2LT7A

Solution nmr structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
ANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator Kaiso
publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
total genus 31
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A02
2EOOA 3EPJA 1ZAAC 1A1KA 2YTPA 1YUJA 1WJPA 2DMIA 2EM5A 2EN6A 2JP9A 2ELZA 2EMLA 2EN2A 2EP3A 1MEYC 2EN3A 1DGCA 2LV2A 2LO3A 5KL4A 2EMWA 1ZR9A 4FK5C 2EQ0A 2ADRA 2JPAA 1UBDC 2RSIA 2YTGA 2YTNA 1X6EA 4IS1C 2LT7A 1LLMC 2YRMA 2WBSA 1A1GA 2J7JA 1Z1BA 2YTIA 2EQ3A 2EOJA 4R2QA 2YRKA 2EPZA 1BB8A 2R1FA 2WBTA 2A25A 5KL5A 2EM9A 2EOHA 2NABA 5KL3A 2EOFA 5KL2A 2I13A 2E72A 2CTDA 2YTQA 1X6FA 1A1FA 2YSPA 1A1JA 2YTDA 2WCC3 2YTOA 4IJDA 2M9AA 1JK2A 1G2DC 2ENAA 2EE8A 1P47A 2EM3A 2DRPA 1X6HA 3EPLA 4R2PA 1UN6B 2EM4A 4WSGA 2EMHA 2GLIA 5KL6A 2EPXA 4F6NA 2EMXA 3MHHC 1KJKA 2EOMA 2EOXA 2CSHA 2EMIA 2HGHA 2GHFA 1YSAC 2EN1A 1ZU1A 2EN4A 3M99B 4R2RA 2PRTA 2EOEA 1TF6A 1X5WA 2YRHA 2DLQA 1NCSA 2EMZA 2MDGA 2EL5A 2EMBA 2EOQA 2YTJA 1TN9A 2EPPA 3EPKA 2WBUA 2EJ4A 2YTEA 1RMDA 4R2AA 2EMFA 2YSOA 2EMKA 2EOSA 1A1HA 2EM0A 2EL6A 2EM8A 2ENCA 2EM2A 1YUIA 2EM7A 2YTFA 4F2JC 1F2IG 5KL7A 3MHSC 1B69A 4F6MA 2DGCA 2EORA 3EPHA 2D9HA 2RPCA 2EMCA 1X3CA 1G2FC 2EOYA 2EPCA 2EPUA 4R2SA 2EMAA 4GZNC 2EQ1A 2VRDA 4R2EA 2LVHA 3VHTB 2EN8A 1BBOA 2EOIA 4R2CA 2ENHA 2ELYA 2EL4A 2CT1A 1A1LA 2EM6A 1TF3A 2MKNA 1A1IA 2LCEA 2EMYA 2EPAA 2YU5A 2EOZA 2YU8A 3UK3C 2EMGA 4X9JA 4R2DA 2BB8A 1JK1A 4M9VC 2EPRA 1AAYA 2EN7A 2DLKA 2MKDA
chains in the Genus database with same CATH superfamily
1ZAAC 4LF7E 1FJGE 3J81C 2YTPA 2EPKX 5CFFE 5DNYA 2WZOA 2EN6A 1N34E 4Q28A 4O5GA 1SR9A 4OX9E 4TUGA 3HPSA 4DV2E 5AC5A 2EMWA 2M1SA 4FK5C 1GTKA 4BHBA 4IS1C 2RSMA 2YRMA 5LMUE 4O4KA 2YTIA 5F3WA 1IBME 2RTXA 2YRKA 2EPZA 1FKAE 1BB8A 2R1FA 2L2NA 1IQOA 4DUYE 4LFBE 2UXBE 4IJDA 2KONA 2M9AA 5AE1A 3ZOQB 4M30A 2EM4A 4X8WA 4JI1E 2VQEE 2EMXA 1IBLE 3MHHC 3TQMA 1YYKA 1UILA 2NUFA 4R8OA 1T39A 3M99B 4LFCE 4JI3E 2EMZA 5IV8B 2NUEA 2LRSA 1T4LB 2H36X 1L4SA 2EJ4A 2K7IA 4MLQA 3KZYA 2EMFA 2M7QA 2EOSA 3VK6A 2EL6A 5IWAE 2EM7A 2M4IA 3ADLA 2V87A 1HR0E 4F9BB 2B3TB 5KL7A 3IWCA 2LMZA 1N36E 3BBGA 4F6MA 2DGCA 3EPHA 4RH8A 3H09A 2D9HA 4BCAA 3VYYA 4LF4E 2EOYA 5LLQA 4GEQB 4RHBB 2F4VE 2GPIA 2UUAE 3ADJA 3C6MA 2DMYA 2LUPB 1BBOA 5AE3A 1STUA 4KZSA 4LF6E 2JR1A 2EOIA 4NZVA 3T1YE 2KOUA 3OTOE 5A6BD 1TF3A 2MC6A 1A1IA 2LCEA 4LFAE 2EMYA 2EPAA 2YU8A 4LF8E 1N33E 3J80C 1JK1A 1AAYA 2EN7A 2K4VA 4L5NC 2V83A 4HEIA 1EKZA 1A1KA 3AUZA 2L92A 1ZBTA 2KHXA 2FTXB 2V89A 1T4OA 2ELZA 4JYAE 2EP3A 2YPNA 2VQFE 1DGCA 2EPMX 2LO3A 4P78A 2ADRA 4LTYA 4YHHE 3L00A 3THNA 4N4RB 1LLMC 4DV1E 2LT7A 4DR3E 2J7JA 1Z1BA 4JI0E 4R2QA 2JVAA 4DV0E 2WBTA 4ZYGA 3LLHA 2A25A 3ADGA 4GKJE 2JOBA 2EOHA 2NABA 1O0WA 1AH5A 2EOFA 5KL2A 5TSEA 4WXDA 1YYOA 4BBYA 2VE7C 3KWRA 2G7HA 2YWQA 1HNWE 2YTQA 2YSPA 4KWYA 2L2KB 1X48A 3C4TA 4BS9A 2RS6A 2BBGA 2YT4A 2L3JA 1X6HA 2JWOA 2LE2A 4BC9A 5KL6A 3F6HA 4JI6E 5IT9C 1WHNA 5T6JA 2CSHA 3JAMC 3FIGA 2EN1A 1ZU1A 2EN4A 2CPNA 2EOEA 2L8TA 1TF6A 1X5WA 2YRHA 2DLQA 2R76A 4P7DA 2E5LE 2EMBA 2V86A 4DV6E 3C4BA 1TN9A 2ODRC 1IMUA 1IQSA 3EPKA 4B3SE 2YTEA 2HC5A 2EM2A 4F2JC 2V8QB 4AQYE 1B69A 4WX9A 5A2QC 1G2FC 2EPCA 4M2ZA 2MC5A 2B9DA 3HXLA 2VRDA 4I8OA 4R2EA 4X65E 4DR4E 4R2CA 4K0KE 4ZYDA 2EM6A 2EOZA 4KHPE 4X9JA 2BB8A 2L33A 1QU6A 3BF2A 2EWLA 2LTRA 2MKDA 2EOOA 3EPJA 4DR5E 1HNXE 2DIXA 4JI8E 4DKKA 4DR2E 3JTZA 1WJPA 2EM5A 2DMIA 1MGTA 2EMLA 2EN2A 5AASA 1GQEA 4O24A 5ADZA 1MEYC 4F9CB 2LV2A 3BIDA 5KL4A 1X49A 2EQ0A 4O43A 4WFTA 4DV4E 1UBDC 2JPAA 2RSIA 3QG5C 2YTGA 2YTNA 2F8BA 1IBKE 1A1GA 4GKKE 1T38A 2EQ3A 1DQ3A 2E1MA 1PDAA 5KL5A 4WXCA 2EM9A 2I13A 2L3CA 2E72A 4LU9A 4R03A 2CTDA 1A1FA 1XMQE 2I9IA 3IWBA 1PJTA 2NA2A 2N3GA 2YTOA 3OMLA 2UUBE 1YZ9A 2LUQA 4WSPA 1G2DC 2ENAA 2EE8A 2EM3A 4TUIA 5A6JA 4R2PA 3J7Yp 3IWDA 4WSGA 2GLIA 4MLVA 2EPXA 4F6NA 1KYQA 2UUCE 1WRJA 2EMIA 3EQ1A 2HGHA 2GHFA 1XNQE 1NEIA 1XNRE 1EH6A 1N3GA 4HTGA 5BR8E 1SFEA 4JI4E 4JI2E 3DJWA 1N32E 4DR6E 2EOQA 2YTJA 4M0VA 3LMLA 3JU0A 2DB2A 2JXPA 1A1HA 2YSOA 2EMKA 4BHCA 2ZM6E 2FGGA 1RC7A 4NXME 1YUIA 2Q8UA 1F2IG 5FLXC 2NUGA 5A6AA 1J5EE 2RPCA 2N8XA 1WHQA 2EMCA 1WXRA 4ZYEA 1YPNA 2FV4B 2EPUA 1GZ6A 2IHR1 4GZNC 2EPLX 4DR7E 3THOB 2EN8A 3KZZA 3BGHA 2ENHA 3HPZA 3ADIA 5LL6R 1A1LA 3J7AG 2N3HA 2V88A 4BC7A 4YY3E 2YU5A 2UXDE 2EMGA 4R2DA 2EPRA 4X66E 2UU9E 2LJUA 1I94E 4F9AB 1X47A 1YUJA 1PKPA 2JP9A 4DV7E 2L2MA 4DR1E 1QNTA 2ODRD 2EN3A 4B3ME 1ZR9A 1YFHA 4J8ZA 1X6EA 2WBSA 2RS7A 2EOJA 4Q35B 1YYWA 2VF1A 3HQ1A 5KL3A 1DI2A 3RMPA 4NXNE 1XMOE 4WPYA 1RQ0A 5IXMB 1HNZE 1X6FA 1A1JA 5A69A 2YTDA 2WCC3 3ECRA 4X62E 4ZYHA 1JK2A 3MSWA 1P47A 3K6QA 3DF6A 2DRPA 3EPLA 2HJJA 1UN6B 2EMHA 2JOXA 3AV0A 1PJSA 3P1XA 1KJKA 2EOMA 5AC4A 2JYAA 3F6GA 2EOXA 2EPNA 1YSAC 4R2RA 2B7VA 2PRTA 4DMIA 1NCSA 4BMJA 2YZTA 2MDGA 1PJQA 2EL5A 1T4NA 2B7TA 2V85A 2EPPA 2WBUA 4X64E 2JY9A 2MDRA 1RMDA 4R2AA 4B3TE 4DV5E 4DV3E 2EM0A 2EM8A 2ENCA 1UHZA 3C6KA 5A6BA 1J26A 2LTSA 2YTFA 4L8NA 2LJHA 3MHSC 1ZBQA 2HHHE 4NHRA 2RQLA 2EORA 4JI7E 1X3CA 4LF5E 2LBSB 4R2SA 2EMAA 5LMNE 2EQ1A 1BBGA 2L6MA 3VYXA 5AE2A 2LVHA 4DUZE 1EH7A 3HTXA 3VHTB 4JI5E 4JV5E 2ELYA 4OOGC 5A6KA 4F54A 2EL4A 4B3RE 2CT1A 2MKNA 2DSYA 4LF9E 3T1HE 2UXCE 3UK3C 4M9VC 4WYQB 1EH8A 2EPOA 2DLKA 2EZ6A
chains in the Genus database with same CATH topology
2EOOA 3EPJA 1ZAAC 1A1KA 2YTPA 1YUJA 1WJPA 2DMIA 2EM5A 2EN6A 2JP9A 2ELZA 2EMLA 2EN2A 2EP3A 1MEYC 2EN3A 1DGCA 2LV2A 2LO3A 5KL4A 2EMWA 1ZR9A 4FK5C 2EQ0A 2ADRA 2JPAA 1UBDC 2RSIA 2YTGA 2YTNA 1X6EA 4IS1C 2LT7A 1LLMC 2YRMA 2WBSA 1A1GA 2J7JA 1Z1BA 2YTIA 2EQ3A 2EOJA 4R2QA 2YRKA 2EPZA 1BB8A 2R1FA 2WBTA 2A25A 5KL5A 2EM9A 2EOHA 2NABA 5KL3A 2EOFA 5KL2A 2I13A 2E72A 2CTDA 2YTQA 1X6FA 1A1FA 2YSPA 1A1JA 2YTDA 2WCC3 2YTOA 4IJDA 2M9AA 1JK2A 1G2DC 2ENAA 2EE8A 1P47A 2EM3A 2DRPA 1X6HA 3EPLA 4R2PA 1UN6B 2EM4A 4WSGA 2EMHA 2GLIA 5KL6A 2EPXA 4F6NA 2EMXA 3MHHC 1KJKA 2EOMA 2EOXA 2CSHA 2EMIA 2HGHA 2GHFA 1YSAC 2EN1A 1ZU1A 2EN4A 3M99B 4R2RA 2PRTA 2EOEA 1TF6A 1X5WA 2YRHA 2DLQA 1NCSA 2EMZA 2MDGA 2EL5A 2EMBA 2EOQA 2YTJA 1TN9A 2EPPA 3EPKA 2WBUA 2EJ4A 2YTEA 1RMDA 4R2AA 2EMFA 2YSOA 2EMKA 2EOSA 1A1HA 2EM0A 2EL6A 2EM8A 2ENCA 2EM2A 1YUIA 2EM7A 2YTFA 4F2JC 1F2IG 5KL7A 3MHSC 1B69A 4F6MA 2DGCA 2EORA 3EPHA 2D9HA 2RPCA 2EMCA 1X3CA 1G2FC 2EOYA 2EPCA 2EPUA 4R2SA 2EMAA 4GZNC 2EQ1A 2VRDA 4R2EA 2LVHA 3VHTB 2EN8A 1BBOA 2EOIA 4R2CA 2ENHA 2ELYA 2EL4A 2CT1A 1A1LA 2EM6A 1TF3A 2MKNA 1A1IA 2LCEA 2EMYA 2EPAA 2YU5A 2EOZA 2YU8A 3UK3C 2EMGA 4X9JA 4R2DA 2BB8A 1JK1A 4M9VC 2EPRA 1AAYA 2EN7A 2DLKA 2MKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOO A;  3EPJ A;  1ZAA C;  1A1K A;  2YTP A;  1YUJ A;  1WJP A;  2DMI A;  2EM5 A;  2EN6 A;  2JP9 A;  2ELZ A;  2EML A;  2EN2 A;  2EP3 A;  1MEY C;  2EN3 A;  1DGC A;  2LV2 A;  2LO3 A;  5KL4 A;  2EMW A;  1ZR9 A;  4FK5 C;  2EQ0 A;  2ADR A;  2JPA A;  1UBD C;  2RSI A;  2YTG A;  2YTN A;  1X6E A;  4IS1 C;  2LT7 A;  1LLM C;  2YRM A;  2WBS A;  1A1G A;  2J7J A;  1Z1B A;  2YTI A;  2EQ3 A;  2EOJ A;  4R2Q A;  2YRK A;  2EPZ A;  1BB8 A;  2R1F A;  2WBT A;  2A25 A;  5KL5 A;  2EM9 A;  2EOH A;  2NAB A;  5KL3 A;  2EOF A;  5KL2 A;  2I13 A;  2E72 A;  2CTD A;  2YTQ A;  1X6F A;  1A1F A;  2YSP A;  1A1J A;  2YTD A;  2WCC 3;  2YTO A;  4IJD A;  2M9A A;  1JK2 A;  1G2D C;  2ENA A;  2EE8 A;  1P47 A;  2EM3 A;  2DRP A;  1X6H A;  3EPL A;  4R2P A;  1UN6 B;  2EM4 A;  4WSG A;  2EMH A;  2GLI A;  5KL6 A;  2EPX A;  4F6N A;  2EMX A;  3MHH C;  1KJK A;  2EOM A;  2EOX A;  2CSH A;  2EMI A;  2HGH A;  2GHF A;  1YSA C;  2EN1 A;  1ZU1 A;  2EN4 A;  3M99 B;  4R2R A;  2PRT A;  2EOE A;  1TF6 A;  1X5W A;  2YRH A;  2DLQ A;  1NCS A;  2EMZ A;  2MDG A;  2EL5 A;  2EMB A;  2EOQ A;  2YTJ A;  1TN9 A;  2EPP A;  3EPK A;  2WBU A;  2EJ4 A;  2YTE A;  1RMD A;  4R2A A;  2EMF A;  2YSO A;  2EMK A;  2EOS A;  1A1H A;  2EM0 A;  2EL6 A;  2EM8 A;  2ENC A;  2EM2 A;  1YUI A;  2EM7 A;  2YTF A;  4F2J C;  1F2I G;  5KL7 A;  3MHS C;  1B69 A;  4F6M A;  2DGC A;  2EOR A;  3EPH A;  2D9H A;  2RPC A;  2EMC A;  1X3C A;  1G2F C;  2EOY A;  2EPC A;  2EPU A;  4R2S A;  2EMA A;  4GZN C;  2EQ1 A;  2VRD A;  4R2E A;  2LVH A;  3VHT B;  2EN8 A;  1BBO A;  2EOI A;  4R2C A;  2ENH A;  2ELY A;  2EL4 A;  2CT1 A;  1A1L A;  2EM6 A;  1TF3 A;  2MKN A;  1A1I A;  2LCE A;  2EMY A;  2EPA A;  2YU5 A;  2EOZ A;  2YU8 A;  3UK3 C;  2EMG A;  4X9J A;  4R2D A;  2BB8 A;  1JK1 A;  4M9V C;  2EPR A;  1AAY A;  2EN7 A;  2DLK A;  2MKD A; 
#chains in the Genus database with same CATH topology
 1ZAA C;  4LF7 E;  1FJG E;  3J81 C;  2YTP A;  2EPK X;  5CFF E;  5DNY A;  2WZO A;  2EN6 A;  1N34 E;  4Q28 A;  4O5G A;  1SR9 A;  4OX9 E;  4TUG A;  3HPS A;  4DV2 E;  5AC5 A;  2EMW A;  2M1S A;  4FK5 C;  1GTK A;  4BHB A;  4IS1 C;  2RSM A;  2YRM A;  5LMU E;  4O4K A;  2YTI A;  5F3W A;  1IBM E;  2RTX A;  2YRK A;  2EPZ A;  1FKA E;  1BB8 A;  2R1F A;  2L2N A;  1IQO A;  4DUY E;  4LFB E;  2UXB E;  4IJD A;  2KON A;  2M9A A;  5AE1 A;  3ZOQ B;  4M30 A;  2EM4 A;  4X8W A;  4JI1 E;  2VQE E;  2EMX A;  1IBL E;  3MHH C;  3TQM A;  1YYK A;  1UIL A;  2NUF A;  4R8O A;  1T39 A;  3M99 B;  4LFC E;  4JI3 E;  2EMZ A;  5IV8 B;  2NUE A;  2LRS A;  1T4L B;  2H36 X;  1L4S A;  2EJ4 A;  2K7I A;  4MLQ A;  3KZY A;  2EMF A;  2M7Q A;  2EOS A;  3VK6 A;  2EL6 A;  5IWA E;  2EM7 A;  2M4I A;  3ADL A;  2V87 A;  1HR0 E;  4F9B B;  2B3T B;  5KL7 A;  3IWC A;  2LMZ A;  1N36 E;  3BBG A;  4F6M A;  2DGC A;  3EPH A;  4RH8 A;  3H09 A;  2D9H A;  4BCA A;  3VYY A;  4LF4 E;  2EOY A;  5LLQ A;  4GEQ B;  4RHB B;  2F4V E;  2GPI A;  2UUA E;  3ADJ A;  3C6M A;  2DMY A;  2LUP B;  1BBO A;  5AE3 A;  1STU A;  4KZS A;  4LF6 E;  2JR1 A;  2EOI A;  4NZV A;  3T1Y E;  2KOU A;  3OTO E;  5A6B D;  1TF3 A;  2MC6 A;  1A1I A;  2LCE A;  4LFA E;  2EMY A;  2EPA A;  2YU8 A;  4LF8 E;  1N33 E;  3J80 C;  1JK1 A;  1AAY A;  2EN7 A;  2K4V A;  4L5N C;  2V83 A;  4HEI A;  1EKZ A;  1A1K A;  3AUZ A;  2L92 A;  1ZBT A;  2KHX A;  2FTX B;  2V89 A;  1T4O A;  2ELZ A;  4JYA E;  2EP3 A;  2YPN A;  2VQF E;  1DGC A;  2EPM X;  2LO3 A;  4P78 A;  2ADR A;  4LTY A;  4YHH E;  3L00 A;  3THN A;  4N4R B;  1LLM C;  4DV1 E;  2LT7 A;  4DR3 E;  2J7J A;  1Z1B A;  4JI0 E;  4R2Q A;  2JVA A;  4DV0 E;  2WBT A;  4ZYG A;  3LLH A;  2A25 A;  3ADG A;  4GKJ E;  2JOB A;  2EOH A;  2NAB A;  1O0W A;  1AH5 A;  2EOF A;  5KL2 A;  5TSE A;  4WXD A;  1YYO A;  4BBY A;  2VE7 C;  3KWR A;  2G7H A;  2YWQ A;  1HNW E;  2YTQ A;  2YSP A;  4KWY A;  2L2K B;  1X48 A;  3C4T A;  4BS9 A;  2RS6 A;  2BBG A;  2YT4 A;  2L3J A;  1X6H A;  2JWO A;  2LE2 A;  4BC9 A;  5KL6 A;  3F6H A;  4JI6 E;  5IT9 C;  1WHN A;  5T6J A;  2CSH A;  3JAM C;  3FIG A;  2EN1 A;  1ZU1 A;  2EN4 A;  2CPN A;  2EOE A;  2L8T A;  1TF6 A;  1X5W A;  2YRH A;  2DLQ A;  2R76 A;  4P7D A;  2E5L E;  2EMB A;  2V86 A;  4DV6 E;  3C4B A;  1TN9 A;  2ODR C;  1IMU A;  1IQS A;  3EPK A;  4B3S E;  2YTE A;  2HC5 A;  2EM2 A;  4F2J C;  2V8Q B;  4AQY E;  1B69 A;  4WX9 A;  5A2Q C;  1G2F C;  2EPC A;  4M2Z A;  2MC5 A;  2B9D A;  3HXL A;  2VRD A;  4I8O A;  4R2E A;  4X65 E;  4DR4 E;  4R2C A;  4K0K E;  4ZYD A;  2EM6 A;  2EOZ A;  4KHP E;  4X9J A;  2BB8 A;  2L33 A;  1QU6 A;  3BF2 A;  2EWL A;  2LTR A;  2MKD A;  2EOO A;  3EPJ A;  4DR5 E;  1HNX E;  2DIX A;  4JI8 E;  4DKK A;  4DR2 E;  3JTZ A;  1WJP A;  2EM5 A;  2DMI A;  1MGT A;  2EML A;  2EN2 A;  5AAS A;  1GQE A;  4O24 A;  5ADZ A;  1MEY C;  4F9C B;  2LV2 A;  3BID A;  5KL4 A;  1X49 A;  2EQ0 A;  4O43 A;  4WFT A;  4DV4 E;  1UBD C;  2JPA A;  2RSI A;  3QG5 C;  2YTG A;  2YTN A;  2F8B A;  1IBK E;  1A1G A;  4GKK E;  1T38 A;  2EQ3 A;  1DQ3 A;  2E1M A;  1PDA A;  5KL5 A;  4WXC A;  2EM9 A;  2I13 A;  2L3C A;  2E72 A;  4LU9 A;  4R03 A;  2CTD A;  1A1F A;  1XMQ E;  2I9I A;  3IWB A;  1PJT A;  2NA2 A;  2N3G A;  2YTO A;  3OML A;  2UUB E;  1YZ9 A;  2LUQ A;  4WSP A;  1G2D C;  2ENA A;  2EE8 A;  2EM3 A;  4TUI A;  5A6J A;  4R2P A;  3J7Y p;  3IWD A;  4WSG A;  2GLI A;  4MLV A;  2EPX A;  4F6N A;  1KYQ A;  2UUC E;  1WRJ A;  2EMI A;  3EQ1 A;  2HGH A;  2GHF A;  1XNQ E;  1NEI A;  1XNR E;  1EH6 A;  1N3G A;  4HTG A;  5BR8 E;  1SFE A;  4JI4 E;  4JI2 E;  3DJW A;  1N32 E;  4DR6 E;  2EOQ A;  2YTJ A;  4M0V A;  3LML A;  3JU0 A;  2DB2 A;  2JXP A;  1A1H A;  2YSO A;  2EMK A;  4BHC A;  2ZM6 E;  2FGG A;  1RC7 A;  4NXM E;  1YUI A;  2Q8U A;  1F2I G;  5FLX C;  2NUG A;  5A6A A;  1J5E E;  2RPC A;  2N8X A;  1WHQ A;  2EMC A;  1WXR A;  4ZYE A;  1YPN A;  2FV4 B;  2EPU A;  1GZ6 A;  2IHR 1;  4GZN C;  2EPL X;  4DR7 E;  3THO B;  2EN8 A;  3KZZ A;  3BGH A;  2ENH A;  3HPZ A;  3ADI A;  5LL6 R;  1A1L A;  3J7A G;  2N3H A;  2V88 A;  4BC7 A;  4YY3 E;  2YU5 A;  2UXD E;  2EMG A;  4R2D A;  2EPR A;  4X66 E;  2UU9 E;  2LJU A;  1I94 E;  4F9A B;  1X47 A;  1YUJ A;  1PKP A;  2JP9 A;  4DV7 E;  2L2M A;  4DR1 E;  1QNT A;  2ODR D;  2EN3 A;  4B3M E;  1ZR9 A;  1YFH A;  4J8Z A;  1X6E A;  2WBS A;  2RS7 A;  2EOJ A;  4Q35 B;  1YYW A;  2VF1 A;  3HQ1 A;  5KL3 A;  1DI2 A;  3RMP A;  4NXN E;  1XMO E;  4WPY A;  1RQ0 A;  5IXM B;  1HNZ E;  1X6F A;  1A1J A;  5A69 A;  2YTD A;  2WCC 3;  3ECR A;  4X62 E;  4ZYH A;  1JK2 A;  3MSW A;  1P47 A;  3K6Q A;  3DF6 A;  2DRP A;  3EPL A;  2HJJ A;  1UN6 B;  2EMH A;  2JOX A;  3AV0 A;  1PJS A;  3P1X A;  1KJK A;  2EOM A;  5AC4 A;  2JYA A;  3F6G A;  2EOX A;  2EPN A;  1YSA C;  4R2R A;  2B7V A;  2PRT A;  4DMI A;  1NCS A;  4BMJ A;  2YZT A;  2MDG A;  1PJQ A;  2EL5 A;  1T4N A;  2B7T A;  2V85 A;  2EPP A;  2WBU A;  4X64 E;  2JY9 A;  2MDR A;  1RMD A;  4R2A A;  4B3T E;  4DV5 E;  4DV3 E;  2EM0 A;  2EM8 A;  2ENC A;  1UHZ A;  3C6K A;  5A6B A;  1J26 A;  2LTS A;  2YTF A;  4L8N A;  2LJH A;  3MHS C;  1ZBQ A;  2HHH E;  4NHR A;  2RQL A;  2EOR A;  4JI7 E;  1X3C A;  4LF5 E;  2LBS B;  4R2S A;  2EMA A;  5LMN E;  2EQ1 A;  1BBG A;  2L6M A;  3VYX A;  5AE2 A;  2LVH A;  4DUZ E;  1EH7 A;  3HTX A;  3VHT B;  4JI5 E;  4JV5 E;  2ELY A;  4OOG C;  5A6K A;  4F54 A;  2EL4 A;  4B3R E;  2CT1 A;  2MKN A;  2DSY A;  4LF9 E;  3T1H E;  2UXC E;  3UK3 C;  4M9V C;  4WYQ B;  1EH8 A;  2EPO A;  2DLK A;  2EZ6 A; 
#chains in the Genus database with same CATH homology
 2EOO A;  3EPJ A;  1ZAA C;  1A1K A;  2YTP A;  1YUJ A;  1WJP A;  2DMI A;  2EM5 A;  2EN6 A;  2JP9 A;  2ELZ A;  2EML A;  2EN2 A;  2EP3 A;  1MEY C;  2EN3 A;  1DGC A;  2LV2 A;  2LO3 A;  5KL4 A;  2EMW A;  1ZR9 A;  4FK5 C;  2EQ0 A;  2ADR A;  2JPA A;  1UBD C;  2RSI A;  2YTG A;  2YTN A;  1X6E A;  4IS1 C;  2LT7 A;  1LLM C;  2YRM A;  2WBS A;  1A1G A;  2J7J A;  1Z1B A;  2YTI A;  2EQ3 A;  2EOJ A;  4R2Q A;  2YRK A;  2EPZ A;  1BB8 A;  2R1F A;  2WBT A;  2A25 A;  5KL5 A;  2EM9 A;  2EOH A;  2NAB A;  5KL3 A;  2EOF A;  5KL2 A;  2I13 A;  2E72 A;  2CTD A;  2YTQ A;  1X6F A;  1A1F A;  2YSP A;  1A1J A;  2YTD A;  2WCC 3;  2YTO A;  4IJD A;  2M9A A;  1JK2 A;  1G2D C;  2ENA A;  2EE8 A;  1P47 A;  2EM3 A;  2DRP A;  1X6H A;  3EPL A;  4R2P A;  1UN6 B;  2EM4 A;  4WSG A;  2EMH A;  2GLI A;  5KL6 A;  2EPX A;  4F6N A;  2EMX A;  3MHH C;  1KJK A;  2EOM A;  2EOX A;  2CSH A;  2EMI A;  2HGH A;  2GHF A;  1YSA C;  2EN1 A;  1ZU1 A;  2EN4 A;  3M99 B;  4R2R A;  2PRT A;  2EOE A;  1TF6 A;  1X5W A;  2YRH A;  2DLQ A;  1NCS A;  2EMZ A;  2MDG A;  2EL5 A;  2EMB A;  2EOQ A;  2YTJ A;  1TN9 A;  2EPP A;  3EPK A;  2WBU A;  2EJ4 A;  2YTE A;  1RMD A;  4R2A A;  2EMF A;  2YSO A;  2EMK A;  2EOS A;  1A1H A;  2EM0 A;  2EL6 A;  2EM8 A;  2ENC A;  2EM2 A;  1YUI A;  2EM7 A;  2YTF A;  4F2J C;  1F2I G;  5KL7 A;  3MHS C;  1B69 A;  4F6M A;  2DGC A;  2EOR A;  3EPH A;  2D9H A;  2RPC A;  2EMC A;  1X3C A;  1G2F C;  2EOY A;  2EPC A;  2EPU A;  4R2S A;  2EMA A;  4GZN C;  2EQ1 A;  2VRD A;  4R2E A;  2LVH A;  3VHT B;  2EN8 A;  1BBO A;  2EOI A;  4R2C A;  2ENH A;  2ELY A;  2EL4 A;  2CT1 A;  1A1L A;  2EM6 A;  1TF3 A;  2MKN A;  1A1I A;  2LCE A;  2EMY A;  2EPA A;  2YU5 A;  2EOZ A;  2YU8 A;  3UK3 C;  2EMG A;  4X9J A;  4R2D A;  2BB8 A;  1JK1 A;  4M9V C;  2EPR A;  1AAY A;  2EN7 A;  2DLK A;  2MKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...