2WBTA

The structure of a double c2h2 zinc finger protein from a hyperthermophilic archaeal virus in the absence of dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
DVDSGSKKYLSNHKGIFIHVTLEELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLYRLLASKAISQFVCPLCLMPFSSSVSLKQHIRYTEHTKVCPVCKKEFTSTDSALDHVCKKHNICVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Double C2H2 Zinc Finger Protein from a Hyperthermophilic Archaeal Virus in the Absence of DNA
rcsb
source organism Sulfolobus virus 1
molecule tags Dna binding protein
molecule keywords B-129
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12756 zf-C2H2_2 C2H2 type zinc-finger (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbtA02
2EQ1A 1X6FA 2LVHA 1AAYA 3EPKA 2YU8A 4IS1C 1MEYC 1BBOA 2WCC3 1WJPA 1TN9A 2YTEA 1A1JA 3UK3C 4F2JC 2MKNA 2YSOA 2YTIA 2EOJA 2EMXA 2ADRA 2EN3A 4R2PA 2LV2A 1ZAAC 1G2FC 3M99B 2EMLA 3EPJA 2JPAA 2DLKA 5KL2A 2YTJA 2D9HA 1X6EA 2EMIA 2EN4A 2YTGA 1A1FA 2ENAA 2VRDA 2WBUA 2DRPA 2LO3A 1UBDC 1X6HA 4R2CA 2WBSA 2EPRA 2EN8A 2EMKA 3MHHC 2MKDA 3EPLA 2EL4A 2YTFA 2YU5A 2GHFA 2YTOA 2PRTA 2M9AA 2EPUA 2YRHA 5KL7A 2EMGA 2EORA 2ELYA 2JP9A 1ZU1A 1A1KA 4R2QA 1JK2A 2EOQA 2EM3A 1YUIA 2GLIA 2EN1A 1YUJA 2LCEA 1P47A 1G2DC 2EPZA 5KL6A 1UN6B 4FK5C 2EMAA 1Z1BA 2ELZA 4IJDA 2EMZA 1A1LA 2MDGA 2EM2A 4R2RA 3MHSC 2EN2A 3EPHA 2EE8A 1A1HA 4R2DA 1DGCA 2EPPA 2A25A 2HGHA 2EMWA 1KJKA 1X3CA 2EOXA 2EOMA 4WSGA 2EOOA 2EP3A 2YRMA 2CSHA 2EMHA 2YTDA 4R2SA 2EM0A 2EOEA 2YRKA 2EOZA 2EOIA 2EMBA 2YTQA 5KL4A 2EM4A 2EOSA 2YSPA 1B69A 4R2EA 2EPXA 2RPCA 2DGCA 1ZR9A 2DMIA 5KL5A 4R2AA 2CT1A 2EQ3A 2EN6A 2EPCA 1YSAC 1RMDA 1JK1A 5KL3A 2EJ4A 2EL5A 2EOHA 1F2IG 2RSIA 1A1GA 3VHTB 2ENCA 4M9VC 4F6NA 2EM5A 2EN7A 2LT7A 1A1IA 1TF3A 2EOFA 2R1FA 4F6MA 2CTDA 2EOYA 2EM8A 1TF6A 1BB8A 2ENHA 2EL6A 1X5WA 2DLQA 2EM6A 2EMFA 2EMYA 2EM7A 2EMCA 2EQ0A 2YTNA 4GZNC 2WBTA 2I13A 1LLMC 2YTPA 1NCSA 2BB8A 2EPAA 2J7JA 4X9JA 2EM9A 2E72A 2NABA
chains in the Genus database with same CATH superfamily
2EQ1A 1X6FA 2LVHA 3EPKA 4O24A 1TN9A 1WHQA 1GTKA 4NXME 4JI1E 4DR2E 4F2JC 4N4RB 2NUEA 2YSOA 1UILA 3ADLA 2EOJA 4BBYA 1IBME 1G2FC 3M99B 4ZYEA 2KONA 3EPJA 2JPAA 1PJQA 2YTJA 1PJTA 5ADZA 2LO3A 3HPSA 1IBLE 1X47A 2MKDA 2JXPA 3EPLA 3ADJA 1J26A 4DKKA 4LF8E 2UUCE 4O4KA 1PKPA 2PRTA 2B3TB 4K0KE 2YRHA 3QG5C 4JI7E 4HEIA 5IWAE 3JU0A 4R2QA 1JK2A 2RSMA 2EPNA 4L5NC 1YUIA 2L33A 3ADIA 1RC7A 4LFAE 3TQMA 4NHRA 4DV2E 1ZBQA 2F4VE 2VF1A 2L3JA 1IMUA 2EMAA 1YZ9A 4J8ZA 4JI5E 4WXDA 3H09A 4TUGA 3C6MA 3DJWA 1X3CA 2M1SA 1T4NA 2B7VA 1EH6A 2EOOA 2E1MA 1AH5A 2YWQA 2JWOA 4BMJA 2EOEA 2EOIA 2HC5A 5LL6R 3KWRA 2YSPA 4HTGA 4O5GA 4LF6E 2B9DA 5KL5A 3EQ1A 1EH8A 4R2AA 2V87A 5TSEA 2YT4A 2JOBA 4LF9E 2EQ3A 1JK1A 1X48A 2EOHA 2JVAA 3VHTB 4M9VC 2VE7C 4P78A 3F6HA 1KYQA 2L2MA 4X65E 2R1FA 4F6MA 2CTDA 4KHPE 2V89A 4KWYA 1PDAA 4DR6E 4P7DA 1X5WA 3K6QA 4Q35B 5A6KA 1X49A 2MC6A 2EM7A 1DQ3A 2WBTA 2F8BA 3VYYA 1LLMC 2YTPA 4B3RE 2EPAA 4X64E 1RQ0A 2LE2A 4JI6E 2YU8A 4IS1C 2N3HA 5A69A 2YTEA 2V8QB 1HNXE 2VQEE 5AE1A 2EN3A 4R2PA 2LMZA 2LV2A 5CFFE 2EMLA 1I94E 1N3GA 3L00A 2D9HA 2EN4A 1QNTA 3MSWA 1A1FA 4F9BB 2EPMX 2V85A 4WPYA 5LMUE 4R2CA 2LBSB 2EPRA 2EN8A 4M2ZA 2EMKA 3MHHC 1DI2A 3BIDA 1YYOA 2YU5A 2GHFA 4DV6E 2FGGA 2M9AA 2EPUA 2ODRC 2UU9E 4JI0E 4WFTA 2LJHA 1ZU1A 2L8TA 2LRSA 3ZOQB 2L2NA 3KZZA 1MGTA 2EN1A 2NA2A 1G2DC 2EPZA 4DV0E 2DIXA 2I9IA 2LTSA 1Z1BA 2N8XA 2KHXA 2MDGA 2FV4B 3BBGA 2EM2A 1A1LA 3J7AG 1YFHA 2H36X 3EPHA 1PJSA 4BHCA 5A2QC 4DR5E 2EOXA 3VYXA 2E5LE 3HPZA 2YPNA 1T4LB 4LF5E 2RS7A 4R2SA 1UHZA 3F6GA 4R03A 2EMBA 2EM4A 1B69A 2L3CA 3FIGA 1YYWA 1BBGA 2M4IA 1N33E 1ZR9A 2DMIA 4MLVA 4JI8E 4BC9A 2ZM6E 4DV4E 2CT1A 1YPNA 4BS9A 3BGHA 1YSAC 1GZ6A 2ENCA 2EM5A 2LTRA 2ODRD 1TF3A 4F9CB 2EOFA 2EOYA 1XNRE 2UXBE 1FJGE 2NUFA 2B7TA 2EZ6A 3LMLA 2EMFA 4X8WA 1NEIA 2EMCA 2EQ0A 2YTNA 4GZNC 1IBKE 1NCSA 4DV1E 1N34E 2E72A 1SR9A 3OMLA 1WJPA 1T38A 2CPNA 5AE2A 1YYKA 3UK3C 2R76A 1XMOE 1SFEA 1ZAAC 5KL2A 1IQSA 1X6EA 4RH8A 4LFCE 5A6JA 2VQFE 2VRDA 4DR7E 1UBDC 1X6HA 3J7Yp 4MLQA 4DV3E 3BF2A 4BCAA 2EL4A 2V86A 3J80C 2K7IA 2M7QA 2YTOA 4M30A 4BC7A 4JI4E 2NUGA 2JOXA 2EMGA 2JP9A 4ZYHA 1A1KA 2JR1A 2UUAE 5AE3A 2EOQA 2GLIA 3KZYA 4DR1E 1YUJA 2L92A 2RS6A 4LTYA 2LCEA 1P47A 5IT9C 4DUYE 3THOB 5KL6A 1UN6B 5A6AA 2EPOA 4FK5C 2IHR1 4IJDA 5DNYA 4R2RA 3MHSC 3J81C 2EN2A 2EPLX 4DMIA 2KOUA 1A1HA 1DGCA 5IXMB 2A25A 1EKZA 2MC5A 3HQ1A 2EMWA 3IWDA 1KJKA 5BR8E 5AASA 4JI2E 2EP3A 2CSHA 2JYAA 1GQEA 4L8NA 3AV0A 2YTQA 5T6JA 5LLQA 1T39A 4X62E 2EOSA 3HTXA 2EPXA 2RPCA 2DGCA 1IQOA 4LU9A 2G7HA 3OTOE 4AQYE 4Q28A 3IWCA 3ADGA 1RMDA 5KL3A 4R8OA 2EJ4A 2RSIA 5AC5A 1EH7A 3RMPA 2LUQA 3THNA 4F6NA 2EN7A 4X66E 3VK6A 1J5EE 2DMYA 1TF6A 1N32E 2GPIA 3T1YE 2UUBE 4B3TE 4B3ME 2EM6A 2EMYA 2FTXB 1WXRA 2UXDE 2J7JA 2UXCE 2EM9A 2V88A 1AAYA 1WHNA 4M0VA 1MEYC 4GKJE 2WCC3 1BBOA 4KZSA 4RHBB 1FKAE 2LUPB 1A1JA 2HHHE 2MKNA 2YTIA 5FLXC 4I8OA 2EMXA 2YZTA 2ADRA 2Q8UA 5F3WA 2EWLA 4B3SE 2JY9A 2DLKA 4WX9A 5A6BD 4DR3E 2EMIA 3HXLA 3JAMC 2YTGA 2ENAA 2DRPA 2WBUA 2WBSA 4NZVA 4JV5E 2LJUA 2MDRA 2YTFA 3C4TA 1WRJA 4GKKE 1XNQE 4O43A 4BHBA 2WZOA 5KL7A 2EORA 4NXNE 2ELYA 5LMNE 2N3GA 3AUZA 3C6KA 2EM3A 2V83A 3JTZA 1QU6A 1XMQE 4JYAE 5AC4A 4DV5E 2ELZA 2EMZA 1O0WA 4JI3E 3IWBA 4OX9E 4WYQB 2DSYA 1ZBTA 3C4BA 2EE8A 4GEQB 1N36E 4LFBE 4R2DA 2EPPA 4TUIA 2HGHA 3LLHA 2EOMA 4DUZE 3DF6A 4WSGA 1HNWE 2RQLA 4WSPA 2YRMA 2EMHA 2YTDA 2EM0A 2YRKA 2EOZA 4WXCA 4F54A 5KL4A 2EPKX 4R2EA 4LF4E 1T4OA 4YHHE 1STUA 2HJJA 4ZYGA 2L2KB 1HR0E 2EN6A 1HNZE 2EPCA 4F9AB 3T1HE 1F2IG 2EL5A 2L6MA 1A1GA 4LF7E 5IV8B 2LT7A 1A1IA 3P1XA 4YY3E 2DB2A 2EM8A 1BB8A 4DR4E 2ENHA 2RTXA 2EL6A 2BBGA 2DLQA 3ECRA 2K4VA 4DV7E 5A6BA 2I13A 1L4SA 2BB8A 4ZYDA 4X9JA 4OOGC 2NABA
chains in the Genus database with same CATH topology
2EQ1A 1X6FA 2LVHA 1AAYA 3EPKA 2YU8A 4IS1C 1MEYC 1BBOA 2WCC3 1WJPA 1TN9A 2YTEA 1A1JA 3UK3C 4F2JC 2MKNA 2YSOA 2YTIA 2EOJA 2EMXA 2ADRA 2EN3A 4R2PA 2LV2A 1ZAAC 1G2FC 3M99B 2EMLA 3EPJA 2JPAA 2DLKA 5KL2A 2YTJA 2D9HA 1X6EA 2EMIA 2EN4A 2YTGA 1A1FA 2ENAA 2VRDA 2WBUA 2DRPA 2LO3A 1UBDC 1X6HA 4R2CA 2WBSA 2EPRA 2EN8A 2EMKA 3MHHC 2MKDA 3EPLA 2EL4A 2YTFA 2YU5A 2GHFA 2YTOA 2PRTA 2M9AA 2EPUA 2YRHA 5KL7A 2EMGA 2EORA 2ELYA 2JP9A 1ZU1A 1A1KA 4R2QA 1JK2A 2EOQA 2EM3A 1YUIA 2GLIA 2EN1A 1YUJA 2LCEA 1P47A 1G2DC 2EPZA 5KL6A 1UN6B 4FK5C 2EMAA 1Z1BA 2ELZA 4IJDA 2EMZA 1A1LA 2MDGA 2EM2A 4R2RA 3MHSC 2EN2A 3EPHA 2EE8A 1A1HA 4R2DA 1DGCA 2EPPA 2A25A 2HGHA 2EMWA 1KJKA 1X3CA 2EOXA 2EOMA 4WSGA 2EOOA 2EP3A 2YRMA 2CSHA 2EMHA 2YTDA 4R2SA 2EM0A 2EOEA 2YRKA 2EOZA 2EOIA 2EMBA 2YTQA 5KL4A 2EM4A 2EOSA 2YSPA 1B69A 4R2EA 2EPXA 2RPCA 2DGCA 1ZR9A 2DMIA 5KL5A 4R2AA 2CT1A 2EQ3A 2EN6A 2EPCA 1YSAC 1RMDA 1JK1A 5KL3A 2EJ4A 2EL5A 2EOHA 1F2IG 2RSIA 1A1GA 3VHTB 2ENCA 4M9VC 4F6NA 2EM5A 2EN7A 2LT7A 1A1IA 1TF3A 2EOFA 2R1FA 4F6MA 2CTDA 2EOYA 2EM8A 1TF6A 1BB8A 2ENHA 2EL6A 1X5WA 2DLQA 2EM6A 2EMFA 2EMYA 2EM7A 2EMCA 2EQ0A 2YTNA 4GZNC 2WBTA 2I13A 1LLMC 2YTPA 1NCSA 2BB8A 2EPAA 2J7JA 4X9JA 2EM9A 2E72A 2NABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ1 A;  1X6F A;  2LVH A;  1AAY A;  3EPK A;  2YU8 A;  4IS1 C;  1MEY C;  1BBO A;  2WCC 3;  1WJP A;  1TN9 A;  2YTE A;  1A1J A;  3UK3 C;  4F2J C;  2MKN A;  2YSO A;  2YTI A;  2EOJ A;  2EMX A;  2ADR A;  2EN3 A;  4R2P A;  2LV2 A;  1ZAA C;  1G2F C;  3M99 B;  2EML A;  3EPJ A;  2JPA A;  2DLK A;  5KL2 A;  2YTJ A;  2D9H A;  1X6E A;  2EMI A;  2EN4 A;  2YTG A;  1A1F A;  2ENA A;  2VRD A;  2WBU A;  2DRP A;  2LO3 A;  1UBD C;  1X6H A;  4R2C A;  2WBS A;  2EPR A;  2EN8 A;  2EMK A;  3MHH C;  2MKD A;  3EPL A;  2EL4 A;  2YTF A;  2YU5 A;  2GHF A;  2YTO A;  2PRT A;  2M9A A;  2EPU A;  2YRH A;  5KL7 A;  2EMG A;  2EOR A;  2ELY A;  2JP9 A;  1ZU1 A;  1A1K A;  4R2Q A;  1JK2 A;  2EOQ A;  2EM3 A;  1YUI A;  2GLI A;  2EN1 A;  1YUJ A;  2LCE A;  1P47 A;  1G2D C;  2EPZ A;  5KL6 A;  1UN6 B;  4FK5 C;  2EMA A;  1Z1B A;  2ELZ A;  4IJD A;  2EMZ A;  1A1L A;  2MDG A;  2EM2 A;  4R2R A;  3MHS C;  2EN2 A;  3EPH A;  2EE8 A;  1A1H A;  4R2D A;  1DGC A;  2EPP A;  2A25 A;  2HGH A;  2EMW A;  1KJK A;  1X3C A;  2EOX A;  2EOM A;  4WSG A;  2EOO A;  2EP3 A;  2YRM A;  2CSH A;  2EMH A;  2YTD A;  4R2S A;  2EM0 A;  2EOE A;  2YRK A;  2EOZ A;  2EOI A;  2EMB A;  2YTQ A;  5KL4 A;  2EM4 A;  2EOS A;  2YSP A;  1B69 A;  4R2E A;  2EPX A;  2RPC A;  2DGC A;  1ZR9 A;  2DMI A;  5KL5 A;  4R2A A;  2CT1 A;  2EQ3 A;  2EN6 A;  2EPC A;  1YSA C;  1RMD A;  1JK1 A;  5KL3 A;  2EJ4 A;  2EL5 A;  2EOH A;  1F2I G;  2RSI A;  1A1G A;  3VHT B;  2ENC A;  4M9V C;  4F6N A;  2EM5 A;  2EN7 A;  2LT7 A;  1A1I A;  1TF3 A;  2EOF A;  2R1F A;  4F6M A;  2CTD A;  2EOY A;  2EM8 A;  1TF6 A;  1BB8 A;  2ENH A;  2EL6 A;  1X5W A;  2DLQ A;  2EM6 A;  2EMF A;  2EMY A;  2EM7 A;  2EMC A;  2EQ0 A;  2YTN A;  4GZN C;  2WBT A;  2I13 A;  1LLM C;  2YTP A;  1NCS A;  2BB8 A;  2EPA A;  2J7J A;  4X9J A;  2EM9 A;  2E72 A;  2NAB A; 
#chains in the Genus database with same CATH topology
 2EQ1 A;  1X6F A;  2LVH A;  3EPK A;  4O24 A;  1TN9 A;  1WHQ A;  1GTK A;  4NXM E;  4JI1 E;  4DR2 E;  4F2J C;  4N4R B;  2NUE A;  2YSO A;  1UIL A;  3ADL A;  2EOJ A;  4BBY A;  1IBM E;  1G2F C;  3M99 B;  4ZYE A;  2KON A;  3EPJ A;  2JPA A;  1PJQ A;  2YTJ A;  1PJT A;  5ADZ A;  2LO3 A;  3HPS A;  1IBL E;  1X47 A;  2MKD A;  2JXP A;  3EPL A;  3ADJ A;  1J26 A;  4DKK A;  4LF8 E;  2UUC E;  4O4K A;  1PKP A;  2PRT A;  2B3T B;  4K0K E;  2YRH A;  3QG5 C;  4JI7 E;  4HEI A;  5IWA E;  3JU0 A;  4R2Q A;  1JK2 A;  2RSM A;  2EPN A;  4L5N C;  1YUI A;  2L33 A;  3ADI A;  1RC7 A;  4LFA E;  3TQM A;  4NHR A;  4DV2 E;  1ZBQ A;  2F4V E;  2VF1 A;  2L3J A;  1IMU A;  2EMA A;  1YZ9 A;  4J8Z A;  4JI5 E;  4WXD A;  3H09 A;  4TUG A;  3C6M A;  3DJW A;  1X3C A;  2M1S A;  1T4N A;  2B7V A;  1EH6 A;  2EOO A;  2E1M A;  1AH5 A;  2YWQ A;  2JWO A;  4BMJ A;  2EOE A;  2EOI A;  2HC5 A;  5LL6 R;  3KWR A;  2YSP A;  4HTG A;  4O5G A;  4LF6 E;  2B9D A;  5KL5 A;  3EQ1 A;  1EH8 A;  4R2A A;  2V87 A;  5TSE A;  2YT4 A;  2JOB A;  4LF9 E;  2EQ3 A;  1JK1 A;  1X48 A;  2EOH A;  2JVA A;  3VHT B;  4M9V C;  2VE7 C;  4P78 A;  3F6H A;  1KYQ A;  2L2M A;  4X65 E;  2R1F A;  4F6M A;  2CTD A;  4KHP E;  2V89 A;  4KWY A;  1PDA A;  4DR6 E;  4P7D A;  1X5W A;  3K6Q A;  4Q35 B;  5A6K A;  1X49 A;  2MC6 A;  2EM7 A;  1DQ3 A;  2WBT A;  2F8B A;  3VYY A;  1LLM C;  2YTP A;  4B3R E;  2EPA A;  4X64 E;  1RQ0 A;  2LE2 A;  4JI6 E;  2YU8 A;  4IS1 C;  2N3H A;  5A69 A;  2YTE A;  2V8Q B;  1HNX E;  2VQE E;  5AE1 A;  2EN3 A;  4R2P A;  2LMZ A;  2LV2 A;  5CFF E;  2EML A;  1I94 E;  1N3G A;  3L00 A;  2D9H A;  2EN4 A;  1QNT A;  3MSW A;  1A1F A;  4F9B B;  2EPM X;  2V85 A;  4WPY A;  5LMU E;  4R2C A;  2LBS B;  2EPR A;  2EN8 A;  4M2Z A;  2EMK A;  3MHH C;  1DI2 A;  3BID A;  1YYO A;  2YU5 A;  2GHF A;  4DV6 E;  2FGG A;  2M9A A;  2EPU A;  2ODR C;  2UU9 E;  4JI0 E;  4WFT A;  2LJH A;  1ZU1 A;  2L8T A;  2LRS A;  3ZOQ B;  2L2N A;  3KZZ A;  1MGT A;  2EN1 A;  2NA2 A;  1G2D C;  2EPZ A;  4DV0 E;  2DIX A;  2I9I A;  2LTS A;  1Z1B A;  2N8X A;  2KHX A;  2MDG A;  2FV4 B;  3BBG A;  2EM2 A;  1A1L A;  3J7A G;  1YFH A;  2H36 X;  3EPH A;  1PJS A;  4BHC A;  5A2Q C;  4DR5 E;  2EOX A;  3VYX A;  2E5L E;  3HPZ A;  2YPN A;  1T4L B;  4LF5 E;  2RS7 A;  4R2S A;  1UHZ A;  3F6G A;  4R03 A;  2EMB A;  2EM4 A;  1B69 A;  2L3C A;  3FIG A;  1YYW A;  1BBG A;  2M4I A;  1N33 E;  1ZR9 A;  2DMI A;  4MLV A;  4JI8 E;  4BC9 A;  2ZM6 E;  4DV4 E;  2CT1 A;  1YPN A;  4BS9 A;  3BGH A;  1YSA C;  1GZ6 A;  2ENC A;  2EM5 A;  2LTR A;  2ODR D;  1TF3 A;  4F9C B;  2EOF A;  2EOY A;  1XNR E;  2UXB E;  1FJG E;  2NUF A;  2B7T A;  2EZ6 A;  3LML A;  2EMF A;  4X8W A;  1NEI A;  2EMC A;  2EQ0 A;  2YTN A;  4GZN C;  1IBK E;  1NCS A;  4DV1 E;  1N34 E;  2E72 A;  1SR9 A;  3OML A;  1WJP A;  1T38 A;  2CPN A;  5AE2 A;  1YYK A;  3UK3 C;  2R76 A;  1XMO E;  1SFE A;  1ZAA C;  5KL2 A;  1IQS A;  1X6E A;  4RH8 A;  4LFC E;  5A6J A;  2VQF E;  2VRD A;  4DR7 E;  1UBD C;  1X6H A;  3J7Y p;  4MLQ A;  4DV3 E;  3BF2 A;  4BCA A;  2EL4 A;  2V86 A;  3J80 C;  2K7I A;  2M7Q A;  2YTO A;  4M30 A;  4BC7 A;  4JI4 E;  2NUG A;  2JOX A;  2EMG A;  2JP9 A;  4ZYH A;  1A1K A;  2JR1 A;  2UUA E;  5AE3 A;  2EOQ A;  2GLI A;  3KZY A;  4DR1 E;  1YUJ A;  2L92 A;  2RS6 A;  4LTY A;  2LCE A;  1P47 A;  5IT9 C;  4DUY E;  3THO B;  5KL6 A;  1UN6 B;  5A6A A;  2EPO A;  4FK5 C;  2IHR 1;  4IJD A;  5DNY A;  4R2R A;  3MHS C;  3J81 C;  2EN2 A;  2EPL X;  4DMI A;  2KOU A;  1A1H A;  1DGC A;  5IXM B;  2A25 A;  1EKZ A;  2MC5 A;  3HQ1 A;  2EMW A;  3IWD A;  1KJK A;  5BR8 E;  5AAS A;  4JI2 E;  2EP3 A;  2CSH A;  2JYA A;  1GQE A;  4L8N A;  3AV0 A;  2YTQ A;  5T6J A;  5LLQ A;  1T39 A;  4X62 E;  2EOS A;  3HTX A;  2EPX A;  2RPC A;  2DGC A;  1IQO A;  4LU9 A;  2G7H A;  3OTO E;  4AQY E;  4Q28 A;  3IWC A;  3ADG A;  1RMD A;  5KL3 A;  4R8O A;  2EJ4 A;  2RSI A;  5AC5 A;  1EH7 A;  3RMP A;  2LUQ A;  3THN A;  4F6N A;  2EN7 A;  4X66 E;  3VK6 A;  1J5E E;  2DMY A;  1TF6 A;  1N32 E;  2GPI A;  3T1Y E;  2UUB E;  4B3T E;  4B3M E;  2EM6 A;  2EMY A;  2FTX B;  1WXR A;  2UXD E;  2J7J A;  2UXC E;  2EM9 A;  2V88 A;  1AAY A;  1WHN A;  4M0V A;  1MEY C;  4GKJ E;  2WCC 3;  1BBO A;  4KZS A;  4RHB B;  1FKA E;  2LUP B;  1A1J A;  2HHH E;  2MKN A;  2YTI A;  5FLX C;  4I8O A;  2EMX A;  2YZT A;  2ADR A;  2Q8U A;  5F3W A;  2EWL A;  4B3S E;  2JY9 A;  2DLK A;  4WX9 A;  5A6B D;  4DR3 E;  2EMI A;  3HXL A;  3JAM C;  2YTG A;  2ENA A;  2DRP A;  2WBU A;  2WBS A;  4NZV A;  4JV5 E;  2LJU A;  2MDR A;  2YTF A;  3C4T A;  1WRJ A;  4GKK E;  1XNQ E;  4O43 A;  4BHB A;  2WZO A;  5KL7 A;  2EOR A;  4NXN E;  2ELY A;  5LMN E;  2N3G A;  3AUZ A;  3C6K A;  2EM3 A;  2V83 A;  3JTZ A;  1QU6 A;  1XMQ E;  4JYA E;  5AC4 A;  4DV5 E;  2ELZ A;  2EMZ A;  1O0W A;  4JI3 E;  3IWB A;  4OX9 E;  4WYQ B;  2DSY A;  1ZBT A;  3C4B A;  2EE8 A;  4GEQ B;  1N36 E;  4LFB E;  4R2D A;  2EPP A;  4TUI A;  2HGH A;  3LLH A;  2EOM A;  4DUZ E;  3DF6 A;  4WSG A;  1HNW E;  2RQL A;  4WSP A;  2YRM A;  2EMH A;  2YTD A;  2EM0 A;  2YRK A;  2EOZ A;  4WXC A;  4F54 A;  5KL4 A;  2EPK X;  4R2E A;  4LF4 E;  1T4O A;  4YHH E;  1STU A;  2HJJ A;  4ZYG A;  2L2K B;  1HR0 E;  2EN6 A;  1HNZ E;  2EPC A;  4F9A B;  3T1H E;  1F2I G;  2EL5 A;  2L6M A;  1A1G A;  4LF7 E;  5IV8 B;  2LT7 A;  1A1I A;  3P1X A;  4YY3 E;  2DB2 A;  2EM8 A;  1BB8 A;  4DR4 E;  2ENH A;  2RTX A;  2EL6 A;  2BBG A;  2DLQ A;  3ECR A;  2K4V A;  4DV7 E;  5A6B A;  2I13 A;  1L4S A;  2BB8 A;  4ZYD A;  4X9J A;  4OOG C;  2NAB A; 
#chains in the Genus database with same CATH homology
 2EQ1 A;  1X6F A;  2LVH A;  1AAY A;  3EPK A;  2YU8 A;  4IS1 C;  1MEY C;  1BBO A;  2WCC 3;  1WJP A;  1TN9 A;  2YTE A;  1A1J A;  3UK3 C;  4F2J C;  2MKN A;  2YSO A;  2YTI A;  2EOJ A;  2EMX A;  2ADR A;  2EN3 A;  4R2P A;  2LV2 A;  1ZAA C;  1G2F C;  3M99 B;  2EML A;  3EPJ A;  2JPA A;  2DLK A;  5KL2 A;  2YTJ A;  2D9H A;  1X6E A;  2EMI A;  2EN4 A;  2YTG A;  1A1F A;  2ENA A;  2VRD A;  2WBU A;  2DRP A;  2LO3 A;  1UBD C;  1X6H A;  4R2C A;  2WBS A;  2EPR A;  2EN8 A;  2EMK A;  3MHH C;  2MKD A;  3EPL A;  2EL4 A;  2YTF A;  2YU5 A;  2GHF A;  2YTO A;  2PRT A;  2M9A A;  2EPU A;  2YRH A;  5KL7 A;  2EMG A;  2EOR A;  2ELY A;  2JP9 A;  1ZU1 A;  1A1K A;  4R2Q A;  1JK2 A;  2EOQ A;  2EM3 A;  1YUI A;  2GLI A;  2EN1 A;  1YUJ A;  2LCE A;  1P47 A;  1G2D C;  2EPZ A;  5KL6 A;  1UN6 B;  4FK5 C;  2EMA A;  1Z1B A;  2ELZ A;  4IJD A;  2EMZ A;  1A1L A;  2MDG A;  2EM2 A;  4R2R A;  3MHS C;  2EN2 A;  3EPH A;  2EE8 A;  1A1H A;  4R2D A;  1DGC A;  2EPP A;  2A25 A;  2HGH A;  2EMW A;  1KJK A;  1X3C A;  2EOX A;  2EOM A;  4WSG A;  2EOO A;  2EP3 A;  2YRM A;  2CSH A;  2EMH A;  2YTD A;  4R2S A;  2EM0 A;  2EOE A;  2YRK A;  2EOZ A;  2EOI A;  2EMB A;  2YTQ A;  5KL4 A;  2EM4 A;  2EOS A;  2YSP A;  1B69 A;  4R2E A;  2EPX A;  2RPC A;  2DGC A;  1ZR9 A;  2DMI A;  5KL5 A;  4R2A A;  2CT1 A;  2EQ3 A;  2EN6 A;  2EPC A;  1YSA C;  1RMD A;  1JK1 A;  5KL3 A;  2EJ4 A;  2EL5 A;  2EOH A;  1F2I G;  2RSI A;  1A1G A;  3VHT B;  2ENC A;  4M9V C;  4F6N A;  2EM5 A;  2EN7 A;  2LT7 A;  1A1I A;  1TF3 A;  2EOF A;  2R1F A;  4F6M A;  2CTD A;  2EOY A;  2EM8 A;  1TF6 A;  1BB8 A;  2ENH A;  2EL6 A;  1X5W A;  2DLQ A;  2EM6 A;  2EMF A;  2EMY A;  2EM7 A;  2EMC A;  2EQ0 A;  2YTN A;  4GZN C;  2WBT A;  2I13 A;  1LLM C;  2YTP A;  1NCS A;  2BB8 A;  2EPA A;  2J7J A;  4X9J A;  2EM9 A;  2E72 A;  2NAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...