2WBTA

The structure of a double c2h2 zinc finger protein from a hyperthermophilic archaeal virus in the absence of dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
DVDSGSKKYLSNHKGIFIHVTLEELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLYRLLASKAISQFVCPLCLMPFSSSVSLKQHIRYTEHTKVCPVCKKEFTSTDSALDHVCKKHNICVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords B-129
publication title The Structure of a Double C2H2 Zinc Finger Protein from a Hyperthermophilic Archaeal Virus in the Absence of DNA
rcsb
source organism Sulfolobus virus 1
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12756 zf-C2H2_2 C2H2 type zinc-finger (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbtA02
1TN9A 2CTDA 3EPLA 1X3CA 2EJ4A 2MDGA 1A1LA 2ELZA 2PRTA 1YSAC 1ZU1A 2EMFA 2YTQA 4R2DA 3MHSC 2EOFA 2GLIA 2DMIA 4F6NA 2EOZA 2NABA 2RPCA 3M99B 2YTIA 1X6HA 2BB8A 2YTJA 2EN2A 2VRDA 1LLMC 4R2CA 2J7JA 2LV2A 2YTFA 1BB8A 2CT1A 2ADRA 2EMBA 2EPZA 1RMDA 4R2SA 2EM3A 1A1JA 2YTGA 2EPXA 2YRKA 2EOQA 5KL7A 2EN6A 4F6MA 3EPHA 2YSOA 2LVHA 2EN7A 2WBUA 1G2DC 2EPPA 2EN8A 2EPUA 2EL5A 2EOHA 1NCSA 2YTDA 2EOSA 2EQ0A 2JP9A 1KJKA 2EM0A 2EN3A 2EMIA 1Z1BA 2EL4A 2YTOA 2DLKA 2EMZA 2EPCA 3VHTB 5KL6A 4IS1C 2MKNA 2EM5A 2MKDA 3EPKA 1JK1A 5KL2A 2EMYA 2YU5A 1A1FA 2EM4A 2EM7A 2CSHA 2YTEA 5KL4A 2EL6A 2YU8A 2EOIA 2EOEA 2EOJA 3UK3C 2EPRA 2EP3A 2WBSA 4R2RA 4FK5C 2R1FA 4R2EA 4IJDA 4GZNC 1AAYA 4WSGA 5KL3A 2EPAA 1X6FA 1WJPA 2EMXA 2DLQA 2EOXA 2A25A 2HGHA 2EM8A 1F2IG 2GHFA 1UBDC 2EMGA 2E72A 1MEYC 2M9AA 1UN6B 1JK2A 4X9JA 1DGCA 2EMAA 2WCC3 4R2PA 2ENAA 2YRMA 2EM9A 4R2QA 2YRHA 2ELYA 2EQ3A 1A1IA 4M9VC 1X6EA 1BBOA 2EM6A 2EOOA 1TF6A 1YUJA 2DRPA 2ENCA 2YSPA 1YUIA 2YTPA 2D9HA 1ZAAC 2EORA 5KL5A 2EMWA 2RSIA 2I13A 2EOYA 2EMHA 1A1KA 2DGCA 3EPJA 1ZR9A 2EQ1A 2EE8A 1A1HA 2JPAA 1X5WA 2EMLA 2ENHA 2YTNA 2LT7A 1B69A 1P47A 4R2AA 2EMKA 2EN1A 1TF3A 2EN4A 2WBTA 4F2JC 3MHHC 2EM2A 2LO3A 2LCEA 1G2FC 2EMCA 2EOMA 1A1GA
chains in the Genus database with same CATH superfamily
4LF8E 4O4KA 2JWOA 3EPLA 5TSEA 2EJ4A 2MDGA 2ELZA 2LRSA 5A69A 2N8XA 2N3HA 4HEIA 4KZSA 4B3ME 4F54A 4DR1E 2GLIA 4J8ZA 2MC6A 2EOZA 1N32E 2RPCA 3M99B 3J7Yp 2YTJA 2VRDA 4HTGA 2LJUA 1EH8A 2J7JA 2YTFA 4F9AB 1BB8A 4BMJA 1SR9A 2RQLA 3QG5C 2IHR1 2EM3A 4Q28A 1PKPA 2YTGA 2EPNA 4F6MA 2LUPB 1G2DC 3KZZA 2EPLX 2EL5A 2YTDA 1T4OA 2UUAE 2JOBA 2EN3A 2EMIA 2M1SA 2EL4A 4MLQA 5F3WA 2EM5A 1SFEA 3BF2A 2MKDA 2EPMX 1L4SA 5KL2A 2YWQA 2EMYA 2EM4A 1X49A 2EM7A 2CSHA 4BHBA 2L3CA 2RS6A 3VK6A 1YFHA 4X65E 2EOEA 2EOJA 2EPRA 2E1MA 2VE7C 2NUGA 4ZYHA 2JR1A 4R2RA 4FK5C 4R2EA 2R76A 2EPKX 4WSGA 2WZOA 2EPAA 2UUBE 4YHHE 4B3RE 2FV4B 1PJTA 1UBDC 5FLXC 2WCC3 2ENAA 4LF9E 2NA2A 1DI2A 4LF4E 1A1IA 4M9VC 3F6GA 1HR0E 3ADIA 1PJQA 2ENCA 2YSPA 3HXLA 1QU6A 2MDRA 2HC5A 1ZAAC 1O0WA 3J80C 1J26A 3IWBA 2L6MA 5LMUE 1X5WA 4JI7E 2ENHA 2EPOA 3THOB 1XMOE 3HQ1A 2LT7A 1B69A 4GKJE 1BBGA 3ADGA 3VYYA 2EN1A 1TF3A 2EZ6A 2B7TA 2EN4A 2L92A 2EM2A 2LCEA 1G2FC 2L2MA 1A1GA 1TN9A 3BBGA 2CTDA 1X3CA 3J7AG 2KHXA 4JI4E 1ZU1A 4GKKE 4RHBB 1IQSA 4DV5E 4M0VA 2NABA 2YTIA 1X6HA 4NHRA 4LFAE 2M4IA 4LF5E 1GTKA 2I9IA 1LLMC 4DV6E 2ZM6E 2VQFE 2EPZA 4JI5E 4AQYE 3BGHA 2LUQA 4X66E 1A1JA 3JAMC 2EOQA 5KL7A 5IV8B 2DB2A 1EH6A 2LTRA 2LVHA 2EN7A 2WBUA 5A6BD 2V89A 2V88A 4O5GA 4LF6E 2EOSA 5A6JA 4KHPE 2YTOA 4DMIA 1HNZE 4JV5E 4DV2E 1STUA 4IS1C 2NUEA 4JI3E 4L5NC 5A6KA 1A1FA 1N3GA 2YTEA 4X62E 3FIGA 2YU8A 5DNYA 5ADZA 1GZ6A 2EP3A 2WBSA 3AV0A 1GQEA 3C6MA 4YY3E 2DIXA 4BCAA 2EOXA 2FGGA 2A25A 1XMQE 2EM8A 1PDAA 2E72A 2HHHE 4X9JA 4I8OA 4B3SE 3ECRA 1UILA 1YYOA 2DSYA 1AH5A 4R2QA 2YRHA 2B3TB 2EQ3A 1X6EA 2V8QB 1BBOA 2UXBE 2EM6A 2EOOA 2CPNA 4R8OA 4DV3E 2D9HA 2EORA 2EMWA 1N34E 2RSIA 2EOYA 2L2NA 2RTXA 2FTXB 1A1KA 3LMLA 3EPJA 1ZR9A 2K4VA 4DR2E 2Q8UA 3ZOQB 4DR5E 2EQ1A 4ZYEA 4R03A 4OX9E 1WXRA 2JPAA 4DV0E 4ZYDA 2G7HA 4DV7E 1P47A 4LU9A 4WXCA 3KWRA 4F2JC 3MHHC 4L8NA 1PJSA 4F9CB 4P78A 3JTZA 1QNTA 2YZTA 5AC4A 5AASA 4JI0E 4JI1E 2KONA 1YSAC 1ZBTA 2EMFA 4R2DA 1YZ9A 2M7QA 5A6BA 4JYAE 5IWAE 4WFTA 2EN2A 4R2CA 2LV2A 4DUZE 2ADRA 2EMBA 1RMDA 1NEIA 4B3TE 4M2ZA 3TQMA 3C4BA 2YRKA 5LLQA 4Q35B 3EPHA 3THNA 4NXME 2YSOA 5IXMB 2V87A 2EPPA 1ZBQA 3F6HA 1T39A 2EPUA 4DR7E 2EOHA 4DV1E 2F8BA 2EWLA 2JVAA 2YPNA 4JI8E 2EQ0A 4BHCA 2JP9A 2EM0A 4JI2E 2DLKA 2EMZA 2EPCA 4DR4E 5KL6A 3H09A 4LF7E 1IQOA 5AC5A 4WYQB 1JK1A 3ADLA 1XNRE 1UHZA 3P1XA 4M30A 4OOGC 3MSWA 1EKZA 2VF1A 5KL4A 3AUZA 2EL6A 4DV4E 1WHQA 3IWCA 3UK3C 1IBKE 4ZYGA 2LE2A 4WX9A 4BS9A 2RSMA 4GZNC 1AAYA 5KL3A 4X8WA 1J5EE 3OTOE 1WJPA 2L2KB 1KYQA 2HGHA 1F2IG 2GHFA 1MEYC 2M9AA 1XNQE 1JK2A 2EMAA 4R2PA 2YRMA 2HJJA 5BR8E 5AE3A 1HNXE 3DF6A 4DUYE 1RQ0A 4TUGA 4KWYA 2LJHA 1IBLE 1T38A 1N36E 1TF6A 1YUJA 2DRPA 3VYXA 2UU9E 2N3GA 1WRJA 2KOUA 2UXDE 2MC5A 2DMYA 2EMHA 1EH7A 1DQ3A 2DGCA 1HNWE 2ODRC 2JOXA 2EE8A 3K6QA 2EMLA 4LFCE 3LLHA 4LFBE 4O24A 3L00A 3OMLA 2WBTA 2LO3A 5LL6R 4K0KE 3EQ1A 2VQEE 2EOMA 2EM9A 2UUCE 5A6AA 2E5LE 4BC9A 2LTSA 1A1LA 1N33E 2PRTA 1X48A 2F4VE 1YPNA 1I94E 2YTQA 2L33A 3MHSC 2H36X 2EOFA 2BBGA 2DMIA 4F6NA 2GPIA 2BB8A 2V83A 4P7DA 1WHNA 3JU0A 2CT1A 4R2SA 1YYWA 5LMNE 4RH8A 1IMUA 2YT4A 2EPXA 1T4NA 2EN6A 2NUFA 4WSPA 4DR6E 2EN8A 3C4TA 1NCSA 4O43A 1FJGE 4N4RB 1KJKA 4WXDA 4JI6E 1Z1BA 3T1HE 2K7IA 3VHTB 3J81C 2JY9A 2MKNA 1T4LB 3EPKA 4MLVA 2YU5A 4BBYA 2L3JA 4LTYA 2B7VA 2EOIA 3T1YE 2JYAA 2R1FA 4IJDA 3KZYA 4DKKA 2V86A 1MGTA 1X6FA 4F9BB 3HTXA 2EMXA 2RS7A 4BC7A 2DLQA 2L8TA 2LMZA 2EMGA 1IBME 3RMPA 1RC7A 1UN6B 1X47A 1DGCA 5T6JA 5CFFE 1YYKA 2ELYA 1FKAE 2UXCE 2B9DA 3ADJA 4WPYA 4NXNE 2LBSB 4TUIA 1YUIA 2YTPA 5KL5A 3HPZA 2I13A 3BIDA 3C6KA 3HPSA 3DJWA 4X64E 2V85A 1A1HA 2JXPA 2YTNA 5AE1A 5A2QC 4R2AA 2EMKA 2ODRD 3IWDA 5AE2A 5IT9C 4GEQB 2EMCA 4NZVA 4DR3E
chains in the Genus database with same CATH topology
1TN9A 2CTDA 3EPLA 1X3CA 2EJ4A 2MDGA 1A1LA 2ELZA 2PRTA 1YSAC 1ZU1A 2EMFA 2YTQA 4R2DA 3MHSC 2EOFA 2GLIA 2DMIA 4F6NA 2EOZA 2NABA 2RPCA 3M99B 2YTIA 1X6HA 2BB8A 2YTJA 2EN2A 2VRDA 1LLMC 4R2CA 2J7JA 2LV2A 2YTFA 1BB8A 2CT1A 2ADRA 2EMBA 2EPZA 1RMDA 4R2SA 2EM3A 1A1JA 2YTGA 2EPXA 2YRKA 2EOQA 5KL7A 2EN6A 4F6MA 3EPHA 2YSOA 2LVHA 2EN7A 2WBUA 1G2DC 2EPPA 2EN8A 2EPUA 2EL5A 2EOHA 1NCSA 2YTDA 2EOSA 2EQ0A 2JP9A 1KJKA 2EM0A 2EN3A 2EMIA 1Z1BA 2EL4A 2YTOA 2DLKA 2EMZA 2EPCA 3VHTB 5KL6A 4IS1C 2MKNA 2EM5A 2MKDA 3EPKA 1JK1A 5KL2A 2EMYA 2YU5A 1A1FA 2EM4A 2EM7A 2CSHA 2YTEA 5KL4A 2EL6A 2YU8A 2EOIA 2EOEA 2EOJA 3UK3C 2EPRA 2EP3A 2WBSA 4R2RA 4FK5C 2R1FA 4R2EA 4IJDA 4GZNC 1AAYA 4WSGA 5KL3A 2EPAA 1X6FA 1WJPA 2EMXA 2DLQA 2EOXA 2A25A 2HGHA 2EM8A 1F2IG 2GHFA 1UBDC 2EMGA 2E72A 1MEYC 2M9AA 1UN6B 1JK2A 4X9JA 1DGCA 2EMAA 2WCC3 4R2PA 2ENAA 2YRMA 2EM9A 4R2QA 2YRHA 2ELYA 2EQ3A 1A1IA 4M9VC 1X6EA 1BBOA 2EM6A 2EOOA 1TF6A 1YUJA 2DRPA 2ENCA 2YSPA 1YUIA 2YTPA 2D9HA 1ZAAC 2EORA 5KL5A 2EMWA 2RSIA 2I13A 2EOYA 2EMHA 1A1KA 2DGCA 3EPJA 1ZR9A 2EQ1A 2EE8A 1A1HA 2JPAA 1X5WA 2EMLA 2ENHA 2YTNA 2LT7A 1B69A 1P47A 4R2AA 2EMKA 2EN1A 1TF3A 2EN4A 2WBTA 4F2JC 3MHHC 2EM2A 2LO3A 2LCEA 1G2FC 2EMCA 2EOMA 1A1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN9 A;  2CTD A;  3EPL A;  1X3C A;  2EJ4 A;  2MDG A;  1A1L A;  2ELZ A;  2PRT A;  1YSA C;  1ZU1 A;  2EMF A;  2YTQ A;  4R2D A;  3MHS C;  2EOF A;  2GLI A;  2DMI A;  4F6N A;  2EOZ A;  2NAB A;  2RPC A;  3M99 B;  2YTI A;  1X6H A;  2BB8 A;  2YTJ A;  2EN2 A;  2VRD A;  1LLM C;  4R2C A;  2J7J A;  2LV2 A;  2YTF A;  1BB8 A;  2CT1 A;  2ADR A;  2EMB A;  2EPZ A;  1RMD A;  4R2S A;  2EM3 A;  1A1J A;  2YTG A;  2EPX A;  2YRK A;  2EOQ A;  5KL7 A;  2EN6 A;  4F6M A;  3EPH A;  2YSO A;  2LVH A;  2EN7 A;  2WBU A;  1G2D C;  2EPP A;  2EN8 A;  2EPU A;  2EL5 A;  2EOH A;  1NCS A;  2YTD A;  2EOS A;  2EQ0 A;  2JP9 A;  1KJK A;  2EM0 A;  2EN3 A;  2EMI A;  1Z1B A;  2EL4 A;  2YTO A;  2DLK A;  2EMZ A;  2EPC A;  3VHT B;  5KL6 A;  4IS1 C;  2MKN A;  2EM5 A;  2MKD A;  3EPK A;  1JK1 A;  5KL2 A;  2EMY A;  2YU5 A;  1A1F A;  2EM4 A;  2EM7 A;  2CSH A;  2YTE A;  5KL4 A;  2EL6 A;  2YU8 A;  2EOI A;  2EOE A;  2EOJ A;  3UK3 C;  2EPR A;  2EP3 A;  2WBS A;  4R2R A;  4FK5 C;  2R1F A;  4R2E A;  4IJD A;  4GZN C;  1AAY A;  4WSG A;  5KL3 A;  2EPA A;  1X6F A;  1WJP A;  2EMX A;  2DLQ A;  2EOX A;  2A25 A;  2HGH A;  2EM8 A;  1F2I G;  2GHF A;  1UBD C;  2EMG A;  2E72 A;  1MEY C;  2M9A A;  1UN6 B;  1JK2 A;  4X9J A;  1DGC A;  2EMA A;  2WCC 3;  4R2P A;  2ENA A;  2YRM A;  2EM9 A;  4R2Q A;  2YRH A;  2ELY A;  2EQ3 A;  1A1I A;  4M9V C;  1X6E A;  1BBO A;  2EM6 A;  2EOO A;  1TF6 A;  1YUJ A;  2DRP A;  2ENC A;  2YSP A;  1YUI A;  2YTP A;  2D9H A;  1ZAA C;  2EOR A;  5KL5 A;  2EMW A;  2RSI A;  2I13 A;  2EOY A;  2EMH A;  1A1K A;  2DGC A;  3EPJ A;  1ZR9 A;  2EQ1 A;  2EE8 A;  1A1H A;  2JPA A;  1X5W A;  2EML A;  2ENH A;  2YTN A;  2LT7 A;  1B69 A;  1P47 A;  4R2A A;  2EMK A;  2EN1 A;  1TF3 A;  2EN4 A;  2WBT A;  4F2J C;  3MHH C;  2EM2 A;  2LO3 A;  2LCE A;  1G2F C;  2EMC A;  2EOM A;  1A1G A; 
#chains in the Genus database with same CATH topology
 4LF8 E;  4O4K A;  2JWO A;  3EPL A;  5TSE A;  2EJ4 A;  2MDG A;  2ELZ A;  2LRS A;  5A69 A;  2N8X A;  2N3H A;  4HEI A;  4KZS A;  4B3M E;  4F54 A;  4DR1 E;  2GLI A;  4J8Z A;  2MC6 A;  2EOZ A;  1N32 E;  2RPC A;  3M99 B;  3J7Y p;  2YTJ A;  2VRD A;  4HTG A;  2LJU A;  1EH8 A;  2J7J A;  2YTF A;  4F9A B;  1BB8 A;  4BMJ A;  1SR9 A;  2RQL A;  3QG5 C;  2IHR 1;  2EM3 A;  4Q28 A;  1PKP A;  2YTG A;  2EPN A;  4F6M A;  2LUP B;  1G2D C;  3KZZ A;  2EPL X;  2EL5 A;  2YTD A;  1T4O A;  2UUA E;  2JOB A;  2EN3 A;  2EMI A;  2M1S A;  2EL4 A;  4MLQ A;  5F3W A;  2EM5 A;  1SFE A;  3BF2 A;  2MKD A;  2EPM X;  1L4S A;  5KL2 A;  2YWQ A;  2EMY A;  2EM4 A;  1X49 A;  2EM7 A;  2CSH A;  4BHB A;  2L3C A;  2RS6 A;  3VK6 A;  1YFH A;  4X65 E;  2EOE A;  2EOJ A;  2EPR A;  2E1M A;  2VE7 C;  2NUG A;  4ZYH A;  2JR1 A;  4R2R A;  4FK5 C;  4R2E A;  2R76 A;  2EPK X;  4WSG A;  2WZO A;  2EPA A;  2UUB E;  4YHH E;  4B3R E;  2FV4 B;  1PJT A;  1UBD C;  5FLX C;  2WCC 3;  2ENA A;  4LF9 E;  2NA2 A;  1DI2 A;  4LF4 E;  1A1I A;  4M9V C;  3F6G A;  1HR0 E;  3ADI A;  1PJQ A;  2ENC A;  2YSP A;  3HXL A;  1QU6 A;  2MDR A;  2HC5 A;  1ZAA C;  1O0W A;  3J80 C;  1J26 A;  3IWB A;  2L6M A;  5LMU E;  1X5W A;  4JI7 E;  2ENH A;  2EPO A;  3THO B;  1XMO E;  3HQ1 A;  2LT7 A;  1B69 A;  4GKJ E;  1BBG A;  3ADG A;  3VYY A;  2EN1 A;  1TF3 A;  2EZ6 A;  2B7T A;  2EN4 A;  2L92 A;  2EM2 A;  2LCE A;  1G2F C;  2L2M A;  1A1G A;  1TN9 A;  3BBG A;  2CTD A;  1X3C A;  3J7A G;  2KHX A;  4JI4 E;  1ZU1 A;  4GKK E;  4RHB B;  1IQS A;  4DV5 E;  4M0V A;  2NAB A;  2YTI A;  1X6H A;  4NHR A;  4LFA E;  2M4I A;  4LF5 E;  1GTK A;  2I9I A;  1LLM C;  4DV6 E;  2ZM6 E;  2VQF E;  2EPZ A;  4JI5 E;  4AQY E;  3BGH A;  2LUQ A;  4X66 E;  1A1J A;  3JAM C;  2EOQ A;  5KL7 A;  5IV8 B;  2DB2 A;  1EH6 A;  2LTR A;  2LVH A;  2EN7 A;  2WBU A;  5A6B D;  2V89 A;  2V88 A;  4O5G A;  4LF6 E;  2EOS A;  5A6J A;  4KHP E;  2YTO A;  4DMI A;  1HNZ E;  4JV5 E;  4DV2 E;  1STU A;  4IS1 C;  2NUE A;  4JI3 E;  4L5N C;  5A6K A;  1A1F A;  1N3G A;  2YTE A;  4X62 E;  3FIG A;  2YU8 A;  5DNY A;  5ADZ A;  1GZ6 A;  2EP3 A;  2WBS A;  3AV0 A;  1GQE A;  3C6M A;  4YY3 E;  2DIX A;  4BCA A;  2EOX A;  2FGG A;  2A25 A;  1XMQ E;  2EM8 A;  1PDA A;  2E72 A;  2HHH E;  4X9J A;  4I8O A;  4B3S E;  3ECR A;  1UIL A;  1YYO A;  2DSY A;  1AH5 A;  4R2Q A;  2YRH A;  2B3T B;  2EQ3 A;  1X6E A;  2V8Q B;  1BBO A;  2UXB E;  2EM6 A;  2EOO A;  2CPN A;  4R8O A;  4DV3 E;  2D9H A;  2EOR A;  2EMW A;  1N34 E;  2RSI A;  2EOY A;  2L2N A;  2RTX A;  2FTX B;  1A1K A;  3LML A;  3EPJ A;  1ZR9 A;  2K4V A;  4DR2 E;  2Q8U A;  3ZOQ B;  4DR5 E;  2EQ1 A;  4ZYE A;  4R03 A;  4OX9 E;  1WXR A;  2JPA A;  4DV0 E;  4ZYD A;  2G7H A;  4DV7 E;  1P47 A;  4LU9 A;  4WXC A;  3KWR A;  4F2J C;  3MHH C;  4L8N A;  1PJS A;  4F9C B;  4P78 A;  3JTZ A;  1QNT A;  2YZT A;  5AC4 A;  5AAS A;  4JI0 E;  4JI1 E;  2KON A;  1YSA C;  1ZBT A;  2EMF A;  4R2D A;  1YZ9 A;  2M7Q A;  5A6B A;  4JYA E;  5IWA E;  4WFT A;  2EN2 A;  4R2C A;  2LV2 A;  4DUZ E;  2ADR A;  2EMB A;  1RMD A;  1NEI A;  4B3T E;  4M2Z A;  3TQM A;  3C4B A;  2YRK A;  5LLQ A;  4Q35 B;  3EPH A;  3THN A;  4NXM E;  2YSO A;  5IXM B;  2V87 A;  2EPP A;  1ZBQ A;  3F6H A;  1T39 A;  2EPU A;  4DR7 E;  2EOH A;  4DV1 E;  2F8B A;  2EWL A;  2JVA A;  2YPN A;  4JI8 E;  2EQ0 A;  4BHC A;  2JP9 A;  2EM0 A;  4JI2 E;  2DLK A;  2EMZ A;  2EPC A;  4DR4 E;  5KL6 A;  3H09 A;  4LF7 E;  1IQO A;  5AC5 A;  4WYQ B;  1JK1 A;  3ADL A;  1XNR E;  1UHZ A;  3P1X A;  4M30 A;  4OOG C;  3MSW A;  1EKZ A;  2VF1 A;  5KL4 A;  3AUZ A;  2EL6 A;  4DV4 E;  1WHQ A;  3IWC A;  3UK3 C;  1IBK E;  4ZYG A;  2LE2 A;  4WX9 A;  4BS9 A;  2RSM A;  4GZN C;  1AAY A;  5KL3 A;  4X8W A;  1J5E E;  3OTO E;  1WJP A;  2L2K B;  1KYQ A;  2HGH A;  1F2I G;  2GHF A;  1MEY C;  2M9A A;  1XNQ E;  1JK2 A;  2EMA A;  4R2P A;  2YRM A;  2HJJ A;  5BR8 E;  5AE3 A;  1HNX E;  3DF6 A;  4DUY E;  1RQ0 A;  4TUG A;  4KWY A;  2LJH A;  1IBL E;  1T38 A;  1N36 E;  1TF6 A;  1YUJ A;  2DRP A;  3VYX A;  2UU9 E;  2N3G A;  1WRJ A;  2KOU A;  2UXD E;  2MC5 A;  2DMY A;  2EMH A;  1EH7 A;  1DQ3 A;  2DGC A;  1HNW E;  2ODR C;  2JOX A;  2EE8 A;  3K6Q A;  2EML A;  4LFC E;  3LLH A;  4LFB E;  4O24 A;  3L00 A;  3OML A;  2WBT A;  2LO3 A;  5LL6 R;  4K0K E;  3EQ1 A;  2VQE E;  2EOM A;  2EM9 A;  2UUC E;  5A6A A;  2E5L E;  4BC9 A;  2LTS A;  1A1L A;  1N33 E;  2PRT A;  1X48 A;  2F4V E;  1YPN A;  1I94 E;  2YTQ A;  2L33 A;  3MHS C;  2H36 X;  2EOF A;  2BBG A;  2DMI A;  4F6N A;  2GPI A;  2BB8 A;  2V83 A;  4P7D A;  1WHN A;  3JU0 A;  2CT1 A;  4R2S A;  1YYW A;  5LMN E;  4RH8 A;  1IMU A;  2YT4 A;  2EPX A;  1T4N A;  2EN6 A;  2NUF A;  4WSP A;  4DR6 E;  2EN8 A;  3C4T A;  1NCS A;  4O43 A;  1FJG E;  4N4R B;  1KJK A;  4WXD A;  4JI6 E;  1Z1B A;  3T1H E;  2K7I A;  3VHT B;  3J81 C;  2JY9 A;  2MKN A;  1T4L B;  3EPK A;  4MLV A;  2YU5 A;  4BBY A;  2L3J A;  4LTY A;  2B7V A;  2EOI A;  3T1Y E;  2JYA A;  2R1F A;  4IJD A;  3KZY A;  4DKK A;  2V86 A;  1MGT A;  1X6F A;  4F9B B;  3HTX A;  2EMX A;  2RS7 A;  4BC7 A;  2DLQ A;  2L8T A;  2LMZ A;  2EMG A;  1IBM E;  3RMP A;  1RC7 A;  1UN6 B;  1X47 A;  1DGC A;  5T6J A;  5CFF E;  1YYK A;  2ELY A;  1FKA E;  2UXC E;  2B9D A;  3ADJ A;  4WPY A;  4NXN E;  2LBS B;  4TUI A;  1YUI A;  2YTP A;  5KL5 A;  3HPZ A;  2I13 A;  3BID A;  3C6K A;  3HPS A;  3DJW A;  4X64 E;  2V85 A;  1A1H A;  2JXP A;  2YTN A;  5AE1 A;  5A2Q C;  4R2A A;  2EMK A;  2ODR D;  3IWD A;  5AE2 A;  5IT9 C;  4GEQ B;  2EMC A;  4NZV A;  4DR3 E; 
#chains in the Genus database with same CATH homology
 1TN9 A;  2CTD A;  3EPL A;  1X3C A;  2EJ4 A;  2MDG A;  1A1L A;  2ELZ A;  2PRT A;  1YSA C;  1ZU1 A;  2EMF A;  2YTQ A;  4R2D A;  3MHS C;  2EOF A;  2GLI A;  2DMI A;  4F6N A;  2EOZ A;  2NAB A;  2RPC A;  3M99 B;  2YTI A;  1X6H A;  2BB8 A;  2YTJ A;  2EN2 A;  2VRD A;  1LLM C;  4R2C A;  2J7J A;  2LV2 A;  2YTF A;  1BB8 A;  2CT1 A;  2ADR A;  2EMB A;  2EPZ A;  1RMD A;  4R2S A;  2EM3 A;  1A1J A;  2YTG A;  2EPX A;  2YRK A;  2EOQ A;  5KL7 A;  2EN6 A;  4F6M A;  3EPH A;  2YSO A;  2LVH A;  2EN7 A;  2WBU A;  1G2D C;  2EPP A;  2EN8 A;  2EPU A;  2EL5 A;  2EOH A;  1NCS A;  2YTD A;  2EOS A;  2EQ0 A;  2JP9 A;  1KJK A;  2EM0 A;  2EN3 A;  2EMI A;  1Z1B A;  2EL4 A;  2YTO A;  2DLK A;  2EMZ A;  2EPC A;  3VHT B;  5KL6 A;  4IS1 C;  2MKN A;  2EM5 A;  2MKD A;  3EPK A;  1JK1 A;  5KL2 A;  2EMY A;  2YU5 A;  1A1F A;  2EM4 A;  2EM7 A;  2CSH A;  2YTE A;  5KL4 A;  2EL6 A;  2YU8 A;  2EOI A;  2EOE A;  2EOJ A;  3UK3 C;  2EPR A;  2EP3 A;  2WBS A;  4R2R A;  4FK5 C;  2R1F A;  4R2E A;  4IJD A;  4GZN C;  1AAY A;  4WSG A;  5KL3 A;  2EPA A;  1X6F A;  1WJP A;  2EMX A;  2DLQ A;  2EOX A;  2A25 A;  2HGH A;  2EM8 A;  1F2I G;  2GHF A;  1UBD C;  2EMG A;  2E72 A;  1MEY C;  2M9A A;  1UN6 B;  1JK2 A;  4X9J A;  1DGC A;  2EMA A;  2WCC 3;  4R2P A;  2ENA A;  2YRM A;  2EM9 A;  4R2Q A;  2YRH A;  2ELY A;  2EQ3 A;  1A1I A;  4M9V C;  1X6E A;  1BBO A;  2EM6 A;  2EOO A;  1TF6 A;  1YUJ A;  2DRP A;  2ENC A;  2YSP A;  1YUI A;  2YTP A;  2D9H A;  1ZAA C;  2EOR A;  5KL5 A;  2EMW A;  2RSI A;  2I13 A;  2EOY A;  2EMH A;  1A1K A;  2DGC A;  3EPJ A;  1ZR9 A;  2EQ1 A;  2EE8 A;  1A1H A;  2JPA A;  1X5W A;  2EML A;  2ENH A;  2YTN A;  2LT7 A;  1B69 A;  1P47 A;  4R2A A;  2EMK A;  2EN1 A;  1TF3 A;  2EN4 A;  2WBT A;  4F2J C;  3MHH C;  2EM2 A;  2LO3 A;  2LCE A;  1G2F C;  2EMC A;  2EOM A;  1A1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...