2JOBA

Solution structure of an antilipopolysaccharide factor from shrimp and its possible lipid a binding site
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
102
structure length
102
Chain Sequence
EAYVQGWEAVAAAVASKIVGLWRNEKTELLGHECKFTVKPYLKRFQVYYKGRMWCPGWTAIRGEASTRSQSGVAGKTAKDFVRKAFQKGLISQQEANQWLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords antilipopolysaccharide factor
publication title NMR structure of rALF-Pm3, an anti-lipopolysaccharide factor from shrimp: Model of the possible lipid A-binding site
pubmed doi rcsb
source organism Penaeus monodon
total genus 24
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11630 DUF3254 Protein of unknown function (DUF3254)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.320 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jobA00
2JOBA
chains in the Genus database with same CATH superfamily
1XNQE 1PDAA 2EOIA 4WFTA 4JI8E 3F6HA 3P1XA 2EPRA 1TF3A 2NUFA 4IJDA 1TN9A 4J8ZA 2YTEA 1NCSA 4K0KE 4M2ZA 2EPUA 5CFFE 3IWDA 1J26A 3VYYA 2EMGA 2LV2A 2UXDE 1X6EA 4JI6E 2B9DA 2B7VA 2K4VA 4GKKE 2YWQA 2PRTA 4LTYA 1HNWE 4F6MA 1UHZA 4DV5E 4WX9A 4F2JC 2V88A 2EOHA 4Q35B 2EORA 3OTOE 2UUCE 2N3HA 4LU9A 2EMZA 4DR1E 1A1KA 2G7HA 3EQ1A 3ADLA 2EOEA 2V87A 2V86A 5IWAE 3EPKA 2L2KB 1YYWA 1YZ9A 1X49A 2DIXA 4TUIA 3KZYA 2EM4A 2ENHA 4R8OA 5A6AA 2WCC3 2JWOA 2RSMA 4F54A 2FV4B 4F9BB 4DR6E 2F8BA 2E5LE 4BS9A 3HPSA 2L3CA 2LJHA 3KZZA 1XMOE 2EM2A 4DV2E 4RH8A 3KWRA 4JV5E 1G2FC 2YTIA 4I8OA 2CTDA 4WXCA 2D9HA 2JOBA 2VQFE 3JTZA 2L92A 1QU6A 4R2RA 1HR0E 2HHHE 2LJUA 2B3TB 3J81C 5IV8B 2EPPA 2JXPA 2EMYA 2GLIA 1X3CA 5TSEA 1YYOA 2L2MA 2YTOA 1N34E 1X5WA 3MSWA 5LMNE 2JYAA 2EN6A 1WJPA 1EH7A 2L8TA 1FKAE 1MEYC 5A2QC 4DR5E 2IHR1 4L5NC 1T4LB 1ZAAC 2EMXA 3RMPA 4KHPE 4ZYEA 4BHCA 2KOUA 4B3ME 2N3GA 2YRHA 4P7DA 2LUPB 1XNRE 1EH8A 4R2CA 4R2DA 2YRMA 2M4IA 2EM8A 2EOXA 1N32E 1I94E 4X9JA 1IBKE 4MLVA 4WSGA 5T6JA 1QNTA 4LF6E 4JI2E 1KJKA 4R2PA 2LTSA 5KL3A 1T39A 3HQ1A 4OX9E 1X6FA 3DJWA 1O0WA 4FK5C 1IQSA 2FGGA 1IQOA 2EL4A 2ZM6E 1IMUA 2HJJA 2ELZA 3L00A 1DI2A 2UXBE 1PKPA 5F3WA 2YTFA 1RC7A 5A6BA 5KL5A 5FLXC 4DUYE 3IWCA 5BR8E 4BCAA 1RMDA 2A25A 4JI0E 2GPIA 2E1MA 2RTXA 2LE2A 1B69A 2WZOA 5LL6R 4F6NA 4DR7E 4O24A 4ZYHA 1F2IG 4X8WA 4LFCE 2EN8A 2LMZA 4O5GA 5AC5A 5KL6A 3C6KA 2RPCA 2RSIA 4ZYGA 5KL7A 2NA2A 5A69A 2MC6A 5AE3A 2EN4A 1XMQE 1SR9A 4ZYDA 4DR2E 4WYQB 2BBGA 5LLQA 2DSYA 2EM7A 2EPMX 4IS1C 4JI7E 2VE7C 3MHHC 5A6BD 2EE8A 1T38A 2LUQA 2E72A 3J80C 1HNXE 5IT9C 1N33E 2MKDA 1GTKA 2EOYA 3J7AG 2JVAA 1X6HA 4B3RE 1MGTA 4L8NA 3JAMC 1A1FA 2EOMA 1A1JA 2LT7A 2HC5A 2NUEA 2EMCA 3TQMA 4MLQA 5AE2A 2DB2A 2V85A 2HGHA 4O43A 2JP9A 2EMBA 2EP3A 3MHSC 3AUZA 5AC4A 2CPNA 4DV4E 2ODRC 2JPAA 2EM6A 5ADZA 2LTRA 2LVHA 1EKZA 1ZR9A 2NUGA 2M1SA 4WXDA 2N8XA 2CSHA 4F9AB 2M9AA 3JU0A 2MC5A 2RS7A 2MDGA 2YRKA 4X64E 3T1HE 2DLKA 2DGCA 1UBDC 2EPAA 2EPLX 3EPLA 2K7IA 4M30A 1A1LA 2YPNA 2JR1A 4M9VC 2WBTA 3C6MA 1YSAC 4DUZE 2YU5A 2EQ0A 2LBSB 2EPNA 2B7TA 3C4TA 3VK6A 4BHBA 1A1GA 2V8QB 4DKKA 2M7QA 1GZ6A 1L4SA 3THNA 1KYQA 2EPZA 2VF1A 1ZBQA 2EMLA 2EMAA 5A6JA 4GEQB 2DLQA 3H09A 2EPXA 4B3SE 4YY3E 3IWBA 3VYXA 2UUAE 2EL6A 4GKJE 1G2DC 2JOXA 2UU9E 2EOSA 1UILA 2EQ1A 4NXNE 1LLMC 2L6MA 4NXME 1YFHA 2F4VE 1AAYA 4R2QA 2WBUA 4TUGA 2DMYA 2V83A 3DF6A 2EOOA 2RS6A 4HEIA 2ADRA 1RQ0A 2YSPA 2YZTA 2DMIA 1SFEA 2MDRA 4Q28A 3ADJA 5KL4A 1BBOA 1PJQA 2NABA 1DGCA 1YYKA 4NHRA 4JI4E 4BC9A 2EPCA 2FTXB 1WXRA 3EPHA 3EPJA 4B3TE 4GZNC 4NZVA 1IBLE 4LF8E 2DRPA 2EPOA 1DQ3A 1JK2A 2R1FA 2H36X 1ZU1A 4LF5E 1T4OA 1P47A 1IBME 1EH6A 4LF9E 5AASA 4DV3E 2L2NA 3HPZA 5LMUE 2YTQA 4R2AA 4F9CB 2YTJA 3C4BA 4WPYA 2EOZA 4DV1E 3T1YE 3ADGA 3LLHA 5A6KA 1NEIA 5AE1A 4JI1E 2UXCE 3M99B 2YT4A 3AV0A 2LRSA 1PJTA 2JY9A 2EM9A 4X62E 4RHBB 1A1IA 2EM5A 2EN1A 2L33A 4BC7A 2EN3A 2LO3A 1WRJA 5IXMB 1UN6B 2EWLA 2YTGA 2EZ6A 3LMLA 1ZBTA 2KHXA 3HXLA 4DV7E 1BBGA 2J7JA 2EM0A 2ELYA 2EQ3A 3BBGA 2EMFA 4HTGA 4KZSA 2EOFA 1PJSA 3OMLA 1N3GA 2EOJA 2YTPA 4LF7E 4YHHE 3BGHA 4DR3E 2YTDA 4BBYA 2ENAA 1GQEA 2BB8A 2YSOA 2RQLA 3F6GA 4DV0E 2V89A 1X48A 2Q8UA 2ODRD 1YUJA 3BIDA 2EM3A 2UUBE 4DV6E 1Z1BA 4JYAE 2VQEE 2I13A 2EMIA 2EL5A 2EMHA 1WHNA 4OOGC 2WBSA 2VRDA 2GHFA 2EN7A 3UK3C 1X47A 4N4RB 3FIGA 4KWYA 2LCEA 4BMJA 2KONA 2CT1A 4LFAE 3ECRA 1A1HA 4O4KA 1J5EE 4X66E 4R03A 4P78A 2EMKA 3ZOQB 2L3JA 3VHTB 4JI5E 2ENCA 1BB8A 4R2SA 4LF4E 3HTXA 4DR4E 2EMWA 4AQYE 3QG5C 2EJ4A 4X65E 4WSPA 1HNZE 5KL2A 3K6QA 2I9IA 4DMIA 1N36E 4LFBE 1T4NA 1FJGE 1STUA 1WHQA 3THOB 2MKNA 2R76A 1TF6A 2EOQA 1YPNA 1YUIA 2YTNA 1JK1A 1AH5A 3BF2A 4M0VA 5DNYA 2EN2A 4JI3E 4R2EA 3J7Yp 2YU8A 3ADIA 2EPKX
chains in the Genus database with same CATH topology
3ADGA 3LLHA 1XNQE 4JI1E 4WFTA 5AE1A 5A2QC 4JI8E 2NUEA 2YT4A 3F6HA 2UXCE 4DR5E 2IHR1 5AE2A 2DB2A 2V85A 3AV0A 2LRSA 3P1XA 4L5NC 1T4LB 3RMPA 2NUFA 2JY9A 4KHPE 4J8ZA 4X62E 3AUZA 2KOUA 4B3ME 2CPNA 2N3GA 4DV4E 2ODRC 4P7DA 5ADZA 4K0KE 4M2ZA 2LTRA 5CFFE 2LUPB 1XNRE 3IWDA 1EKZA 1J26A 2NUGA 2M1SA 3VYYA 2L33A 2UXDE 4BC7A 4JI6E 2M4IA 2B9DA 2B7VA 2K4VA 4GKKE 4F9AB 1N32E 1HNWE 4LTYA 3JU0A 2EWLA 1I94E 1UHZA 4DV5E 2MC5A 1IBKE 2EZ6A 2RS7A 3LMLA 1ZBTA 2KHXA 3HXLA 4X64E 5T6JA 4DV7E 3T1HE 4LF6E 4JI2E 2LTSA 3HQ1A 4OX9E 3DJWA 1O0WA 2V88A 4KZSA 3OMLA 4M30A 2FGGA 4LF7E 3OTOE 2ZM6E 2UUCE 2N3HA 2JR1A 4YHHE 4LU9A 4DR3E 1DI2A 2UXBE 1PKPA 4BBYA 1GQEA 4DR1E 4DV0E 5F3WA 3F6GA 4DUZE 2G7HA 2LBSB 2V89A 1RC7A 1X48A 3ADLA 2B7TA 2ODRD 3C4TA 3VK6A 2UUBE 2V87A 2V8QB 4DKKA 2M7QA 4DV6E 1GZ6A 2V86A 5FLXC 2VQEE 3IWCA 5BR8E 4BCAA 4DUYE 4JYAE 4JI0E 5IWAE 2E1MA 1WHNA 2L2KB 2RTXA 1X49A 2DIXA 2VF1A 4OOGC 1ZBQA 4TUIA 1YYWA 2LE2A 4GEQB 3H09A 4R8OA 4B3SE 4YY3E 1X47A 2JWOA 3IWBA 2UUAE 3VYXA 4GKJE 2RSMA 2WZOA 3FIGA 5LL6R 4F54A 2JOXA 4DR7E 2FV4B 2UU9E 4X8WA 4BMJA 4LFCE 2KONA 4LFAE 1UILA 4F9BB 4DR6E 2LMZA 1FKAE 2F8BA 2E5LE 4BS9A 4NXNE 1J5EE 2L6MA 3HPSA 4X66E 4NXME 4R03A 4P78A 2L3CA 3ZOQB 2L3JA 2LJHA 2F4VE 1XMOE 4JI5E 4TUGA 4DV2E 4JV5E 2DMYA 2NA2A 2V83A 3KWRA 4LF4E 2MC6A 3DF6A 2RS6A 5AE3A 3HTXA 1RQ0A 1XMQE 1SR9A 4I8OA 4DR4E 4DR2E 2YZTA 4AQYE 2JOBA 2VQFE 4X65E 2MDRA 4Q28A 3ADJA 3JTZA 4WSPA 4WYQB 2L92A 1HNZE 1QU6A 2DSYA 1YYKA 3K6QA 4JI4E 4DMIA 4JI7E 2VE7C 1HR0E 4BC9A 1N36E 2LUQA 1T4NA 3J80C 2HHHE 4LFBE 2B3TB 2FTXB 1WHQA 1STUA 3J81C 1FJGE 1WXRA 1HNXE 5IT9C 1YYOA 4B3TE 2L2MA 1N33E 1YZ9A 1IBLE 4LF8E 1DQ3A 3J7AG 2H36X 2JVAA 1N34E 3MSWA 5LMNE 4LF5E 4B3RE 1T4OA 1IBME 4LF9E 5AASA 4DV3E 4M0VA 2L2NA 3HPZA 4L8NA 3JAMC 5DNYA 3J7Yp 5LMUE 4JI3E 4F9CB 3ADIA 3C4BA 2L8TA 4WPYA 4DV1E 3T1YE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOB A; 
#chains in the Genus database with same CATH topology
 1XNQ E;  1PDA A;  2EOI A;  4WFT A;  4JI8 E;  3F6H A;  3P1X A;  2EPR A;  1TF3 A;  2NUF A;  4IJD A;  1TN9 A;  4J8Z A;  2YTE A;  1NCS A;  4K0K E;  4M2Z A;  2EPU A;  5CFF E;  3IWD A;  1J26 A;  3VYY A;  2EMG A;  2LV2 A;  2UXD E;  1X6E A;  4JI6 E;  2B9D A;  2B7V A;  2K4V A;  4GKK E;  2YWQ A;  2PRT A;  4LTY A;  1HNW E;  4F6M A;  1UHZ A;  4DV5 E;  4WX9 A;  4F2J C;  2V88 A;  2EOH A;  4Q35 B;  2EOR A;  3OTO E;  2UUC E;  2N3H A;  4LU9 A;  2EMZ A;  4DR1 E;  1A1K A;  2G7H A;  3EQ1 A;  3ADL A;  2EOE A;  2V87 A;  2V86 A;  5IWA E;  3EPK A;  2L2K B;  1YYW A;  1YZ9 A;  1X49 A;  2DIX A;  4TUI A;  3KZY A;  2EM4 A;  2ENH A;  4R8O A;  5A6A A;  2WCC 3;  2JWO A;  2RSM A;  4F54 A;  2FV4 B;  4F9B B;  4DR6 E;  2F8B A;  2E5L E;  4BS9 A;  3HPS A;  2L3C A;  2LJH A;  3KZZ A;  1XMO E;  2EM2 A;  4DV2 E;  4RH8 A;  3KWR A;  4JV5 E;  1G2F C;  2YTI A;  4I8O A;  2CTD A;  4WXC A;  2D9H A;  2JOB A;  2VQF E;  3JTZ A;  2L92 A;  1QU6 A;  4R2R A;  1HR0 E;  2HHH E;  2LJU A;  2B3T B;  3J81 C;  5IV8 B;  2EPP A;  2JXP A;  2EMY A;  2GLI A;  1X3C A;  5TSE A;  1YYO A;  2L2M A;  2YTO A;  1N34 E;  1X5W A;  3MSW A;  5LMN E;  2JYA A;  2EN6 A;  1WJP A;  1EH7 A;  2L8T A;  1FKA E;  1MEY C;  5A2Q C;  4DR5 E;  2IHR 1;  4L5N C;  1T4L B;  1ZAA C;  2EMX A;  3RMP A;  4KHP E;  4ZYE A;  4BHC A;  2KOU A;  4B3M E;  2N3G A;  2YRH A;  4P7D A;  2LUP B;  1XNR E;  1EH8 A;  4R2C A;  4R2D A;  2YRM A;  2M4I A;  2EM8 A;  2EOX A;  1N32 E;  1I94 E;  4X9J A;  1IBK E;  4MLV A;  4WSG A;  5T6J A;  1QNT A;  4LF6 E;  4JI2 E;  1KJK A;  4R2P A;  2LTS A;  5KL3 A;  1T39 A;  3HQ1 A;  4OX9 E;  1X6F A;  3DJW A;  1O0W A;  4FK5 C;  1IQS A;  2FGG A;  1IQO A;  2EL4 A;  2ZM6 E;  1IMU A;  2HJJ A;  2ELZ A;  3L00 A;  1DI2 A;  2UXB E;  1PKP A;  5F3W A;  2YTF A;  1RC7 A;  5A6B A;  5KL5 A;  5FLX C;  4DUY E;  3IWC A;  5BR8 E;  4BCA A;  1RMD A;  2A25 A;  4JI0 E;  2GPI A;  2E1M A;  2RTX A;  2LE2 A;  1B69 A;  2WZO A;  5LL6 R;  4F6N A;  4DR7 E;  4O24 A;  4ZYH A;  1F2I G;  4X8W A;  4LFC E;  2EN8 A;  2LMZ A;  4O5G A;  5AC5 A;  5KL6 A;  3C6K A;  2RPC A;  2RSI A;  4ZYG A;  5KL7 A;  2NA2 A;  5A69 A;  2MC6 A;  5AE3 A;  2EN4 A;  1XMQ E;  1SR9 A;  4ZYD A;  4DR2 E;  4WYQ B;  2BBG A;  5LLQ A;  2DSY A;  2EM7 A;  2EPM X;  4IS1 C;  4JI7 E;  2VE7 C;  3MHH C;  5A6B D;  2EE8 A;  1T38 A;  2LUQ A;  2E72 A;  3J80 C;  1HNX E;  5IT9 C;  1N33 E;  2MKD A;  1GTK A;  2EOY A;  3J7A G;  2JVA A;  1X6H A;  4B3R E;  1MGT A;  4L8N A;  3JAM C;  1A1F A;  2EOM A;  1A1J A;  2LT7 A;  2HC5 A;  2NUE A;  2EMC A;  3TQM A;  4MLQ A;  5AE2 A;  2DB2 A;  2V85 A;  2HGH A;  4O43 A;  2JP9 A;  2EMB A;  2EP3 A;  3MHS C;  3AUZ A;  5AC4 A;  2CPN A;  4DV4 E;  2ODR C;  2JPA A;  2EM6 A;  5ADZ A;  2LTR A;  2LVH A;  1EKZ A;  1ZR9 A;  2NUG A;  2M1S A;  4WXD A;  2N8X A;  2CSH A;  4F9A B;  2M9A A;  3JU0 A;  2MC5 A;  2RS7 A;  2MDG A;  2YRK A;  4X64 E;  3T1H E;  2DLK A;  2DGC A;  1UBD C;  2EPA A;  2EPL X;  3EPL A;  2K7I A;  4M30 A;  1A1L A;  2YPN A;  2JR1 A;  4M9V C;  2WBT A;  3C6M A;  1YSA C;  4DUZ E;  2YU5 A;  2EQ0 A;  2LBS B;  2EPN A;  2B7T A;  3C4T A;  3VK6 A;  4BHB A;  1A1G A;  2V8Q B;  4DKK A;  2M7Q A;  1GZ6 A;  1L4S A;  3THN A;  1KYQ A;  2EPZ A;  2VF1 A;  1ZBQ A;  2EML A;  2EMA A;  5A6J A;  4GEQ B;  2DLQ A;  3H09 A;  2EPX A;  4B3S E;  4YY3 E;  3IWB A;  3VYX A;  2UUA E;  2EL6 A;  4GKJ E;  1G2D C;  2JOX A;  2UU9 E;  2EOS A;  1UIL A;  2EQ1 A;  4NXN E;  1LLM C;  2L6M A;  4NXM E;  1YFH A;  2F4V E;  1AAY A;  4R2Q A;  2WBU A;  4TUG A;  2DMY A;  2V83 A;  3DF6 A;  2EOO A;  2RS6 A;  4HEI A;  2ADR A;  1RQ0 A;  2YSP A;  2YZT A;  2DMI A;  1SFE A;  2MDR A;  4Q28 A;  3ADJ A;  5KL4 A;  1BBO A;  1PJQ A;  2NAB A;  1DGC A;  1YYK A;  4NHR A;  4JI4 E;  4BC9 A;  2EPC A;  2FTX B;  1WXR A;  3EPH A;  3EPJ A;  4B3T E;  4GZN C;  4NZV A;  1IBL E;  4LF8 E;  2DRP A;  2EPO A;  1DQ3 A;  1JK2 A;  2R1F A;  2H36 X;  1ZU1 A;  4LF5 E;  1T4O A;  1P47 A;  1IBM E;  1EH6 A;  4LF9 E;  5AAS A;  4DV3 E;  2L2N A;  3HPZ A;  5LMU E;  2YTQ A;  4R2A A;  4F9C B;  2YTJ A;  3C4B A;  4WPY A;  2EOZ A;  4DV1 E;  3T1Y E;  3ADG A;  3LLH A;  5A6K A;  1NEI A;  5AE1 A;  4JI1 E;  2UXC E;  3M99 B;  2YT4 A;  3AV0 A;  2LRS A;  1PJT A;  2JY9 A;  2EM9 A;  4X62 E;  4RHB B;  1A1I A;  2EM5 A;  2EN1 A;  2L33 A;  4BC7 A;  2EN3 A;  2LO3 A;  1WRJ A;  5IXM B;  1UN6 B;  2EWL A;  2YTG A;  2EZ6 A;  3LML A;  1ZBT A;  2KHX A;  3HXL A;  4DV7 E;  1BBG A;  2J7J A;  2EM0 A;  2ELY A;  2EQ3 A;  3BBG A;  2EMF A;  4HTG A;  4KZS A;  2EOF A;  1PJS A;  3OML A;  1N3G A;  2EOJ A;  2YTP A;  4LF7 E;  4YHH E;  3BGH A;  4DR3 E;  2YTD A;  4BBY A;  2ENA A;  1GQE A;  2BB8 A;  2YSO A;  2RQL A;  3F6G A;  4DV0 E;  2V89 A;  1X48 A;  2Q8U A;  2ODR D;  1YUJ A;  3BID A;  2EM3 A;  2UUB E;  4DV6 E;  1Z1B A;  4JYA E;  2VQE E;  2I13 A;  2EMI A;  2EL5 A;  2EMH A;  1WHN A;  4OOG C;  2WBS A;  2VRD A;  2GHF A;  2EN7 A;  3UK3 C;  1X47 A;  4N4R B;  3FIG A;  4KWY A;  2LCE A;  4BMJ A;  2KON A;  2CT1 A;  4LFA E;  3ECR A;  1A1H A;  4O4K A;  1J5E E;  4X66 E;  4R03 A;  4P78 A;  2EMK A;  3ZOQ B;  2L3J A;  3VHT B;  4JI5 E;  2ENC A;  1BB8 A;  4R2S A;  4LF4 E;  3HTX A;  4DR4 E;  2EMW A;  4AQY E;  3QG5 C;  2EJ4 A;  4X65 E;  4WSP A;  1HNZ E;  5KL2 A;  3K6Q A;  2I9I A;  4DMI A;  1N36 E;  4LFB E;  1T4N A;  1FJG E;  1STU A;  1WHQ A;  3THO B;  2MKN A;  2R76 A;  1TF6 A;  2EOQ A;  1YPN A;  1YUI A;  2YTN A;  1JK1 A;  1AH5 A;  3BF2 A;  4M0V A;  5DNY A;  2EN2 A;  4JI3 E;  4R2E A;  3J7Y p;  2YU8 A;  3ADI A;  2EPK X; 
#chains in the Genus database with same CATH homology
 3ADG A;  3LLH A;  1XNQ E;  4JI1 E;  4WFT A;  5AE1 A;  5A2Q C;  4JI8 E;  2NUE A;  2YT4 A;  3F6H A;  2UXC E;  4DR5 E;  2IHR 1;  5AE2 A;  2DB2 A;  2V85 A;  3AV0 A;  2LRS A;  3P1X A;  4L5N C;  1T4L B;  3RMP A;  2NUF A;  2JY9 A;  4KHP E;  4J8Z A;  4X62 E;  3AUZ A;  2KOU A;  4B3M E;  2CPN A;  2N3G A;  4DV4 E;  2ODR C;  4P7D A;  5ADZ A;  4K0K E;  4M2Z A;  2LTR A;  5CFF E;  2LUP B;  1XNR E;  3IWD A;  1EKZ A;  1J26 A;  2NUG A;  2M1S A;  3VYY A;  2L33 A;  2UXD E;  4BC7 A;  4JI6 E;  2M4I A;  2B9D A;  2B7V A;  2K4V A;  4GKK E;  4F9A B;  1N32 E;  1HNW E;  4LTY A;  3JU0 A;  2EWL A;  1I94 E;  1UHZ A;  4DV5 E;  2MC5 A;  1IBK E;  2EZ6 A;  2RS7 A;  3LML A;  1ZBT A;  2KHX A;  3HXL A;  4X64 E;  5T6J A;  4DV7 E;  3T1H E;  4LF6 E;  4JI2 E;  2LTS A;  3HQ1 A;  4OX9 E;  3DJW A;  1O0W A;  2V88 A;  4KZS A;  3OML A;  4M30 A;  2FGG A;  4LF7 E;  3OTO E;  2ZM6 E;  2UUC E;  2N3H A;  2JR1 A;  4YHH E;  4LU9 A;  4DR3 E;  1DI2 A;  2UXB E;  1PKP A;  4BBY A;  1GQE A;  4DR1 E;  4DV0 E;  5F3W A;  3F6G A;  4DUZ E;  2G7H A;  2LBS B;  2V89 A;  1RC7 A;  1X48 A;  3ADL A;  2B7T A;  2ODR D;  3C4T A;  3VK6 A;  2UUB E;  2V87 A;  2V8Q B;  4DKK A;  2M7Q A;  4DV6 E;  1GZ6 A;  2V86 A;  5FLX C;  2VQE E;  3IWC A;  5BR8 E;  4BCA A;  4DUY E;  4JYA E;  4JI0 E;  5IWA E;  2E1M A;  1WHN A;  2L2K B;  2RTX A;  1X49 A;  2DIX A;  2VF1 A;  4OOG C;  1ZBQ A;  4TUI A;  1YYW A;  2LE2 A;  4GEQ B;  3H09 A;  4R8O A;  4B3S E;  4YY3 E;  1X47 A;  2JWO A;  3IWB A;  2UUA E;  3VYX A;  4GKJ E;  2RSM A;  2WZO A;  3FIG A;  5LL6 R;  4F54 A;  2JOX A;  4DR7 E;  2FV4 B;  2UU9 E;  4X8W A;  4BMJ A;  4LFC E;  2KON A;  4LFA E;  1UIL A;  4F9B B;  4DR6 E;  2LMZ A;  1FKA E;  2F8B A;  2E5L E;  4BS9 A;  4NXN E;  1J5E E;  2L6M A;  3HPS A;  4X66 E;  4NXM E;  4R03 A;  4P78 A;  2L3C A;  3ZOQ B;  2L3J A;  2LJH A;  2F4V E;  1XMO E;  4JI5 E;  4TUG A;  4DV2 E;  4JV5 E;  2DMY A;  2NA2 A;  2V83 A;  3KWR A;  4LF4 E;  2MC6 A;  3DF6 A;  2RS6 A;  5AE3 A;  3HTX A;  1RQ0 A;  1XMQ E;  1SR9 A;  4I8O A;  4DR4 E;  4DR2 E;  2YZT A;  4AQY E;  2JOB A;  2VQF E;  4X65 E;  2MDR A;  4Q28 A;  3ADJ A;  3JTZ A;  4WSP A;  4WYQ B;  2L92 A;  1HNZ E;  1QU6 A;  2DSY A;  1YYK A;  3K6Q A;  4JI4 E;  4DMI A;  4JI7 E;  2VE7 C;  1HR0 E;  4BC9 A;  1N36 E;  2LUQ A;  1T4N A;  3J80 C;  2HHH E;  4LFB E;  2B3T B;  2FTX B;  1WHQ A;  1STU A;  3J81 C;  1FJG E;  1WXR A;  1HNX E;  5IT9 C;  1YYO A;  4B3T E;  2L2M A;  1N33 E;  1YZ9 A;  1IBL E;  4LF8 E;  1DQ3 A;  3J7A G;  2H36 X;  2JVA A;  1N34 E;  3MSW A;  5LMN E;  4LF5 E;  4B3R E;  1T4O A;  1IBM E;  4LF9 E;  5AAS A;  4DV3 E;  4M0V A;  2L2N A;  3HPZ A;  4L8N A;  3JAM C;  5DNY A;  3J7Y p;  5LMU E;  4JI3 E;  4F9C B;  3ADI A;  3C4B A;  2L8T A;  4WPY A;  4DV1 E;  3T1Y E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...