2WBTA

The structure of a double c2h2 zinc finger protein from a hyperthermophilic archaeal virus in the absence of dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
DVDSGSKKYLSNHKGIFIHVTLEELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLYRLLASKAISQFVCPLCLMPFSSSVSLKQHIRYTEHTKVCPVCKKEFTSTDSALDHVCKKHNICVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-129
publication title The Structure of a Double C2H2 Zinc Finger Protein from a Hyperthermophilic Archaeal Virus in the Absence of DNA
rcsb
source organism Sulfolobus virus 1
molecule tags Dna binding protein
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12756 zf-C2H2_2 C2H2 type zinc-finger (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbtA02
2EPZA 2EN6A 1YUIA 2EN8A 2EPRA 2EM6A 2YTQA 2WCC3 2LO3A 2WBTA 2YTDA 1UBDC 1UN6B 2EMHA 2YU8A 2EMBA 1Z1BA 2EMIA 1A1HA 1AAYA 1TF6A 3EPJA 1X6EA 2YTEA 1DGCA 4R2CA 2EMYA 2YTNA 2MKNA 2JPAA 3M99B 3VHTB 2EMKA 2EN4A 2HGHA 2EQ1A 2WBUA 4M9VC 2EM4A 2YTFA 2EPXA 2WBSA 4F6NA 2DLKA 2EL6A 2EMFA 2EOHA 2EM2A 2ELYA 2MDGA 2ENAA 4FK5C 2LT7A 1JK1A 2GHFA 1X3CA 2YU5A 2EJ4A 2EL5A 1G2FC 2ENHA 2EPUA 5KL7A 4R2PA 2EQ3A 5KL2A 3EPHA 2EOQA 2EM9A 1ZAAC 4R2DA 2EM5A 2JP9A 1B69A 1ZR9A 2EN7A 3MHSC 2J7JA 3UK3C 2EOSA 2EMCA 2EOZA 2EPAA 1X6FA 1ZU1A 1JK2A 2DRPA 2CT1A 2EMAA 2ELZA 1A1IA 2EMGA 1TF3A 2EM8A 2EOEA 2EORA 2R1FA 2RSIA 4WSGA 1G2DC 1BBOA 2PRTA 2YSPA 2BB8A 2EMZA 2EQ0A 4R2EA 2YTGA 2DLQA 4GZNC 2EM0A 2VRDA 3EPKA 2E72A 4R2RA 2EOYA 3MHHC 1A1KA 2YSOA 2EPCA 1P47A 2YTPA 4R2QA 1LLMC 2EN1A 1KJKA 2YRKA 2D9HA 2NABA 2YTOA 5KL4A 2EOMA 1MEYC 1X5WA 2EN2A 2YTIA 2ADRA 2EP3A 4R2SA 2YTJA 2I13A 1BB8A 2EMWA 2EOJA 2EOXA 2RPCA 5KL6A 2GLIA 1A1GA 1F2IG 1YSAC 2EM3A 2M9AA 2EOIA 2DGCA 2LV2A 2EMLA 1A1LA 2EN3A 2EPPA 5KL3A 1RMDA 3EPLA 2EOOA 1A1JA 2EL4A 2LVHA 1TN9A 2EM7A 4F2JC 1X6HA 2LCEA 2ENCA 2YRHA 2EMXA 2EE8A 2YRMA 4IJDA 1YUJA 1A1FA 2EOFA 1NCSA 2DMIA 4X9JA 1WJPA 4R2AA 2CSHA 5KL5A 2A25A 2MKDA 4F6MA 4IS1C 2CTDA
chains in the Genus database with same CATH superfamily
2KOUA 5A6KA 2I9IA 2YTQA 4ZYHA 3HPZA 1ZBQA 1Z1BA 4I8OA 1TF6A 4OX9E 4DUZE 3THOB 4ZYEA 1EH7A 1DGCA 1IBKE 2MKNA 3IWDA 3C4TA 2UXDE 2V8QB 3DF6A 4DR1E 5AC5A 2EOHA 2N3HA 4X65E 2ENAA 3ADIA 4HEIA 3C4BA 2LT7A 4BBYA 3J80C 2EPMX 2B7TA 4DKKA 4DR4E 3J7AG 1DI2A 3OTOE 4BC7A 2EQ3A 2LUPB 2B9DA 4DV0E 4B3SE 5KL2A 4HTGA 2UUAE 2NA2A 1B69A 2LTRA 2EN7A 4F9BB 1X47A 2FGGA 4ZYGA 4M0VA 4LF8E 2RS7A 2EMCA 2EPAA 2L2MA 4JI8E 1X6FA 1ZU1A 4DR3E 3T1YE 2LTSA 2ELZA 2EMGA 2ZM6E 2EOEA 2R1FA 2IHR1 3QG5C 1IMUA 1BBOA 5LLQA 2BB8A 4N4RB 3BGHA 3T1HE 4P7DA 1WRJA 1SR9A 2N8XA 5AE3A 2E72A 4X66E 5CFFE 1STUA 2EOYA 4L8NA 1P47A 1LLMC 2JYAA 2YRKA 2D9HA 4L5NC 4JYAE 1EKZA 1QU6A 1PKPA 5IT9C 1YZ9A 4ZYDA 2JR1A 3KZZA 4JI2E 2I13A 1L4SA 4DR5E 3C6MA 4F9AB 2ODRD 1N36E 2EM3A 3ADGA 4RHBB 1HNXE 4JI5E 1PDAA 2NUFA 2YZTA 3HPSA 5KL3A 3J81C 3C6KA 2EL4A 2VQFE 2LVHA 1TN9A 2NUGA 2EM7A 3VK6A 3ZOQB 4F2JC 1YYKA 2VE7C 2YRHA 4IJDA 2V85A 5A6BA 3LLHA 1NCSA 3IWCA 4X9JA 4J8ZA 3OMLA 1EH8A 5IV8B 4B3ME 4IS1C 4GEQB 2ODRC 2M7QA 2EPZA 3ADLA 4O43A 5LMNE 2EN8A 3F6GA 2WCC3 1UBDC 3FIGA 5A6JA 2EMBA 2EMIA 3AUZA 1AAYA 5FLXC 1UHZA 2EPNA 2YTEA 4LTYA 3P1XA 2EMYA 2YTNA 2EPOA 2L6MA 2JPAA 3VHTB 2EMKA 1J5EE 2L3CA 2WBUA 2JOBA 4B3TE 2JY9A 2EL6A 4F6NA 1BBGA 3BF2A 2EM2A 2E5LE 2L8TA 4MLQA 2N3GA 3JU0A 4Q28A 1X3CA 2EL5A 4JV5E 1ZBTA 1DQ3A 2EOQA 3AV0A 1ZAAC 3J7Yp 2JP9A 3HXLA 3MSWA 3MHSC 2LMZA 1NEIA 1RC7A 4WXCA 3DJWA 4KWYA 2HHHE 1MGTA 3JAMC 2NUEA 2EMAA 1A1IA 2EORA 3RMPA 2RSMA 2YSPA 5ADZA 2EMZA 4R2EA 2YTGA 2DLQA 4JI7E 2VRDA 4DUYE 1IQSA 4DV5E 1FJGE 3L00A 2LBSB 1XMOE 4F9CB 4R2RA 4LFAE 1A1KA 1KJKA 4R2QA 5IWAE 2UXBE 5T6JA 1X5WA 5DNYA 5A6BD 2JVAA 2EP3A 4BHCA 2YTJA 2Q8UA 3KZYA 1A1GA 1FKAE 1F2IG 2FV4B 4WPYA 2RS6A 2UUBE 4LF7E 4LF4E 1N32E 1O0WA 3THNA 1A1LA 2RQLA 4JI0E 1RMDA 3EPLA 4X8WA 1A1JA 4WX9A 5AASA 2KHXA 1X6HA 2LCEA 1YUJA 5A2QC 4K0KE 2EOFA 2R76A 1WJPA 2V88A 1HR0E 1GTKA 2CSHA 2MC5A 2MKDA 4BC9A 1KYQA 4LFBE 2EPRA 4KHPE 4JI3E 2BBGA 2WBTA 4TUIA 2YTDA 2YWQA 2EMHA 2YU8A 3HQ1A 2L2NA 2EZ6A 2CPNA 4R2CA 4NXME 2JXPA 4LFCE 3M99B 2HGHA 4M9VC 1T4NA 1XNRE 2EMFA 3VYYA 2ELYA 4KZSA 4GKJE 1T39A 4DV4E 1JK1A 3HTXA 2EJ4A 1G2FC 1T4LB 1XNQE 2ENHA 2EPUA 5KL7A 4O4KA 1X49A 2EM9A 4R2DA 2EM5A 1ZR9A 3UK3C 1WXRA 4DV7E 4M30A 4NXNE 3JTZA 2EOSA 2EOZA 1QNTA 1JK2A 2L2KB 2CT1A 2DSYA 1TF3A 2EM8A 2RSIA 3LMLA 4WSGA 4P78A 1IQOA 1G2DC 4WYQB 2PRTA 3F6HA 2EWLA 2FTXB 4GZNC 2EM0A 4BCAA 3BBGA 3TQMA 4TUGA 4DR6E 1YYWA 2L3JA 1IBME 2YSOA 2EPCA 2YTPA 1SFEA 2JOXA 2NABA 4DV2E 2EPKX 2LJHA 2M1SA 2EOMA 2K4VA 2YTIA 4R2SA 2HJJA 2EOJA 2EOXA 2EPLX 2RPCA 5A69A 5KL6A 2DGCA 2L33A 2LV2A 5A6AA 2EPPA 1N34E 3IWBA 1XMQE 2EOOA 2M4IA 2F4VE 2UUCE 4LU9A 2LUQA 2YRMA 4DV1E 3BIDA 4WSPA 1A1FA 2JWOA 2H36X 1N3GA 2DMIA 4DV6E 3ECRA 2K7IA 3VYXA 5KL5A 1A1HA 2VF1A 4R03A 2F8BA 4O24A 2EN6A 1YUIA 2EM6A 2UU9E 2LO3A 5AC4A 1UN6B 2V89A 1PJQA 3EPJA 1X6EA 4JI4E 1EH6A 1RQ0A 1I94E 4BS9A 2RTXA 1YYOA 2EN4A 4WFTA 1X48A 2EQ1A 2EM4A 2YTFA 1WHNA 2EPXA 2WBSA 2DLKA 3K6QA 2MDRA 1YFHA 2MDGA 4DV3E 4FK5C 1WHQA 2DIXA 2LJUA 2UXCE 2GHFA 2YU5A 2GPIA 2G7HA 4R2PA 4M2ZA 1HNZE 3EPHA 1J26A 5TSEA 2YPNA 4AQYE 3EQ1A 2J7JA 5BR8E 2YT4A 1YPNA 2WZOA 4R8OA 4JI1E 4F54A 4X64E 4LF5E 2DRPA 2DMYA 1UILA 2LE2A 2L92A 5IXMB 2V87A 4LF6E 5AE1A 4NZVA 4RH8A 5AE2A 2B3TB 2EQ0A 1GZ6A 1PJTA 1GQEA 2KONA 3EPKA 4X62E 5LL6R 3MHHC 4GKKE 2EN1A 5LMUE 2YTOA 5KL4A 1MEYC 2EN2A 2V86A 2ADRA 4JI6E 4DMIA 1N33E 2VQEE 1BB8A 3H09A 2EMWA 4O5GA 4Q35B 2GLIA 2E1MA 1YSAC 1IBLE 2M9AA 2EOIA 2HC5A 4MLVA 4YHHE 4B3RE 4BHBA 2LRSA 2EMLA 2V83A 4LF9E 2EN3A 3ADJA 4BMJA 1HNWE 4OOGC 1T38A 4DR7E 3KWRA 2ENCA 2EMXA 2EE8A 2DB2A 1AH5A 4DR2E 5F3WA 1PJSA 2MC6A 4YY3E 4NHRA 4R2AA 2A25A 2B7VA 4F6MA 4WXDA 2CTDA 1T4OA
chains in the Genus database with same CATH topology
2EPZA 2EN6A 1YUIA 2EN8A 2EPRA 2EM6A 2YTQA 2WCC3 2LO3A 2WBTA 2YTDA 1UBDC 1UN6B 2EMHA 2YU8A 2EMBA 1Z1BA 2EMIA 1A1HA 1AAYA 1TF6A 3EPJA 1X6EA 2YTEA 1DGCA 4R2CA 2EMYA 2YTNA 2MKNA 2JPAA 3M99B 3VHTB 2EMKA 2EN4A 2HGHA 2EQ1A 2WBUA 4M9VC 2EM4A 2YTFA 2EPXA 2WBSA 4F6NA 2DLKA 2EL6A 2EMFA 2EOHA 2EM2A 2ELYA 2MDGA 2ENAA 4FK5C 2LT7A 1JK1A 2GHFA 1X3CA 2YU5A 2EJ4A 2EL5A 1G2FC 2ENHA 2EPUA 5KL7A 4R2PA 2EQ3A 5KL2A 3EPHA 2EOQA 2EM9A 1ZAAC 4R2DA 2EM5A 2JP9A 1B69A 1ZR9A 2EN7A 3MHSC 2J7JA 3UK3C 2EOSA 2EMCA 2EOZA 2EPAA 1X6FA 1ZU1A 1JK2A 2DRPA 2CT1A 2EMAA 2ELZA 1A1IA 2EMGA 1TF3A 2EM8A 2EOEA 2EORA 2R1FA 2RSIA 4WSGA 1G2DC 1BBOA 2PRTA 2YSPA 2BB8A 2EMZA 2EQ0A 4R2EA 2YTGA 2DLQA 4GZNC 2EM0A 2VRDA 3EPKA 2E72A 4R2RA 2EOYA 3MHHC 1A1KA 2YSOA 2EPCA 1P47A 2YTPA 4R2QA 1LLMC 2EN1A 1KJKA 2YRKA 2D9HA 2NABA 2YTOA 5KL4A 2EOMA 1MEYC 1X5WA 2EN2A 2YTIA 2ADRA 2EP3A 4R2SA 2YTJA 2I13A 1BB8A 2EMWA 2EOJA 2EOXA 2RPCA 5KL6A 2GLIA 1A1GA 1F2IG 1YSAC 2EM3A 2M9AA 2EOIA 2DGCA 2LV2A 2EMLA 1A1LA 2EN3A 2EPPA 5KL3A 1RMDA 3EPLA 2EOOA 1A1JA 2EL4A 2LVHA 1TN9A 2EM7A 4F2JC 1X6HA 2LCEA 2ENCA 2YRHA 2EMXA 2EE8A 2YRMA 4IJDA 1YUJA 1A1FA 2EOFA 1NCSA 2DMIA 4X9JA 1WJPA 4R2AA 2CSHA 5KL5A 2A25A 2MKDA 4F6MA 4IS1C 2CTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPZ A;  2EN6 A;  1YUI A;  2EN8 A;  2EPR A;  2EM6 A;  2YTQ A;  2WCC 3;  2LO3 A;  2WBT A;  2YTD A;  1UBD C;  1UN6 B;  2EMH A;  2YU8 A;  2EMB A;  1Z1B A;  2EMI A;  1A1H A;  1AAY A;  1TF6 A;  3EPJ A;  1X6E A;  2YTE A;  1DGC A;  4R2C A;  2EMY A;  2YTN A;  2MKN A;  2JPA A;  3M99 B;  3VHT B;  2EMK A;  2EN4 A;  2HGH A;  2EQ1 A;  2WBU A;  4M9V C;  2EM4 A;  2YTF A;  2EPX A;  2WBS A;  4F6N A;  2DLK A;  2EL6 A;  2EMF A;  2EOH A;  2EM2 A;  2ELY A;  2MDG A;  2ENA A;  4FK5 C;  2LT7 A;  1JK1 A;  2GHF A;  1X3C A;  2YU5 A;  2EJ4 A;  2EL5 A;  1G2F C;  2ENH A;  2EPU A;  5KL7 A;  4R2P A;  2EQ3 A;  5KL2 A;  3EPH A;  2EOQ A;  2EM9 A;  1ZAA C;  4R2D A;  2EM5 A;  2JP9 A;  1B69 A;  1ZR9 A;  2EN7 A;  3MHS C;  2J7J A;  3UK3 C;  2EOS A;  2EMC A;  2EOZ A;  2EPA A;  1X6F A;  1ZU1 A;  1JK2 A;  2DRP A;  2CT1 A;  2EMA A;  2ELZ A;  1A1I A;  2EMG A;  1TF3 A;  2EM8 A;  2EOE A;  2EOR A;  2R1F A;  2RSI A;  4WSG A;  1G2D C;  1BBO A;  2PRT A;  2YSP A;  2BB8 A;  2EMZ A;  2EQ0 A;  4R2E A;  2YTG A;  2DLQ A;  4GZN C;  2EM0 A;  2VRD A;  3EPK A;  2E72 A;  4R2R A;  2EOY A;  3MHH C;  1A1K A;  2YSO A;  2EPC A;  1P47 A;  2YTP A;  4R2Q A;  1LLM C;  2EN1 A;  1KJK A;  2YRK A;  2D9H A;  2NAB A;  2YTO A;  5KL4 A;  2EOM A;  1MEY C;  1X5W A;  2EN2 A;  2YTI A;  2ADR A;  2EP3 A;  4R2S A;  2YTJ A;  2I13 A;  1BB8 A;  2EMW A;  2EOJ A;  2EOX A;  2RPC A;  5KL6 A;  2GLI A;  1A1G A;  1F2I G;  1YSA C;  2EM3 A;  2M9A A;  2EOI A;  2DGC A;  2LV2 A;  2EML A;  1A1L A;  2EN3 A;  2EPP A;  5KL3 A;  1RMD A;  3EPL A;  2EOO A;  1A1J A;  2EL4 A;  2LVH A;  1TN9 A;  2EM7 A;  4F2J C;  1X6H A;  2LCE A;  2ENC A;  2YRH A;  2EMX A;  2EE8 A;  2YRM A;  4IJD A;  1YUJ A;  1A1F A;  2EOF A;  1NCS A;  2DMI A;  4X9J A;  1WJP A;  4R2A A;  2CSH A;  5KL5 A;  2A25 A;  2MKD A;  4F6M A;  4IS1 C;  2CTD A; 
#chains in the Genus database with same CATH topology
 2KOU A;  5A6K A;  2I9I A;  2YTQ A;  4ZYH A;  3HPZ A;  1ZBQ A;  1Z1B A;  4I8O A;  1TF6 A;  4OX9 E;  4DUZ E;  3THO B;  4ZYE A;  1EH7 A;  1DGC A;  1IBK E;  2MKN A;  3IWD A;  3C4T A;  2UXD E;  2V8Q B;  3DF6 A;  4DR1 E;  5AC5 A;  2EOH A;  2N3H A;  4X65 E;  2ENA A;  3ADI A;  4HEI A;  3C4B A;  2LT7 A;  4BBY A;  3J80 C;  2EPM X;  2B7T A;  4DKK A;  4DR4 E;  3J7A G;  1DI2 A;  3OTO E;  4BC7 A;  2EQ3 A;  2LUP B;  2B9D A;  4DV0 E;  4B3S E;  5KL2 A;  4HTG A;  2UUA E;  2NA2 A;  1B69 A;  2LTR A;  2EN7 A;  4F9B B;  1X47 A;  2FGG A;  4ZYG A;  4M0V A;  4LF8 E;  2RS7 A;  2EMC A;  2EPA A;  2L2M A;  4JI8 E;  1X6F A;  1ZU1 A;  4DR3 E;  3T1Y E;  2LTS A;  2ELZ A;  2EMG A;  2ZM6 E;  2EOE A;  2R1F A;  2IHR 1;  3QG5 C;  1IMU A;  1BBO A;  5LLQ A;  2BB8 A;  4N4R B;  3BGH A;  3T1H E;  4P7D A;  1WRJ A;  1SR9 A;  2N8X A;  5AE3 A;  2E72 A;  4X66 E;  5CFF E;  1STU A;  2EOY A;  4L8N A;  1P47 A;  1LLM C;  2JYA A;  2YRK A;  2D9H A;  4L5N C;  4JYA E;  1EKZ A;  1QU6 A;  1PKP A;  5IT9 C;  1YZ9 A;  4ZYD A;  2JR1 A;  3KZZ A;  4JI2 E;  2I13 A;  1L4S A;  4DR5 E;  3C6M A;  4F9A B;  2ODR D;  1N36 E;  2EM3 A;  3ADG A;  4RHB B;  1HNX E;  4JI5 E;  1PDA A;  2NUF A;  2YZT A;  3HPS A;  5KL3 A;  3J81 C;  3C6K A;  2EL4 A;  2VQF E;  2LVH A;  1TN9 A;  2NUG A;  2EM7 A;  3VK6 A;  3ZOQ B;  4F2J C;  1YYK A;  2VE7 C;  2YRH A;  4IJD A;  2V85 A;  5A6B A;  3LLH A;  1NCS A;  3IWC A;  4X9J A;  4J8Z A;  3OML A;  1EH8 A;  5IV8 B;  4B3M E;  4IS1 C;  4GEQ B;  2ODR C;  2M7Q A;  2EPZ A;  3ADL A;  4O43 A;  5LMN E;  2EN8 A;  3F6G A;  2WCC 3;  1UBD C;  3FIG A;  5A6J A;  2EMB A;  2EMI A;  3AUZ A;  1AAY A;  5FLX C;  1UHZ A;  2EPN A;  2YTE A;  4LTY A;  3P1X A;  2EMY A;  2YTN A;  2EPO A;  2L6M A;  2JPA A;  3VHT B;  2EMK A;  1J5E E;  2L3C A;  2WBU A;  2JOB A;  4B3T E;  2JY9 A;  2EL6 A;  4F6N A;  1BBG A;  3BF2 A;  2EM2 A;  2E5L E;  2L8T A;  4MLQ A;  2N3G A;  3JU0 A;  4Q28 A;  1X3C A;  2EL5 A;  4JV5 E;  1ZBT A;  1DQ3 A;  2EOQ A;  3AV0 A;  1ZAA C;  3J7Y p;  2JP9 A;  3HXL A;  3MSW A;  3MHS C;  2LMZ A;  1NEI A;  1RC7 A;  4WXC A;  3DJW A;  4KWY A;  2HHH E;  1MGT A;  3JAM C;  2NUE A;  2EMA A;  1A1I A;  2EOR A;  3RMP A;  2RSM A;  2YSP A;  5ADZ A;  2EMZ A;  4R2E A;  2YTG A;  2DLQ A;  4JI7 E;  2VRD A;  4DUY E;  1IQS A;  4DV5 E;  1FJG E;  3L00 A;  2LBS B;  1XMO E;  4F9C B;  4R2R A;  4LFA E;  1A1K A;  1KJK A;  4R2Q A;  5IWA E;  2UXB E;  5T6J A;  1X5W A;  5DNY A;  5A6B D;  2JVA A;  2EP3 A;  4BHC A;  2YTJ A;  2Q8U A;  3KZY A;  1A1G A;  1FKA E;  1F2I G;  2FV4 B;  4WPY A;  2RS6 A;  2UUB E;  4LF7 E;  4LF4 E;  1N32 E;  1O0W A;  3THN A;  1A1L A;  2RQL A;  4JI0 E;  1RMD A;  3EPL A;  4X8W A;  1A1J A;  4WX9 A;  5AAS A;  2KHX A;  1X6H A;  2LCE A;  1YUJ A;  5A2Q C;  4K0K E;  2EOF A;  2R76 A;  1WJP A;  2V88 A;  1HR0 E;  1GTK A;  2CSH A;  2MC5 A;  2MKD A;  4BC9 A;  1KYQ A;  4LFB E;  2EPR A;  4KHP E;  4JI3 E;  2BBG A;  2WBT A;  4TUI A;  2YTD A;  2YWQ A;  2EMH A;  2YU8 A;  3HQ1 A;  2L2N A;  2EZ6 A;  2CPN A;  4R2C A;  4NXM E;  2JXP A;  4LFC E;  3M99 B;  2HGH A;  4M9V C;  1T4N A;  1XNR E;  2EMF A;  3VYY A;  2ELY A;  4KZS A;  4GKJ E;  1T39 A;  4DV4 E;  1JK1 A;  3HTX A;  2EJ4 A;  1G2F C;  1T4L B;  1XNQ E;  2ENH A;  2EPU A;  5KL7 A;  4O4K A;  1X49 A;  2EM9 A;  4R2D A;  2EM5 A;  1ZR9 A;  3UK3 C;  1WXR A;  4DV7 E;  4M30 A;  4NXN E;  3JTZ A;  2EOS A;  2EOZ A;  1QNT A;  1JK2 A;  2L2K B;  2CT1 A;  2DSY A;  1TF3 A;  2EM8 A;  2RSI A;  3LML A;  4WSG A;  4P78 A;  1IQO A;  1G2D C;  4WYQ B;  2PRT A;  3F6H A;  2EWL A;  2FTX B;  4GZN C;  2EM0 A;  4BCA A;  3BBG A;  3TQM A;  4TUG A;  4DR6 E;  1YYW A;  2L3J A;  1IBM E;  2YSO A;  2EPC A;  2YTP A;  1SFE A;  2JOX A;  2NAB A;  4DV2 E;  2EPK X;  2LJH A;  2M1S A;  2EOM A;  2K4V A;  2YTI A;  4R2S A;  2HJJ A;  2EOJ A;  2EOX A;  2EPL X;  2RPC A;  5A69 A;  5KL6 A;  2DGC A;  2L33 A;  2LV2 A;  5A6A A;  2EPP A;  1N34 E;  3IWB A;  1XMQ E;  2EOO A;  2M4I A;  2F4V E;  2UUC E;  4LU9 A;  2LUQ A;  2YRM A;  4DV1 E;  3BID A;  4WSP A;  1A1F A;  2JWO A;  2H36 X;  1N3G A;  2DMI A;  4DV6 E;  3ECR A;  2K7I A;  3VYX A;  5KL5 A;  1A1H A;  2VF1 A;  4R03 A;  2F8B A;  4O24 A;  2EN6 A;  1YUI A;  2EM6 A;  2UU9 E;  2LO3 A;  5AC4 A;  1UN6 B;  2V89 A;  1PJQ A;  3EPJ A;  1X6E A;  4JI4 E;  1EH6 A;  1RQ0 A;  1I94 E;  4BS9 A;  2RTX A;  1YYO A;  2EN4 A;  4WFT A;  1X48 A;  2EQ1 A;  2EM4 A;  2YTF A;  1WHN A;  2EPX A;  2WBS A;  2DLK A;  3K6Q A;  2MDR A;  1YFH A;  2MDG A;  4DV3 E;  4FK5 C;  1WHQ A;  2DIX A;  2LJU A;  2UXC E;  2GHF A;  2YU5 A;  2GPI A;  2G7H A;  4R2P A;  4M2Z A;  1HNZ E;  3EPH A;  1J26 A;  5TSE A;  2YPN A;  4AQY E;  3EQ1 A;  2J7J A;  5BR8 E;  2YT4 A;  1YPN A;  2WZO A;  4R8O A;  4JI1 E;  4F54 A;  4X64 E;  4LF5 E;  2DRP A;  2DMY A;  1UIL A;  2LE2 A;  2L92 A;  5IXM B;  2V87 A;  4LF6 E;  5AE1 A;  4NZV A;  4RH8 A;  5AE2 A;  2B3T B;  2EQ0 A;  1GZ6 A;  1PJT A;  1GQE A;  2KON A;  3EPK A;  4X62 E;  5LL6 R;  3MHH C;  4GKK E;  2EN1 A;  5LMU E;  2YTO A;  5KL4 A;  1MEY C;  2EN2 A;  2V86 A;  2ADR A;  4JI6 E;  4DMI A;  1N33 E;  2VQE E;  1BB8 A;  3H09 A;  2EMW A;  4O5G A;  4Q35 B;  2GLI A;  2E1M A;  1YSA C;  1IBL E;  2M9A A;  2EOI A;  2HC5 A;  4MLV A;  4YHH E;  4B3R E;  4BHB A;  2LRS A;  2EML A;  2V83 A;  4LF9 E;  2EN3 A;  3ADJ A;  4BMJ A;  1HNW E;  4OOG C;  1T38 A;  4DR7 E;  3KWR A;  2ENC A;  2EMX A;  2EE8 A;  2DB2 A;  1AH5 A;  4DR2 E;  5F3W A;  1PJS A;  2MC6 A;  4YY3 E;  4NHR A;  4R2A A;  2A25 A;  2B7V A;  4F6M A;  4WXD A;  2CTD A;  1T4O A; 
#chains in the Genus database with same CATH homology
 2EPZ A;  2EN6 A;  1YUI A;  2EN8 A;  2EPR A;  2EM6 A;  2YTQ A;  2WCC 3;  2LO3 A;  2WBT A;  2YTD A;  1UBD C;  1UN6 B;  2EMH A;  2YU8 A;  2EMB A;  1Z1B A;  2EMI A;  1A1H A;  1AAY A;  1TF6 A;  3EPJ A;  1X6E A;  2YTE A;  1DGC A;  4R2C A;  2EMY A;  2YTN A;  2MKN A;  2JPA A;  3M99 B;  3VHT B;  2EMK A;  2EN4 A;  2HGH A;  2EQ1 A;  2WBU A;  4M9V C;  2EM4 A;  2YTF A;  2EPX A;  2WBS A;  4F6N A;  2DLK A;  2EL6 A;  2EMF A;  2EOH A;  2EM2 A;  2ELY A;  2MDG A;  2ENA A;  4FK5 C;  2LT7 A;  1JK1 A;  2GHF A;  1X3C A;  2YU5 A;  2EJ4 A;  2EL5 A;  1G2F C;  2ENH A;  2EPU A;  5KL7 A;  4R2P A;  2EQ3 A;  5KL2 A;  3EPH A;  2EOQ A;  2EM9 A;  1ZAA C;  4R2D A;  2EM5 A;  2JP9 A;  1B69 A;  1ZR9 A;  2EN7 A;  3MHS C;  2J7J A;  3UK3 C;  2EOS A;  2EMC A;  2EOZ A;  2EPA A;  1X6F A;  1ZU1 A;  1JK2 A;  2DRP A;  2CT1 A;  2EMA A;  2ELZ A;  1A1I A;  2EMG A;  1TF3 A;  2EM8 A;  2EOE A;  2EOR A;  2R1F A;  2RSI A;  4WSG A;  1G2D C;  1BBO A;  2PRT A;  2YSP A;  2BB8 A;  2EMZ A;  2EQ0 A;  4R2E A;  2YTG A;  2DLQ A;  4GZN C;  2EM0 A;  2VRD A;  3EPK A;  2E72 A;  4R2R A;  2EOY A;  3MHH C;  1A1K A;  2YSO A;  2EPC A;  1P47 A;  2YTP A;  4R2Q A;  1LLM C;  2EN1 A;  1KJK A;  2YRK A;  2D9H A;  2NAB A;  2YTO A;  5KL4 A;  2EOM A;  1MEY C;  1X5W A;  2EN2 A;  2YTI A;  2ADR A;  2EP3 A;  4R2S A;  2YTJ A;  2I13 A;  1BB8 A;  2EMW A;  2EOJ A;  2EOX A;  2RPC A;  5KL6 A;  2GLI A;  1A1G A;  1F2I G;  1YSA C;  2EM3 A;  2M9A A;  2EOI A;  2DGC A;  2LV2 A;  2EML A;  1A1L A;  2EN3 A;  2EPP A;  5KL3 A;  1RMD A;  3EPL A;  2EOO A;  1A1J A;  2EL4 A;  2LVH A;  1TN9 A;  2EM7 A;  4F2J C;  1X6H A;  2LCE A;  2ENC A;  2YRH A;  2EMX A;  2EE8 A;  2YRM A;  4IJD A;  1YUJ A;  1A1F A;  2EOF A;  1NCS A;  2DMI A;  4X9J A;  1WJP A;  4R2A A;  2CSH A;  5KL5 A;  2A25 A;  2MKD A;  4F6M A;  4IS1 C;  2CTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...