  4BBY A;  1L4S A;  3ADI A; 
#chains in the Genus database with same CATH homology
 2L2M A;  2FGG A;  5LMN E;  4WFT A;  4F9C B;  4DV7 E;  4KZS A;  1PKP A;  4DR2 E;  2E1M A;  4WSP A;  3C4B A;  3VK6 A;  2K4V A;  4DV6 E;  2JVA A;  3AUZ A;  1HNX E;  1YYW A;  5IT9 C;  3AV0 A;  1HR0 E;  1J5E E;  1GZ6 A;  3ADJ A;  4WYQ B;  2V86 A;  3HPS A;  3T1H E;  3IWC A;  3ADG A;  5BR8 E;  4DV3 E;  2YT4 A;  2LTS A;  4Q28 A;  2UUB E;  2F8B A;  4JI1 E;  4LF8 E;  1N34 E;  4DUY E;  3HTX A;  4DR4 E;  1UIL A;  1EKZ A;  2E5L E;  3KWR A;  3RMP A;  4F9A B;  3JAM C;  2UUA E;  4TUI A;  1IBK E;  5LMU E;  3VYY A;  1YYK A;  3ADL A;  1YZ9 A;  5DNY A;  4I8O A;  2L33 A;  4X8W A;  4BC9 A;  5T6J A;  4BS9 A;  2IHR 1;  2N3G A;  3J7A G;  4KHP E;  3JU0 A;  5AAS A;  4F54 A;  4JI2 E;  2VF1 A;  2VQE E;  4X64 E;  2NUE A;  2M4I A;  3LML A;  3HXL A;  5AE2 A;  3MSW A;  3JTZ A;  2UU9 E;  2KON A;  2LUP B;  1T4L B;  4BC7 A;  2G7H A;  2VQF E;  5F3W A;  1T4O A;  4AQY E;  1RC7 A;  2DMY A;  2JOB A;  4GEQ B;  2RS6 A;  2RSM A;  5AE1 A;  4X65 E;  4DR5 E;  4JI5 E;  2V87 A;  5IWA E;  1N32 E;  4DR6 E;  4GKJ E;  4LFB E;  2UXB E;  1N36 E;  4DV4 E;  2V85 A;  2N3H A;  3F6H A;  4YHH E;  2V8Q B;  2L3C A;  2EWL A;  1STU A;  2KOU A;  1XMQ E;  2LBS B;  1XNR E;  4DR7 E;  1FKA E;  5AE3 A;  4J8Z A;  1IBL E;  2DB2 A;  1X47 A;  4JI8 E;  3J7Y p;  2B7T A;  4B3M E;  1I94 E;  2L2N A;  2L6M A;  2KHX A;  5CFF E;  2CPN A;  4DKK A;  4F9B B;  4JI7 E;  2V89 A;  1ZBT A;  1XMO E;  2EZ6 A;  2ZM6 E;  4R8O A;  4BMJ A;  4NXN E;  4LF5 E;  4LF7 E;  4B3T E;  1WHN A;  4JV5 E;  3J81 C;  1WXR A;  1HNZ E;  1QU6 A;  1RQ0 A;  2L92 A;  2YZT A;  5LL6 R;  2JWO A;  4OOG C;  2NA2 A;  2L2K B;  2LRS A;  2DSY A;  3HQ1 A;  4LF4 E;  4LFA E;  5A2Q C;  2L3J A;  2MC6 A;  2DIX A;  4DV2 E;  3IWB A;  2LUQ A;  4JI0 E;  1HNW E;  4WPY A;  4JI3 E;  1UHZ A;  2H36 X;  4DMI A;  3OML A;  3T1Y E;  2V88 A;  1IBM E;  4JI4 E;  4LF6 E;  4K0K E;  4DV1 E;  1O0W A;  2B9D A;  4B3S E;  2WZO A;  4DR1 E;  4YY3 E;  2LE2 A;  5FLX C;  3OTO E;  1N33 E;  3ZOQ B;  4LFC E;  2HHH E;  1X48 A;  3LLH A;  4LU9 A;  2MC5 A;  4LF9 E;  4M30 A;  4DV5 E;  4X66 E;  4JI6 E;  4P78 A;  4GKK E;  2UXD E;  2LTR A;  1J26 A;  1X49 A;  1DI2 A;  4M0V A;  3J80 C;  4TUG A;  2LMZ A;  4DR3 E;  2LJH A;  4B3R E;  4DUZ E;  2V83 A;  2ODR C;  4L5N C;  1FJG E;  2L8T A;  2NUG A;  4M2Z A;  1SR9 A;  2MDR A;  2RS7 A;  2JR1 A;  2M1S A;  3K6Q A;  1T4N A;  2NUF A;  3FIG A;  3H09 A;  1DQ3 A;  2FTX B;  2ODR D;  2VE7 C;  3F6G A;  2M7Q A;  4X62 E;  2F4V E;  2B7V A;  2UXC E;  4JYA E;  3DJW A;  1YYO A;  3P1X A;  3C4T A;  4NXM E;  2JY9 A;  2B3T B;  2UUC E;  4OX9 E;  3IWD A;  4LTY A;  1ZBQ A;  1WHQ A;  2RTX A;  3VYX A;  4P7D A;  3DF6 A;  2JOX A;  3HPZ A;  4BCA A;  2FV4 B;  5ADZ A;  1XNQ E;  4L8N A;  4R03 A;  4BBY A;  4DV0 E;  3ADI A;  1GQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...