2WBTA

The structure of a double c2h2 zinc finger protein from a hyperthermophilic archaeal virus in the absence of dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
b'DVDSGSKKYLSNHKGIFIHVTLEELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLYRLLASKAISQFVCPLCLMPFSSSVSLKQHIRYTEHTKVCPVCKKEFTSTDSALDHVCKKHNICVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-129
publication title The Structure of a Double C2H2 Zinc Finger Protein from a Hyperthermophilic Archaeal Virus in the Absence of DNA
rcsb
source organism Sulfolobus virus 1
molecule tags Dna binding protein
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12756 zf-C2H2_2 C2H2 type zinc-finger (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbtA02
2CT1A 2YRKA 4F6NA 1RMDA 2DLQA 2E72A 5KL6A 2R1FA 2JPAA 4R2EA 2J7JA 2MDGA 1X6FA 2YU5A 4R2PA 4R2AA 4IS1C 2EOFA 1UN6B 2WCC3 2EOEA 2YTDA 4FK5C 2YTGA 2WBTA 1ZU1A 5KL3A 2EPPA 1A1LA 1YSAC 2YSPA 4R2QA 2EM2A 1UBDC 2LCEA 2MKDA 4WSGA 3M99B 1A1FA 2EMYA 4R2DA 2EPAA 1X5WA 2EN3A 1YUIA 2RSIA 1KJKA 3MHHC 2EMGA 2EQ0A 2EN1A 2LVHA 2ENAA 2CTDA 2EL5A 1G2DC 2YRHA 2EMZA 1Z1BA 2WBSA 3EPJA 2EPRA 2EQ1A 2MKNA 1F2IG 2YTJA 2GHFA 2YTNA 5KL4A 2EPCA 1B69A 2EMXA 1YUJA 2ENHA 1ZR9A 2EPXA 2EL6A 1WJPA 2EMBA 2YU8A 1AAYA 1A1KA 2EM7A 4X9JA 2EMAA 2EQ3A 1ZAAC 2CSHA 2LO3A 2EMHA 1X6HA 4R2CA 2YRMA 2YSOA 4F6MA 2DMIA 1X3CA 2ENCA 2WBUA 4F2JC 1DGCA 2EMIA 2DLKA 2ELZA 4IJDA 2M9AA 2EOSA 2LT7A 1TN9A 2EMKA 2GLIA 1NCSA 4R2SA 2EN8A 2EJ4A 2EPZA 2YTEA 3EPKA 1BB8A 2ADRA 2A25A 1LLMC 2EM6A 1JK2A 2NABA 1BBOA 2EN4A 2EMLA 1X6EA 2EOHA 2EM4A 2EOIA 2I13A 3VHTB 5KL5A 2EMFA 1MEYC 1TF3A 2YTOA 1A1GA 2RPCA 2EOQA 1G2FC 2EM9A 2HGHA 2YTQA 2EP3A 1A1HA 2EPUA 2EN7A 2EM8A 2D9HA 2BB8A 1A1IA 2EM3A 4M9VC 1JK1A 2EOMA 2EOXA 2YTFA 4GZNC 2DGCA 2EOYA 2PRTA 2JP9A 2ELYA 2EM0A 1TF6A 2EN2A 2EM5A 2LV2A 2EMCA 3MHSC 2EMWA 2EOOA 2VRDA 2EN6A 2YTIA 3EPHA 1A1JA 4R2RA 2EOZA 2YTPA 2EE8A 2DRPA 5KL7A 5KL2A 3UK3C 2EOJA 2EORA 3EPLA 1P47A 2EL4A
chains in the Genus database with same CATH superfamily
4M30A 3ADJA 2YT4A 5A6AA 4R2EA 4R8OA 2J7JA 2RTXA 2N3HA 4JI7E 2MDGA 2YU5A 1UN6B 4BHCA 3T1YE 3C4BA 4Q28A 1X49A 4F9BB 5KL3A 2YPNA 1HNXE 1MGTA 2YSPA 5AC4A 5A6KA 1GQEA 2RS7A 4TUIA 1UBDC 1IQOA 4JI8E 4DKKA 3M99B 1T4NA 4B3ME 2EMYA 1X5WA 2RSIA 2N8XA 2R76A 4ZYHA 2EN1A 2H36X 2L33A 3LMLA 2EL5A 2KOUA 2YRHA 1GTKA 4P7DA 1F2IG 1BBGA 2YTNA 2KONA 2EMXA 2DIXA 3VYXA 2EL6A 1WRJA 4LF4E 2MDRA 2YU8A 1KYQA 1AAYA 1IMUA 4X9JA 2EQ3A 4JI2E 2LO3A 4WSPA 2YRMA 4WX9A 1QU6A 4LF9E 2DLKA 2M9AA 2UU9E 2EOSA 4DMIA 4GKKE 1XMQE 2EN8A 4X65E 2EPZA 2EWLA 4JI4E 2B9DA 2LTSA 2MC6A 2JOXA 2UXCE 2EN4A 2EMLA 2NUEA 2LJUA 3C4TA 2EM4A 2L2NA 2YTOA 4KZSA 1A1GA 1G2FC 2EOQA 2L3JA 2JWOA 2EN7A 2EM8A 5AE1A 1YYWA 4JV5E 3IWDA 4WFTA 2FV4B 4DV0E 1FKAE 4DR4E 1T4LB 4HEIA 4GZNC 4MLQA 5FLXC 2Q8UA 5ADZA 4JI0E 2ELYA 1HNWE 2ZM6E 4DV3E 2LUPB 1EH6A 3J7AG 2EMCA 3K6QA 2EMWA 2LBSB 3L00A 3J80C 5IT9C 4P78A 3OTOE 2K7IA 3T1HE 5A2QC 4O24A 2EOZA 2EE8A 5KL7A 2EORA 2YRKA 2EZ6A 4JI3E 4X8WA 4F6NA 2JOBA 1IBKE 2R1FA 3BBGA 1WXRA 3AUZA 2WCC3 2YTDA 3AV0A 4FK5C 4WXDA 2WBTA 3OMLA 2B3TB 2LMZA 1YSAC 2EM2A 2JVAA 2LCEA 4L8NA 3EQ1A 4WSGA 2JY9A 2EPKX 1A1FA 4LFAE 4R2DA 2L3CA 1GZ6A 2EPAA 1UILA 5A6BA 1NEIA 1KJKA 4DV5E 1N3GA 3ZOQB 1N33E 3JU0A 5IXMB 2CTDA 2NUGA 4MLVA 1J5EE 1G2DC 1Z1BA 4DR1E 2GHFA 2B7VA 1YYOA 4LFCE 3HXLA 1YUJA 3ECRA 1ZR9A 4O4KA 1WJPA 2DB2A 2EMBA 2L6MA 2VQEE 1A1KA 5A6BD 2CSHA 1DI2A 2I9IA 2WBUA 4F2JC 4LFBE 1DGCA 2EMIA 2UUCE 2V8QB 4DV6E 2EMKA 3C6MA 2VQFE 2YTEA 1RQ0A 3EPKA 3P1XA 2ADRA 2A25A 2V88A 2EM6A 1LLMC 1BB8A 4BHBA 4DUZE 2I13A 3HTXA 5LLQA 2EMFA 1MEYC 2RS6A 1T4OA 2G7HA 2HC5A 2YTQA 4GKJE 2YZTA 1RC7A 4JI5E 1A1IA 2M4IA 1I94E 4RHBB 5BR8E 5TSEA 4F9AB 1JK1A 3JAMC 2EOXA 2YTFA 1XNQE 3FIGA 3QG5C 2EM0A 1TF6A 2EM5A 1ZBQA 2LV2A 4F9CB 4RH8A 2HHHE 1XMOE 2EOOA 1STUA 3VYYA 2EN6A 2UUBE 4O43A 2RSMA 4B3TE 2V87A 3BF2A 2HJJA 2V86A 3IWBA 2LE2A 2CT1A 4BS9A 3VK6A 5F3WA 2NA2A 3LLHA 2KHXA 4X64E 1AH5A 1X6FA 5AE2A 4R2PA 2EOFA 4LF7E 2N3GA 4LF6E 2EOEA 4N4RB 3HQ1A 5LL6R 1N32E 2F8BA 2YTGA 1ZU1A 3DJWA 4NZVA 4X66E 2EPOA 2L2MA 4LU9A 3BIDA 4M0VA 2EN3A 4GEQB 3KZYA 2EMGA 2EQ0A 2UXDE 4WYQB 1YFHA 2V89A 2EMZA 2WBSA 2DSYA 2EQ1A 4BC7A 2MKNA 2B7TA 1O0WA 2GPIA 5KL4A 1B69A 2NUFA 2RQLA 1DQ3A 3TQMA 3BGHA 2EPXA 2F4VE 1IBLE 2EM7A 2EMHA 2YSOA 2DMIA 3J81C 5AE3A 2ENCA 2FGGA 4IJDA 1EH8A 2LT7A 3F6HA 5DNYA 1TN9A 2GLIA 1FJGE 1NCSA 2BBGA 2DMYA 3HPSA 1N36E 2YWQA 2MC5A 1JK2A 1BBOA 2EOHA 1PJQA 5CFFE 2EOIA 1TF3A 2L8TA 2M7QA 2HGHA 2EPUA 1UHZA 2LUQA 2V85A 2FTXB 5A69A 3J7Yp 4ZYEA 2EPMX 4HTGA 1N34E 2EOMA 1YYKA 5IWAE 2L2KB 4OX9E 4KWYA 4DUYE 4K0KE 4R03A 2JP9A 2M1SA 2EN2A 4LTYA 4DV2E 5AASA 3MHSC 1X48A 4NXME 3ADLA 1EKZA 2JXPA 4JI6E 1XNRE 2YTIA 3EPHA 1A1JA 1IQSA 4AQYE 5T6JA 2YTPA 2ODRC 4BBYA 1X47A 3KZZA 4JYAE 3EPLA 1HNZE 1P47A 3RMPA 2L92A 2EL4A 3ADGA 1RMDA 2DLQA 2E72A 5KL6A 1YZ9A 2JPAA 4BMJA 3THOB 3THNA 1QNTA 4R2AA 4IS1C 2EPNA 2LJHA 1IBME 1YPNA 2VE7C 4KHPE 3MSWA 2EPPA 4L5NC 1A1LA 4R2QA 1PJTA 2MKDA 4WPYA 1T38A 5A6JA 3JTZA 4DV1E 1YUIA 4BC9A 3MHHC 4Q35B 1HR0E 2LVHA 2ENAA 3F6GA 3EPJA 2EPRA 2WZOA 4BCAA 2YTJA 2EPCA 4DR5E 1PKPA 2ENHA 4WXCA 1T39A 1ZAAC 2EMAA 1X6HA 4R2CA 1SR9A 4F6MA 2LTRA 4J8ZA 5LMUE 4B3SE 1X3CA 4DR3E 2JR1A 2ELZA 1L4SA 4OOGC 1SFEA 1WHQA 2V83A 4O5GA 4R2SA 5AC5A 4LF8E 2EJ4A 1WHNA 3H09A 2ODRD 2NABA 3C6KA 4X62E 2JYAA 1X6EA 4DR7E 1PJSA 3VHTB 5KL5A 2EPLX 1ZBTA 2RPCA 2UUAE 3ADIA 2EM9A 1A1HA 2EP3A 1PDAA 2D9HA 5LMNE 3IWCA 2BB8A 4YHHE 4DV4E 2EM3A 3KWRA 4M9VC 4M2ZA 2E5LE 2LRSA 4F54A 2K4VA 4YY3E 2DGCA 2EOYA 4B3RE 2PRTA 2UXBE 2E1MA 2CPNA 4ZYGA 3HPZA 4DR6E 4TUGA 3DF6A 2IHR1 1EH7A 4LF5E 2VRDA 4ZYDA 5IV8B 1J26A 4R2RA 4DR2E 4NHRA 4I8OA 2VF1A 2DRPA 3UK3C 5KL2A 2EOJA 4JI1E 4NXNE 4DV7E
chains in the Genus database with same CATH topology
2CT1A 2YRKA 4F6NA 1RMDA 2DLQA 2E72A 5KL6A 2R1FA 2JPAA 4R2EA 2J7JA 2MDGA 1X6FA 2YU5A 4R2PA 4R2AA 4IS1C 2EOFA 1UN6B 2WCC3 2EOEA 2YTDA 4FK5C 2YTGA 2WBTA 1ZU1A 5KL3A 2EPPA 1A1LA 1YSAC 2YSPA 4R2QA 2EM2A 1UBDC 2LCEA 2MKDA 4WSGA 3M99B 1A1FA 2EMYA 4R2DA 2EPAA 1X5WA 2EN3A 1YUIA 2RSIA 1KJKA 3MHHC 2EMGA 2EQ0A 2EN1A 2LVHA 2ENAA 2CTDA 2EL5A 1G2DC 2YRHA 2EMZA 1Z1BA 2WBSA 3EPJA 2EPRA 2EQ1A 2MKNA 1F2IG 2YTJA 2GHFA 2YTNA 5KL4A 2EPCA 1B69A 2EMXA 1YUJA 2ENHA 1ZR9A 2EPXA 2EL6A 1WJPA 2EMBA 2YU8A 1AAYA 1A1KA 2EM7A 4X9JA 2EMAA 2EQ3A 1ZAAC 2CSHA 2LO3A 2EMHA 1X6HA 4R2CA 2YRMA 2YSOA 4F6MA 2DMIA 1X3CA 2ENCA 2WBUA 4F2JC 1DGCA 2EMIA 2DLKA 2ELZA 4IJDA 2M9AA 2EOSA 2LT7A 1TN9A 2EMKA 2GLIA 1NCSA 4R2SA 2EN8A 2EJ4A 2EPZA 2YTEA 3EPKA 1BB8A 2ADRA 2A25A 1LLMC 2EM6A 1JK2A 2NABA 1BBOA 2EN4A 2EMLA 1X6EA 2EOHA 2EM4A 2EOIA 2I13A 3VHTB 5KL5A 2EMFA 1MEYC 1TF3A 2YTOA 1A1GA 2RPCA 2EOQA 1G2FC 2EM9A 2HGHA 2YTQA 2EP3A 1A1HA 2EPUA 2EN7A 2EM8A 2D9HA 2BB8A 1A1IA 2EM3A 4M9VC 1JK1A 2EOMA 2EOXA 2YTFA 4GZNC 2DGCA 2EOYA 2PRTA 2JP9A 2ELYA 2EM0A 1TF6A 2EN2A 2EM5A 2LV2A 2EMCA 3MHSC 2EMWA 2EOOA 2VRDA 2EN6A 2YTIA 3EPHA 1A1JA 4R2RA 2EOZA 2YTPA 2EE8A 2DRPA 5KL7A 5KL2A 3UK3C 2EOJA 2EORA 3EPLA 1P47A 2EL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT1 A;  2YRK A;  4F6N A;  1RMD A;  2DLQ A;  2E72 A;  5KL6 A;  2R1F A;  2JPA A;  4R2E A;  2J7J A;  2MDG A;  1X6F A;  2YU5 A;  4R2P A;  4R2A A;  4IS1 C;  2EOF A;  1UN6 B;  2WCC 3;  2EOE A;  2YTD A;  4FK5 C;  2YTG A;  2WBT A;  1ZU1 A;  5KL3 A;  2EPP A;  1A1L A;  1YSA C;  2YSP A;  4R2Q A;  2EM2 A;  1UBD C;  2LCE A;  2MKD A;  4WSG A;  3M99 B;  1A1F A;  2EMY A;  4R2D A;  2EPA A;  1X5W A;  2EN3 A;  1YUI A;  2RSI A;  1KJK A;  3MHH C;  2EMG A;  2EQ0 A;  2EN1 A;  2LVH A;  2ENA A;  2CTD A;  2EL5 A;  1G2D C;  2YRH A;  2EMZ A;  1Z1B A;  2WBS A;  3EPJ A;  2EPR A;  2EQ1 A;  2MKN A;  1F2I G;  2YTJ A;  2GHF A;  2YTN A;  5KL4 A;  2EPC A;  1B69 A;  2EMX A;  1YUJ A;  2ENH A;  1ZR9 A;  2EPX A;  2EL6 A;  1WJP A;  2EMB A;  2YU8 A;  1AAY A;  1A1K A;  2EM7 A;  4X9J A;  2EMA A;  2EQ3 A;  1ZAA C;  2CSH A;  2LO3 A;  2EMH A;  1X6H A;  4R2C A;  2YRM A;  2YSO A;  4F6M A;  2DMI A;  1X3C A;  2ENC A;  2WBU A;  4F2J C;  1DGC A;  2EMI A;  2DLK A;  2ELZ A;  4IJD A;  2M9A A;  2EOS A;  2LT7 A;  1TN9 A;  2EMK A;  2GLI A;  1NCS A;  4R2S A;  2EN8 A;  2EJ4 A;  2EPZ A;  2YTE A;  3EPK A;  1BB8 A;  2ADR A;  2A25 A;  1LLM C;  2EM6 A;  1JK2 A;  2NAB A;  1BBO A;  2EN4 A;  2EML A;  1X6E A;  2EOH A;  2EM4 A;  2EOI A;  2I13 A;  3VHT B;  5KL5 A;  2EMF A;  1MEY C;  1TF3 A;  2YTO A;  1A1G A;  2RPC A;  2EOQ A;  1G2F C;  2EM9 A;  2HGH A;  2YTQ A;  2EP3 A;  1A1H A;  2EPU A;  2EN7 A;  2EM8 A;  2D9H A;  2BB8 A;  1A1I A;  2EM3 A;  4M9V C;  1JK1 A;  2EOM A;  2EOX A;  2YTF A;  4GZN C;  2DGC A;  2EOY A;  2PRT A;  2JP9 A;  2ELY A;  2EM0 A;  1TF6 A;  2EN2 A;  2EM5 A;  2LV2 A;  2EMC A;  3MHS C;  2EMW A;  2EOO A;  2VRD A;  2EN6 A;  2YTI A;  3EPH A;  1A1J A;  4R2R A;  2EOZ A;  2YTP A;  2EE8 A;  2DRP A;  5KL7 A;  5KL2 A;  3UK3 C;  2EOJ A;  2EOR A;  3EPL A;  1P47 A;  2EL4 A; 
#chains in the Genus database with same CATH topology
 4M30 A;  3ADJ A;  2YT4 A;  5A6A A;  4R2E A;  4R8O A;  2J7J A;  2RTX A;  2N3H A;  4JI7 E;  2MDG A;  2YU5 A;  1UN6 B;  4BHC A;  3T1Y E;  3C4B A;  4Q28 A;  1X49 A;  4F9B B;  5KL3 A;  2YPN A;  1HNX E;  1MGT A;  2YSP A;  5AC4 A;  5A6K A;  1GQE A;  2RS7 A;  4TUI A;  1UBD C;  1IQO A;  4JI8 E;  4DKK A;  3M99 B;  1T4N A;  4B3M E;  2EMY A;  1X5W A;  2RSI A;  2N8X A;  2R76 A;  4ZYH A;  2EN1 A;  2H36 X;  2L33 A;  3LML A;  2EL5 A;  2KOU A;  2YRH A;  1GTK A;  4P7D A;  1F2I G;  1BBG A;  2YTN A;  2KON A;  2EMX A;  2DIX A;  3VYX A;  2EL6 A;  1WRJ A;  4LF4 E;  2MDR A;  2YU8 A;  1KYQ A;  1AAY A;  1IMU A;  4X9J A;  2EQ3 A;  4JI2 E;  2LO3 A;  4WSP A;  2YRM A;  4WX9 A;  1QU6 A;  4LF9 E;  2DLK A;  2M9A A;  2UU9 E;  2EOS A;  4DMI A;  4GKK E;  1XMQ E;  2EN8 A;  4X65 E;  2EPZ A;  2EWL A;  4JI4 E;  2B9D A;  2LTS A;  2MC6 A;  2JOX A;  2UXC E;  2EN4 A;  2EML A;  2NUE A;  2LJU A;  3C4T A;  2EM4 A;  2L2N A;  2YTO A;  4KZS A;  1A1G A;  1G2F C;  2EOQ A;  2L3J A;  2JWO A;  2EN7 A;  2EM8 A;  5AE1 A;  1YYW A;  4JV5 E;  3IWD A;  4WFT A;  2FV4 B;  4DV0 E;  1FKA E;  4DR4 E;  1T4L B;  4HEI A;  4GZN C;  4MLQ A;  5FLX C;  2Q8U A;  5ADZ A;  4JI0 E;  2ELY A;  1HNW E;  2ZM6 E;  4DV3 E;  2LUP B;  1EH6 A;  3J7A G;  2EMC A;  3K6Q A;  2EMW A;  2LBS B;  3L00 A;  3J80 C;  5IT9 C;  4P78 A;  3OTO E;  2K7I A;  3T1H E;  5A2Q C;  4O24 A;  2EOZ A;  2EE8 A;  5KL7 A;  2EOR A;  2YRK A;  2EZ6 A;  4JI3 E;  4X8W A;  4F6N A;  2JOB A;  1IBK E;  2R1F A;  3BBG A;  1WXR A;  3AUZ A;  2WCC 3;  2YTD A;  3AV0 A;  4FK5 C;  4WXD A;  2WBT A;  3OML A;  2B3T B;  2LMZ A;  1YSA C;  2EM2 A;  2JVA A;  2LCE A;  4L8N A;  3EQ1 A;  4WSG A;  2JY9 A;  2EPK X;  1A1F A;  4LFA E;  4R2D A;  2L3C A;  1GZ6 A;  2EPA A;  1UIL A;  5A6B A;  1NEI A;  1KJK A;  4DV5 E;  1N3G A;  3ZOQ B;  1N33 E;  3JU0 A;  5IXM B;  2CTD A;  2NUG A;  4MLV A;  1J5E E;  1G2D C;  1Z1B A;  4DR1 E;  2GHF A;  2B7V A;  1YYO A;  4LFC E;  3HXL A;  1YUJ A;  3ECR A;  1ZR9 A;  4O4K A;  1WJP A;  2DB2 A;  2EMB A;  2L6M A;  2VQE E;  1A1K A;  5A6B D;  2CSH A;  1DI2 A;  2I9I A;  2WBU A;  4F2J C;  4LFB E;  1DGC A;  2EMI A;  2UUC E;  2V8Q B;  4DV6 E;  2EMK A;  3C6M A;  2VQF E;  2YTE A;  1RQ0 A;  3EPK A;  3P1X A;  2ADR A;  2A25 A;  2V88 A;  2EM6 A;  1LLM C;  1BB8 A;  4BHB A;  4DUZ E;  2I13 A;  3HTX A;  5LLQ A;  2EMF A;  1MEY C;  2RS6 A;  1T4O A;  2G7H A;  2HC5 A;  2YTQ A;  4GKJ E;  2YZT A;  1RC7 A;  4JI5 E;  1A1I A;  2M4I A;  1I94 E;  4RHB B;  5BR8 E;  5TSE A;  4F9A B;  1JK1 A;  3JAM C;  2EOX A;  2YTF A;  1XNQ E;  3FIG A;  3QG5 C;  2EM0 A;  1TF6 A;  2EM5 A;  1ZBQ A;  2LV2 A;  4F9C B;  4RH8 A;  2HHH E;  1XMO E;  2EOO A;  1STU A;  3VYY A;  2EN6 A;  2UUB E;  4O43 A;  2RSM A;  4B3T E;  2V87 A;  3BF2 A;  2HJJ A;  2V86 A;  3IWB A;  2LE2 A;  2CT1 A;  4BS9 A;  3VK6 A;  5F3W A;  2NA2 A;  3LLH A;  2KHX A;  4X64 E;  1AH5 A;  1X6F A;  5AE2 A;  4R2P A;  2EOF A;  4LF7 E;  2N3G A;  4LF6 E;  2EOE A;  4N4R B;  3HQ1 A;  5LL6 R;  1N32 E;  2F8B A;  2YTG A;  1ZU1 A;  3DJW A;  4NZV A;  4X66 E;  2EPO A;  2L2M A;  4LU9 A;  3BID A;  4M0V A;  2EN3 A;  4GEQ B;  3KZY A;  2EMG A;  2EQ0 A;  2UXD E;  4WYQ B;  1YFH A;  2V89 A;  2EMZ A;  2WBS A;  2DSY A;  2EQ1 A;  4BC7 A;  2MKN A;  2B7T A;  1O0W A;  2GPI A;  5KL4 A;  1B69 A;  2NUF A;  2RQL A;  1DQ3 A;  3TQM A;  3BGH A;  2EPX A;  2F4V E;  1IBL E;  2EM7 A;  2EMH A;  2YSO A;  2DMI A;  3J81 C;  5AE3 A;  2ENC A;  2FGG A;  4IJD A;  1EH8 A;  2LT7 A;  3F6H A;  5DNY A;  1TN9 A;  2GLI A;  1FJG E;  1NCS A;  2BBG A;  2DMY A;  3HPS A;  1N36 E;  2YWQ A;  2MC5 A;  1JK2 A;  1BBO A;  2EOH A;  1PJQ A;  5CFF E;  2EOI A;  1TF3 A;  2L8T A;  2M7Q A;  2HGH A;  2EPU A;  1UHZ A;  2LUQ A;  2V85 A;  2FTX B;  5A69 A;  3J7Y p;  4ZYE A;  2EPM X;  4HTG A;  1N34 E;  2EOM A;  1YYK A;  5IWA E;  2L2K B;  4OX9 E;  4KWY A;  4DUY E;  4K0K E;  4R03 A;  2JP9 A;  2M1S A;  2EN2 A;  4LTY A;  4DV2 E;  5AAS A;  3MHS C;  1X48 A;  4NXM E;  3ADL A;  1EKZ A;  2JXP A;  4JI6 E;  1XNR E;  2YTI A;  3EPH A;  1A1J A;  1IQS A;  4AQY E;  5T6J A;  2YTP A;  2ODR C;  4BBY A;  1X47 A;  3KZZ A;  4JYA E;  3EPL A;  1HNZ E;  1P47 A;  3RMP A;  2L92 A;  2EL4 A;  3ADG A;  1RMD A;  2DLQ A;  2E72 A;  5KL6 A;  1YZ9 A;  2JPA A;  4BMJ A;  3THO B;  3THN A;  1QNT A;  4R2A A;  4IS1 C;  2EPN A;  2LJH A;  1IBM E;  1YPN A;  2VE7 C;  4KHP E;  3MSW A;  2EPP A;  4L5N C;  1A1L A;  4R2Q A;  1PJT A;  2MKD A;  4WPY A;  1T38 A;  5A6J A;  3JTZ A;  4DV1 E;  1YUI A;  4BC9 A;  3MHH C;  4Q35 B;  1HR0 E;  2LVH A;  2ENA A;  3F6G A;  3EPJ A;  2EPR A;  2WZO A;  4BCA A;  2YTJ A;  2EPC A;  4DR5 E;  1PKP A;  2ENH A;  4WXC A;  1T39 A;  1ZAA C;  2EMA A;  1X6H A;  4R2C A;  1SR9 A;  4F6M A;  2LTR A;  4J8Z A;  5LMU E;  4B3S E;  1X3C A;  4DR3 E;  2JR1 A;  2ELZ A;  1L4S A;  4OOG C;  1SFE A;  1WHQ A;  2V83 A;  4O5G A;  4R2S A;  5AC5 A;  4LF8 E;  2EJ4 A;  1WHN A;  3H09 A;  2ODR D;  2NAB A;  3C6K A;  4X62 E;  2JYA A;  1X6E A;  4DR7 E;  1PJS A;  3VHT B;  5KL5 A;  2EPL X;  1ZBT A;  2RPC A;  2UUA E;  3ADI A;  2EM9 A;  1A1H A;  2EP3 A;  1PDA A;  2D9H A;  5LMN E;  3IWC A;  2BB8 A;  4YHH E;  4DV4 E;  2EM3 A;  3KWR A;  4M9V C;  4M2Z A;  2E5L E;  2LRS A;  4F54 A;  2K4V A;  4YY3 E;  2DGC A;  2EOY A;  4B3R E;  2PRT A;  2UXB E;  2E1M A;  2CPN A;  4ZYG A;  3HPZ A;  4DR6 E;  4TUG A;  3DF6 A;  2IHR 1;  1EH7 A;  4LF5 E;  2VRD A;  4ZYD A;  5IV8 B;  1J26 A;  4R2R A;  4DR2 E;  4NHR A;  4I8O A;  2VF1 A;  2DRP A;  3UK3 C;  5KL2 A;  2EOJ A;  4JI1 E;  4NXN E;  4DV7 E; 
#chains in the Genus database with same CATH homology
 2CT1 A;  2YRK A;  4F6N A;  1RMD A;  2DLQ A;  2E72 A;  5KL6 A;  2R1F A;  2JPA A;  4R2E A;  2J7J A;  2MDG A;  1X6F A;  2YU5 A;  4R2P A;  4R2A A;  4IS1 C;  2EOF A;  1UN6 B;  2WCC 3;  2EOE A;  2YTD A;  4FK5 C;  2YTG A;  2WBT A;  1ZU1 A;  5KL3 A;  2EPP A;  1A1L A;  1YSA C;  2YSP A;  4R2Q A;  2EM2 A;  1UBD C;  2LCE A;  2MKD A;  4WSG A;  3M99 B;  1A1F A;  2EMY A;  4R2D A;  2EPA A;  1X5W A;  2EN3 A;  1YUI A;  2RSI A;  1KJK A;  3MHH C;  2EMG A;  2EQ0 A;  2EN1 A;  2LVH A;  2ENA A;  2CTD A;  2EL5 A;  1G2D C;  2YRH A;  2EMZ A;  1Z1B A;  2WBS A;  3EPJ A;  2EPR A;  2EQ1 A;  2MKN A;  1F2I G;  2YTJ A;  2GHF A;  2YTN A;  5KL4 A;  2EPC A;  1B69 A;  2EMX A;  1YUJ A;  2ENH A;  1ZR9 A;  2EPX A;  2EL6 A;  1WJP A;  2EMB A;  2YU8 A;  1AAY A;  1A1K A;  2EM7 A;  4X9J A;  2EMA A;  2EQ3 A;  1ZAA C;  2CSH A;  2LO3 A;  2EMH A;  1X6H A;  4R2C A;  2YRM A;  2YSO A;  4F6M A;  2DMI A;  1X3C A;  2ENC A;  2WBU A;  4F2J C;  1DGC A;  2EMI A;  2DLK A;  2ELZ A;  4IJD A;  2M9A A;  2EOS A;  2LT7 A;  1TN9 A;  2EMK A;  2GLI A;  1NCS A;  4R2S A;  2EN8 A;  2EJ4 A;  2EPZ A;  2YTE A;  3EPK A;  1BB8 A;  2ADR A;  2A25 A;  1LLM C;  2EM6 A;  1JK2 A;  2NAB A;  1BBO A;  2EN4 A;  2EML A;  1X6E A;  2EOH A;  2EM4 A;  2EOI A;  2I13 A;  3VHT B;  5KL5 A;  2EMF A;  1MEY C;  1TF3 A;  2YTO A;  1A1G A;  2RPC A;  2EOQ A;  1G2F C;  2EM9 A;  2HGH A;  2YTQ A;  2EP3 A;  1A1H A;  2EPU A;  2EN7 A;  2EM8 A;  2D9H A;  2BB8 A;  1A1I A;  2EM3 A;  4M9V C;  1JK1 A;  2EOM A;  2EOX A;  2YTF A;  4GZN C;  2DGC A;  2EOY A;  2PRT A;  2JP9 A;  2ELY A;  2EM0 A;  1TF6 A;  2EN2 A;  2EM5 A;  2LV2 A;  2EMC A;  3MHS C;  2EMW A;  2EOO A;  2VRD A;  2EN6 A;  2YTI A;  3EPH A;  1A1J A;  4R2R A;  2EOZ A;  2YTP A;  2EE8 A;  2DRP A;  5KL7 A;  5KL2 A;  3UK3 C;  2EOJ A;  2EOR A;  3EPL A;  1P47 A;  2EL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...