2LT7A

Solution nmr structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
ANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein/dna
molecule keywords Transcriptional regulator Kaiso
publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A02
1AAYA 2PRTA 3EPKA 3M99B 2EN3A 2WCC3 2EPXA 4F6NA 5KL2A 2JP9A 1RMDA 4FK5C 2WBUA 2I13A 2YTNA 2EOOA 2EMBA 2EM6A 1MEYC 2EORA 2ENHA 2J7JA 2EOXA 2EOIA 2EM5A 2CT1A 4WSGA 1A1HA 2EMIA 2EOFA 1BBOA 2EQ0A 1X3CA 2YRMA 2YTFA 1UBDC 1YUJA 4R2CA 1Z1BA 4IJDA 1JK2A 4IS1C 1X6HA 2BB8A 2ELZA 2MDGA 2ADRA 1WJPA 2EMZA 2RSIA 4R2QA 1TF6A 3MHSC 1P47A 2EN2A 2HGHA 2EPRA 2DMIA 2EN4A 1LLMC 1YSAC 1X5WA 2EM4A 2EMXA 2EOSA 1X6EA 2LT7A 2YTJA 2ELYA 2EMYA 1DGCA 2EN1A 3EPJA 1A1LA 2EOEA 2EL5A 1TN9A 4M9VC 2JPAA 2A25A 2CTDA 2EOYA 2EMCA 2EOZA 2YTQA 5KL4A 2EM8A 2YTOA 2EMKA 2EOJA 2LO3A 2YTDA 3VHTB 3EPLA 2NABA 2EMLA 1A1IA 1ZU1A 2EPPA 1A1JA 4R2RA 1A1KA 4F2JC 2R1FA 1ZR9A 2YSOA 2EN7A 1UN6B 2EPAA 2EOHA 2MKDA 1KJKA 3EPHA 1A1GA 2EOMA 2E72A 4R2EA 2EM9A 4R2PA 2EM0A 2GLIA 2EMFA 2EMAA 1F2IG 2EP3A 2YTIA 3UK3C 2YTPA 1BB8A 4R2DA 1G2DC 2YTEA 2EN6A 2YRHA 1YUIA 2CSHA 2ENCA 5KL6A 2EOQA 2YTGA 2EJ4A 2LVHA 2EN8A 4GZNC 2GHFA 2YU5A 2EMGA 2EM3A 5KL7A 1ZAAC 2RPCA 2YSPA 2MKNA 2LV2A 4R2AA 2EM2A 2M9AA 2VRDA 5KL5A 2LCEA 3MHHC 2EE8A 2EL4A 2DRPA 2EMHA 4X9JA 2EL6A 2WBSA 2ENAA 2YRKA 1G2FC 4F6MA 2EM7A 2EPCA 2D9HA 2DLQA 2WBTA 2YU8A 2EQ3A 2DLKA 1B69A 2EQ1A 1JK1A 2EMWA 4R2SA 1X6FA 1TF3A 1A1FA 2EPZA 1NCSA 5KL3A 2EPUA 2DGCA
chains in the Genus database with same CATH superfamily
1AAYA 2PRTA 4LFCE 1L4SA 1WRJA 5IXMB 4DV2E 1IBLE 2LTRA 2EN3A 2NUEA 2EPXA 2K7IA 4F6NA 5KL2A 4LF6E 2YTNA 2EOOA 2YT4A 3J7AG 2J7JA 4JI8E 5AC5A 2CT1A 1YZ9A 1BBOA 2YTFA 4GKKE 4KHPE 2N3HA 2RS7A 2EMZA 2RSIA 3C4BA 2EN2A 2HGHA 2EPRA 2EN4A 1YPNA 3JAMC 1AH5A 2LT7A 2ELYA 2Q8UA 1QU6A 1GQEA 2JY9A 4M2ZA 2EN1A 1EH6A 4HEIA 2L2MA 4P78A 2EZ6A 1TN9A 4M9VC 2JPAA 4DUYE 2EOYA 2YTOA 2EMKA 3T1HE 4JI7E 3F6HA 3VHTB 2VQFE 5DNYA 4DR6E 1A1IA 1A1JA 2EPPA 2LJUA 2UUAE 4F2JC 4DUZE 2EN7A 2EPAA 1KJKA 4NHRA 4KWYA 2RTXA 4DV7E 2EOMA 3EQ1A 3BBGA 2EM9A 4Q35B 5ADZA 2EMFA 1F2IG 2EPKX 2YTPA 4M0VA 4N4RB 4OOGC 2EN6A 4ZYEA 2YWQA 2F8BA 2UXDE 1EH7A 5AASA 1QNTA 2MC5A 4GZNC 2L2KB 2GHFA 2YU5A 2EMGA 5A6JA 1ZAAC 1T4OA 5T6JA 1MGTA 2G7HA 3JU0A 2BBGA 2I9IA 3QG5C 4WXCA 2VRDA 4KZSA 2HJJA 1J26A 4LF9E 3IWCA 4NZVA 2R76A 5AC4A 3KWRA 2EPCA 2EWLA 3T1YE 2EQ3A 1STUA 1HNXE 1JK1A 2N3GA 1T38A 3ADLA 4X62E 1WHQA 3EPHA 4B3RE 5AE3A 3MSWA 4LFBE 2WCC3 1HNWE 4LF7E 4DV1E 2EM6A 2ENHA 4BS9A 2JOBA 2ODRD 2NA2A 4L5NC 4WSGA 1SFEA 2EMIA 2EOFA 2YRMA 1X3CA 4B3SE 3RMPA 1UBDC 4TUGA 1Z1BA 1XMOE 2DSYA 4BC9A 4IJDA 4IS1C 4R2QA 2ADRA 3F6GA 3MHSC 2UU9E 2LE2A 2L2NA 1YYKA 4RHBB 1PJSA 4DR2E 1X5WA 2EMXA 2YTJA 1XMQE 4DR7E 1XNRE 1BBGA 2EMYA 4DV0E 4X66E 1DGCA 2V88A 5LMUE 2EOEA 5IV8B 1PDAA 2A25A 2CTDA 1IMUA 2YTQA 5KL4A 1XNQE 2B7VA 3KZYA 2ODRC 3HTXA 2YTDA 2JOXA 2L8TA 2N8XA 5A6KA 2B7TA 2JWOA 3P1XA 3BF2A 4DV5E 2CPNA 1A1KA 2LBSB 4BC7A 2YSOA 4O5GA 4DMIA 1UN6B 1GTKA 2MKDA 4YY3E 2E72A 2EPOA 4L8NA 4R2PA 4NXNE 2EMAA 2FTXB 4JI5E 3LMLA 2EPMX 5AE1A 2DMYA 1IQOA 2YRHA 1YUIA 2CSHA 2RS6A 1PJQA 5KL6A 2EOQA 1WXRA 2YTGA 5KL7A 2KHXA 2YSPA 2M4IA 4LF4E 3LLHA 2M9AA 2UXCE 2RQLA 4BBYA 2B3TB 4GKJE 2EMHA 1X49A 4X9JA 3C6KA 2EPLX 2KOUA 2YRKA 3ADGA 1G2FC 2YZTA 4O4KA 4F6MA 2D9HA 2DLQA 4WSPA 2HHHE 3THNA 2EMWA 4DV6E 1X6FA 1GZ6A 1A1FA 3HPSA 2EPZA 4MLQA 2H36X 4AQYE 4JI3E 3EPKA 1RQ0A 2HC5A 3M99B 1RMDA 4FK5C 2I13A 5AE2A 4JI0E 3DJWA 2EORA 2EOIA 2M1SA 2EM5A 5LL6R 1A1HA 1HR0E 4JI4E 3IWDA 4J8ZA 2BB8A 2MDGA 1WJPA 1P47A 2DMIA 3VK6A 2FGGA 4DV3E 2L3JA 4Q28A 2EM4A 1X6EA 4F9AB 4BCAA 1N36E 1A1LA 5A2QC 2EL5A 4B3TE 2EMCA 2EOZA 5IWAE 3J80C 4WX9A 2LMZA 2EOJA 3L00A 4O24A 1YYWA 4X8WA 2UXBE 4M30A 4BHBA 2VF1A 2K4VA 3EPLA 3FIGA 4R03A 4DR5E 2LJHA 2LRSA 3ADIA 1PJTA 1ZU1A 4RH8A 1X47A 1FKAE 1ZR9A 3J7Yp 1J5EE 3OMLA 2EOHA 4B3ME 4K0KE 1IBKE 4F9CB 2EM0A 4DR1E 1T4LB 3OTOE 2YTIA 3UK3C 1BB8A 2YTEA 4JI6E 2V89A 2LVHA 1IQSA 5FLXC 2WZOA 5IT9C 2RPCA 1YFHA 4LTYA 4R2AA 4TUIA 1O0WA 2NUGA 4X64E 2DRPA 2FV4B 3AUZA 4I8OA 2B9DA 3BGHA 3VYXA 2L92A 1IBME 2VE7C 1WHNA 2ENAA 2WBSA 3C6MA 4DV4E 4NXME 5A6AA 2DLKA 1B69A 1RC7A 4LU9A 2V86A 4R2SA 2E5LE 2V83A 1N33E 1NCSA 5KL3A 1KYQA 2DGCA 4F9BB 2GPIA 3VYYA 1EKZA 2KONA 5BR8E 2JP9A 2WBUA 4ZYDA 2EMBA 1MEYC 2JVAA 2EOXA 5A6BA 2RSMA 3HXLA 4DR3E 3KZZA 2EQ0A 4BMJA 3HQ1A 4P7DA 1YUJA 4DKKA 2L3CA 3IWBA 4R2CA 3J81C 1JK2A 2JXPA 1X6HA 1N3GA 2ELZA 2NUFA 1TF6A 4OX9E 3JTZA 4WXDA 1YSAC 1X48A 1LLMC 1ZBTA 2EOSA 2LUQA 2DB2A 5A6BD 2LTSA 1T4NA 3EPJA 2V87A 4JI2E 2EM8A 5CFFE 1N34E 2V8QB 2MDRA 4JYAE 3K6QA 4LFAE 4WFTA 2LO3A 1YYOA 1PKPA 1DI2A 3HPZA 2L6MA 2NABA 4DR4E 5F3WA 4ZYGA 2EMLA 4O43A 4WPYA 2EPNA 1SR9A 5A69A 3AV0A 4R2RA 2R1FA 4LF8E 4X65E 2M7QA 4GEQB 2LUPB 4LF5E 3C4TA 3ECRA 4R8OA 1A1GA 4YHHE 4R2EA 3THOB 2GLIA 1ZBQA 1NEIA 2EP3A 4WYQB 4R2DA 1G2DC 4MLVA 3DF6A 3ZOQB 1UILA 2ENCA 2MC6A 2EJ4A 2IHR1 3ADJA 5TSEA 2UUBE 2UUCE 2EN8A 1FJGE 2EM3A 2JR1A 2MKNA 2ZM6E 4BHCA 1DQ3A 2LV2A 2EM2A 2V85A 3TQMA 5KL5A 2LCEA 3MHHC 1HNZE 2EE8A 2EL4A 2YPNA 1I94E 4F54A 1N32E 2E1MA 2EL6A 2JYAA 5LMNE 2F4VE 2L33A 1EH8A 5LLQA 4JI1E 2EM7A 2WBTA 1UHZA 2YU8A 2VQEE 1T39A 4HTGA 4ZYHA 2EQ1A 4JV5E 3H09A 1TF3A 3BIDA 2DIXA 2EPUA
chains in the Genus database with same CATH topology
1AAYA 2PRTA 3EPKA 3M99B 2EN3A 2WCC3 2EPXA 4F6NA 5KL2A 2JP9A 1RMDA 4FK5C 2WBUA 2I13A 2YTNA 2EOOA 2EMBA 2EM6A 1MEYC 2EORA 2ENHA 2J7JA 2EOXA 2EOIA 2EM5A 2CT1A 4WSGA 1A1HA 2EMIA 2EOFA 1BBOA 2EQ0A 1X3CA 2YRMA 2YTFA 1UBDC 1YUJA 4R2CA 1Z1BA 4IJDA 1JK2A 4IS1C 1X6HA 2BB8A 2ELZA 2MDGA 2ADRA 1WJPA 2EMZA 2RSIA 4R2QA 1TF6A 3MHSC 1P47A 2EN2A 2HGHA 2EPRA 2DMIA 2EN4A 1LLMC 1YSAC 1X5WA 2EM4A 2EMXA 2EOSA 1X6EA 2LT7A 2YTJA 2ELYA 2EMYA 1DGCA 2EN1A 3EPJA 1A1LA 2EOEA 2EL5A 1TN9A 4M9VC 2JPAA 2A25A 2CTDA 2EOYA 2EMCA 2EOZA 2YTQA 5KL4A 2EM8A 2YTOA 2EMKA 2EOJA 2LO3A 2YTDA 3VHTB 3EPLA 2NABA 2EMLA 1A1IA 1ZU1A 2EPPA 1A1JA 4R2RA 1A1KA 4F2JC 2R1FA 1ZR9A 2YSOA 2EN7A 1UN6B 2EPAA 2EOHA 2MKDA 1KJKA 3EPHA 1A1GA 2EOMA 2E72A 4R2EA 2EM9A 4R2PA 2EM0A 2GLIA 2EMFA 2EMAA 1F2IG 2EP3A 2YTIA 3UK3C 2YTPA 1BB8A 4R2DA 1G2DC 2YTEA 2EN6A 2YRHA 1YUIA 2CSHA 2ENCA 5KL6A 2EOQA 2YTGA 2EJ4A 2LVHA 2EN8A 4GZNC 2GHFA 2YU5A 2EMGA 2EM3A 5KL7A 1ZAAC 2RPCA 2YSPA 2MKNA 2LV2A 4R2AA 2EM2A 2M9AA 2VRDA 5KL5A 2LCEA 3MHHC 2EE8A 2EL4A 2DRPA 2EMHA 4X9JA 2EL6A 2WBSA 2ENAA 2YRKA 1G2FC 4F6MA 2EM7A 2EPCA 2D9HA 2DLQA 2WBTA 2YU8A 2EQ3A 2DLKA 1B69A 2EQ1A 1JK1A 2EMWA 4R2SA 1X6FA 1TF3A 1A1FA 2EPZA 1NCSA 5KL3A 2EPUA 2DGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAY A;  2PRT A;  3EPK A;  3M99 B;  2EN3 A;  2WCC 3;  2EPX A;  4F6N A;  5KL2 A;  2JP9 A;  1RMD A;  4FK5 C;  2WBU A;  2I13 A;  2YTN A;  2EOO A;  2EMB A;  2EM6 A;  1MEY C;  2EOR A;  2ENH A;  2J7J A;  2EOX A;  2EOI A;  2EM5 A;  2CT1 A;  4WSG A;  1A1H A;  2EMI A;  2EOF A;  1BBO A;  2EQ0 A;  1X3C A;  2YRM A;  2YTF A;  1UBD C;  1YUJ A;  4R2C A;  1Z1B A;  4IJD A;  1JK2 A;  4IS1 C;  1X6H A;  2BB8 A;  2ELZ A;  2MDG A;  2ADR A;  1WJP A;  2EMZ A;  2RSI A;  4R2Q A;  1TF6 A;  3MHS C;  1P47 A;  2EN2 A;  2HGH A;  2EPR A;  2DMI A;  2EN4 A;  1LLM C;  1YSA C;  1X5W A;  2EM4 A;  2EMX A;  2EOS A;  1X6E A;  2LT7 A;  2YTJ A;  2ELY A;  2EMY A;  1DGC A;  2EN1 A;  3EPJ A;  1A1L A;  2EOE A;  2EL5 A;  1TN9 A;  4M9V C;  2JPA A;  2A25 A;  2CTD A;  2EOY A;  2EMC A;  2EOZ A;  2YTQ A;  5KL4 A;  2EM8 A;  2YTO A;  2EMK A;  2EOJ A;  2LO3 A;  2YTD A;  3VHT B;  3EPL A;  2NAB A;  2EML A;  1A1I A;  1ZU1 A;  2EPP A;  1A1J A;  4R2R A;  1A1K A;  4F2J C;  2R1F A;  1ZR9 A;  2YSO A;  2EN7 A;  1UN6 B;  2EPA A;  2EOH A;  2MKD A;  1KJK A;  3EPH A;  1A1G A;  2EOM A;  2E72 A;  4R2E A;  2EM9 A;  4R2P A;  2EM0 A;  2GLI A;  2EMF A;  2EMA A;  1F2I G;  2EP3 A;  2YTI A;  3UK3 C;  2YTP A;  1BB8 A;  4R2D A;  1G2D C;  2YTE A;  2EN6 A;  2YRH A;  1YUI A;  2CSH A;  2ENC A;  5KL6 A;  2EOQ A;  2YTG A;  2EJ4 A;  2LVH A;  2EN8 A;  4GZN C;  2GHF A;  2YU5 A;  2EMG A;  2EM3 A;  5KL7 A;  1ZAA C;  2RPC A;  2YSP A;  2MKN A;  2LV2 A;  4R2A A;  2EM2 A;  2M9A A;  2VRD A;  5KL5 A;  2LCE A;  3MHH C;  2EE8 A;  2EL4 A;  2DRP A;  2EMH A;  4X9J A;  2EL6 A;  2WBS A;  2ENA A;  2YRK A;  1G2F C;  4F6M A;  2EM7 A;  2EPC A;  2D9H A;  2DLQ A;  2WBT A;  2YU8 A;  2EQ3 A;  2DLK A;  1B69 A;  2EQ1 A;  1JK1 A;  2EMW A;  4R2S A;  1X6F A;  1TF3 A;  1A1F A;  2EPZ A;  1NCS A;  5KL3 A;  2EPU A;  2DGC A; 
#chains in the Genus database with same CATH topology
 1AAY A;  2PRT A;  4LFC E;  1L4S A;  1WRJ A;  5IXM B;  4DV2 E;  1IBL E;  2LTR A;  2EN3 A;  2NUE A;  2EPX A;  2K7I A;  4F6N A;  5KL2 A;  4LF6 E;  2YTN A;  2EOO A;  2YT4 A;  3J7A G;  2J7J A;  4JI8 E;  5AC5 A;  2CT1 A;  1YZ9 A;  1BBO A;  2YTF A;  4GKK E;  4KHP E;  2N3H A;  2RS7 A;  2EMZ A;  2RSI A;  3C4B A;  2EN2 A;  2HGH A;  2EPR A;  2EN4 A;  1YPN A;  3JAM C;  1AH5 A;  2LT7 A;  2ELY A;  2Q8U A;  1QU6 A;  1GQE A;  2JY9 A;  4M2Z A;  2EN1 A;  1EH6 A;  4HEI A;  2L2M A;  4P78 A;  2EZ6 A;  1TN9 A;  4M9V C;  2JPA A;  4DUY E;  2EOY A;  2YTO A;  2EMK A;  3T1H E;  4JI7 E;  3F6H A;  3VHT B;  2VQF E;  5DNY A;  4DR6 E;  1A1I A;  1A1J A;  2EPP A;  2LJU A;  2UUA E;  4F2J C;  4DUZ E;  2EN7 A;  2EPA A;  1KJK A;  4NHR A;  4KWY A;  2RTX A;  4DV7 E;  2EOM A;  3EQ1 A;  3BBG A;  2EM9 A;  4Q35 B;  5ADZ A;  2EMF A;  1F2I G;  2EPK X;  2YTP A;  4M0V A;  4N4R B;  4OOG C;  2EN6 A;  4ZYE A;  2YWQ A;  2F8B A;  2UXD E;  1EH7 A;  5AAS A;  1QNT A;  2MC5 A;  4GZN C;  2L2K B;  2GHF A;  2YU5 A;  2EMG A;  5A6J A;  1ZAA C;  1T4O A;  5T6J A;  1MGT A;  2G7H A;  3JU0 A;  2BBG A;  2I9I A;  3QG5 C;  4WXC A;  2VRD A;  4KZS A;  2HJJ A;  1J26 A;  4LF9 E;  3IWC A;  4NZV A;  2R76 A;  5AC4 A;  3KWR A;  2EPC A;  2EWL A;  3T1Y E;  2EQ3 A;  1STU A;  1HNX E;  1JK1 A;  2N3G A;  1T38 A;  3ADL A;  4X62 E;  1WHQ A;  3EPH A;  4B3R E;  5AE3 A;  3MSW A;  4LFB E;  2WCC 3;  1HNW E;  4LF7 E;  4DV1 E;  2EM6 A;  2ENH A;  4BS9 A;  2JOB A;  2ODR D;  2NA2 A;  4L5N C;  4WSG A;  1SFE A;  2EMI A;  2EOF A;  2YRM A;  1X3C A;  4B3S E;  3RMP A;  1UBD C;  4TUG A;  1Z1B A;  1XMO E;  2DSY A;  4BC9 A;  4IJD A;  4IS1 C;  4R2Q A;  2ADR A;  3F6G A;  3MHS C;  2UU9 E;  2LE2 A;  2L2N A;  1YYK A;  4RHB B;  1PJS A;  4DR2 E;  1X5W A;  2EMX A;  2YTJ A;  1XMQ E;  4DR7 E;  1XNR E;  1BBG A;  2EMY A;  4DV0 E;  4X66 E;  1DGC A;  2V88 A;  5LMU E;  2EOE A;  5IV8 B;  1PDA A;  2A25 A;  2CTD A;  1IMU A;  2YTQ A;  5KL4 A;  1XNQ E;  2B7V A;  3KZY A;  2ODR C;  3HTX A;  2YTD A;  2JOX A;  2L8T A;  2N8X A;  5A6K A;  2B7T A;  2JWO A;  3P1X A;  3BF2 A;  4DV5 E;  2CPN A;  1A1K A;  2LBS B;  4BC7 A;  2YSO A;  4O5G A;  4DMI A;  1UN6 B;  1GTK A;  2MKD A;  4YY3 E;  2E72 A;  2EPO A;  4L8N A;  4R2P A;  4NXN E;  2EMA A;  2FTX B;  4JI5 E;  3LML A;  2EPM X;  5AE1 A;  2DMY A;  1IQO A;  2YRH A;  1YUI A;  2CSH A;  2RS6 A;  1PJQ A;  5KL6 A;  2EOQ A;  1WXR A;  2YTG A;  5KL7 A;  2KHX A;  2YSP A;  2M4I A;  4LF4 E;  3LLH A;  2M9A A;  2UXC E;  2RQL A;  4BBY A;  2B3T B;  4GKJ E;  2EMH A;  1X49 A;  4X9J A;  3C6K A;  2EPL X;  2KOU A;  2YRK A;  3ADG A;  1G2F C;  2YZT A;  4O4K A;  4F6M A;  2D9H A;  2DLQ A;  4WSP A;  2HHH E;  3THN A;  2EMW A;  4DV6 E;  1X6F A;  1GZ6 A;  1A1F A;  3HPS A;  2EPZ A;  4MLQ A;  2H36 X;  4AQY E;  4JI3 E;  3EPK A;  1RQ0 A;  2HC5 A;  3M99 B;  1RMD A;  4FK5 C;  2I13 A;  5AE2 A;  4JI0 E;  3DJW A;  2EOR A;  2EOI A;  2M1S A;  2EM5 A;  5LL6 R;  1A1H A;  1HR0 E;  4JI4 E;  3IWD A;  4J8Z A;  2BB8 A;  2MDG A;  1WJP A;  1P47 A;  2DMI A;  3VK6 A;  2FGG A;  4DV3 E;  2L3J A;  4Q28 A;  2EM4 A;  1X6E A;  4F9A B;  4BCA A;  1N36 E;  1A1L A;  5A2Q C;  2EL5 A;  4B3T E;  2EMC A;  2EOZ A;  5IWA E;  3J80 C;  4WX9 A;  2LMZ A;  2EOJ A;  3L00 A;  4O24 A;  1YYW A;  4X8W A;  2UXB E;  4M30 A;  4BHB A;  2VF1 A;  2K4V A;  3EPL A;  3FIG A;  4R03 A;  4DR5 E;  2LJH A;  2LRS A;  3ADI A;  1PJT A;  1ZU1 A;  4RH8 A;  1X47 A;  1FKA E;  1ZR9 A;  3J7Y p;  1J5E E;  3OML A;  2EOH A;  4B3M E;  4K0K E;  1IBK E;  4F9C B;  2EM0 A;  4DR1 E;  1T4L B;  3OTO E;  2YTI A;  3UK3 C;  1BB8 A;  2YTE A;  4JI6 E;  2V89 A;  2LVH A;  1IQS A;  5FLX C;  2WZO A;  5IT9 C;  2RPC A;  1YFH A;  4LTY A;  4R2A A;  4TUI A;  1O0W A;  2NUG A;  4X64 E;  2DRP A;  2FV4 B;  3AUZ A;  4I8O A;  2B9D A;  3BGH A;  3VYX A;  2L92 A;  1IBM E;  2VE7 C;  1WHN A;  2ENA A;  2WBS A;  3C6M A;  4DV4 E;  4NXM E;  5A6A A;  2DLK A;  1B69 A;  1RC7 A;  4LU9 A;  2V86 A;  4R2S A;  2E5L E;  2V83 A;  1N33 E;  1NCS A;  5KL3 A;  1KYQ A;  2DGC A;  4F9B B;  2GPI A;  3VYY A;  1EKZ A;  2KON A;  5BR8 E;  2JP9 A;  2WBU A;  4ZYD A;  2EMB A;  1MEY C;  2JVA A;  2EOX A;  5A6B A;  2RSM A;  3HXL A;  4DR3 E;  3KZZ A;  2EQ0 A;  4BMJ A;  3HQ1 A;  4P7D A;  1YUJ A;  4DKK A;  2L3C A;  3IWB A;  4R2C A;  3J81 C;  1JK2 A;  2JXP A;  1X6H A;  1N3G A;  2ELZ A;  2NUF A;  1TF6 A;  4OX9 E;  3JTZ A;  4WXD A;  1YSA C;  1X48 A;  1LLM C;  1ZBT A;  2EOS A;  2LUQ A;  2DB2 A;  5A6B D;  2LTS A;  1T4N A;  3EPJ A;  2V87 A;  4JI2 E;  2EM8 A;  5CFF E;  1N34 E;  2V8Q B;  2MDR A;  4JYA E;  3K6Q A;  4LFA E;  4WFT A;  2LO3 A;  1YYO A;  1PKP A;  1DI2 A;  3HPZ A;  2L6M A;  2NAB A;  4DR4 E;  5F3W A;  4ZYG A;  2EML A;  4O43 A;  4WPY A;  2EPN A;  1SR9 A;  5A69 A;  3AV0 A;  4R2R A;  2R1F A;  4LF8 E;  4X65 E;  2M7Q A;  4GEQ B;  2LUP B;  4LF5 E;  3C4T A;  3ECR A;  4R8O A;  1A1G A;  4YHH E;  4R2E A;  3THO B;  2GLI A;  1ZBQ A;  1NEI A;  2EP3 A;  4WYQ B;  4R2D A;  1G2D C;  4MLV A;  3DF6 A;  3ZOQ B;  1UIL A;  2ENC A;  2MC6 A;  2EJ4 A;  2IHR 1;  3ADJ A;  5TSE A;  2UUB E;  2UUC E;  2EN8 A;  1FJG E;  2EM3 A;  2JR1 A;  2MKN A;  2ZM6 E;  4BHC A;  1DQ3 A;  2LV2 A;  2EM2 A;  2V85 A;  3TQM A;  5KL5 A;  2LCE A;  3MHH C;  1HNZ E;  2EE8 A;  2EL4 A;  2YPN A;  1I94 E;  4F54 A;  1N32 E;  2E1M A;  2EL6 A;  2JYA A;  5LMN E;  2F4V E;  2L33 A;  1EH8 A;  5LLQ A;  4JI1 E;  2EM7 A;  2WBT A;  1UHZ A;  2YU8 A;  2VQE E;  1T39 A;  4HTG A;  4ZYH A;  2EQ1 A;  4JV5 E;  3H09 A;  1TF3 A;  3BID A;  2DIX A;  2EPU A; 
#chains in the Genus database with same CATH homology
 1AAY A;  2PRT A;  3EPK A;  3M99 B;  2EN3 A;  2WCC 3;  2EPX A;  4F6N A;  5KL2 A;  2JP9 A;  1RMD A;  4FK5 C;  2WBU A;  2I13 A;  2YTN A;  2EOO A;  2EMB A;  2EM6 A;  1MEY C;  2EOR A;  2ENH A;  2J7J A;  2EOX A;  2EOI A;  2EM5 A;  2CT1 A;  4WSG A;  1A1H A;  2EMI A;  2EOF A;  1BBO A;  2EQ0 A;  1X3C A;  2YRM A;  2YTF A;  1UBD C;  1YUJ A;  4R2C A;  1Z1B A;  4IJD A;  1JK2 A;  4IS1 C;  1X6H A;  2BB8 A;  2ELZ A;  2MDG A;  2ADR A;  1WJP A;  2EMZ A;  2RSI A;  4R2Q A;  1TF6 A;  3MHS C;  1P47 A;  2EN2 A;  2HGH A;  2EPR A;  2DMI A;  2EN4 A;  1LLM C;  1YSA C;  1X5W A;  2EM4 A;  2EMX A;  2EOS A;  1X6E A;  2LT7 A;  2YTJ A;  2ELY A;  2EMY A;  1DGC A;  2EN1 A;  3EPJ A;  1A1L A;  2EOE A;  2EL5 A;  1TN9 A;  4M9V C;  2JPA A;  2A25 A;  2CTD A;  2EOY A;  2EMC A;  2EOZ A;  2YTQ A;  5KL4 A;  2EM8 A;  2YTO A;  2EMK A;  2EOJ A;  2LO3 A;  2YTD A;  3VHT B;  3EPL A;  2NAB A;  2EML A;  1A1I A;  1ZU1 A;  2EPP A;  1A1J A;  4R2R A;  1A1K A;  4F2J C;  2R1F A;  1ZR9 A;  2YSO A;  2EN7 A;  1UN6 B;  2EPA A;  2EOH A;  2MKD A;  1KJK A;  3EPH A;  1A1G A;  2EOM A;  2E72 A;  4R2E A;  2EM9 A;  4R2P A;  2EM0 A;  2GLI A;  2EMF A;  2EMA A;  1F2I G;  2EP3 A;  2YTI A;  3UK3 C;  2YTP A;  1BB8 A;  4R2D A;  1G2D C;  2YTE A;  2EN6 A;  2YRH A;  1YUI A;  2CSH A;  2ENC A;  5KL6 A;  2EOQ A;  2YTG A;  2EJ4 A;  2LVH A;  2EN8 A;  4GZN C;  2GHF A;  2YU5 A;  2EMG A;  2EM3 A;  5KL7 A;  1ZAA C;  2RPC A;  2YSP A;  2MKN A;  2LV2 A;  4R2A A;  2EM2 A;  2M9A A;  2VRD A;  5KL5 A;  2LCE A;  3MHH C;  2EE8 A;  2EL4 A;  2DRP A;  2EMH A;  4X9J A;  2EL6 A;  2WBS A;  2ENA A;  2YRK A;  1G2F C;  4F6M A;  2EM7 A;  2EPC A;  2D9H A;  2DLQ A;  2WBT A;  2YU8 A;  2EQ3 A;  2DLK A;  1B69 A;  2EQ1 A;  1JK1 A;  2EMW A;  4R2S A;  1X6F A;  1TF3 A;  1A1F A;  2EPZ A;  1NCS A;  5KL3 A;  2EPU A;  2DGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...