2LT7A

Solution nmr structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
ANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator Kaiso
publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
total genus 31
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A02
1BBOA 2DLQA 2EN8A 1A1HA 1LLMC 2EPRA 4IJDA 2YTOA 1JK2A 2ENAA 2EM2A 2CT1A 2EOFA 2EMHA 3MHSC 2EPZA 2EMIA 2RPCA 2EM0A 1ZU1A 2EN1A 2EPPA 2LO3A 2EM4A 1KJKA 2EOHA 2LVHA 2E72A 1P47A 2EM9A 4R2SA 2EP3A 2YRMA 1A1JA 2EOXA 1YSAC 2MKNA 1RMDA 2JPAA 2EMXA 2EMGA 4R2DA 2YTIA 2JP9A 4X9JA 2EM3A 2WBUA 2EMWA 3EPLA 2EM6A 2I13A 2EMZA 2M9AA 2EL5A 2EOZA 1YUIA 3VHTB 2EQ0A 1G2FC 2J7JA 2EMLA 1B69A 2DRPA 1X6HA 4F2JC 5KL5A 2EN3A 2CTDA 2LCEA 4R2AA 4R2QA 2EL6A 2EOSA 2EPCA 2EORA 1X3CA 1A1LA 4F6NA 1BB8A 4R2CA 4R2PA 3EPHA 1A1KA 2YTEA 5KL6A 2EMBA 1ZR9A 2PRTA 1UN6B 1TF6A 2ENCA 2CSHA 1TN9A 2HGHA 1X6FA 2EPXA 2RSIA 4FK5C 2EOOA 2EOEA 2WCC3 2DMIA 2EMYA 2EN6A 4GZNC 2EOYA 2YSOA 2YTDA 5KL2A 2R1FA 2BB8A 2DLKA 1ZAAC 2EM5A 3UK3C 2MKDA 2MDGA 2EMCA 1F2IG 2YU5A 2EMFA 3MHHC 1A1IA 2WBSA 2EJ4A 2EPAA 2ADRA 2EN7A 2ELZA 1YUJA 1A1FA 4IS1C 1G2DC 2YTJA 1JK1A 1UBDC 1Z1BA 1X5WA 2NABA 1X6EA 2GHFA 2EM8A 2LV2A 2YTNA 2WBTA 2YTFA 2YTQA 2YTPA 2YTGA 2EQ3A 2EOMA 2EOJA 1A1GA 2A25A 2EE8A 3EPJA 2YU8A 2LT7A 2D9HA 2EMAA 2YSPA 2EPUA 4WSGA 1NCSA 4F6MA 4M9VC 2YRHA 2EOIA 5KL3A 3EPKA 2EM7A 2EQ1A 2VRDA 1AAYA 1MEYC 2DGCA 2EOQA 2EMKA 1DGCA 1TF3A 2YRKA 5KL4A 4R2RA 2EN2A 2ELYA 2GLIA 4R2EA 2EN4A 5KL7A 2ENHA 2EL4A 1WJPA 3M99B
chains in the Genus database with same CATH superfamily
1QU6A 2DLQA 4DV2E 1T38A 2LTSA 4L8NA 3F6GA 2YTOA 4F9AB 2ENAA 1WXRA 1PJTA 4NHRA 4L5NC 2EMHA 2EPPA 1KJKA 4WX9A 2EM4A 5IXMB 4DUYE 1P47A 2LE2A 3T1YE 4JI6E 2YRMA 3C6MA 1RMDA 2YTIA 4GEQB 1PJSA 4X9JA 3EPLA 2EM6A 1T4LB 3ADIA 4WXDA 1YUIA 2VQFE 1G2FC 2FTXB 4DV5E 2DRPA 2HHHE 1X6HA 1RC7A 4DR7E 4ZYDA 2CTDA 1BBGA 3BGHA 2ODRC 4R2AA 5A6BA 2LMZA 1XNQE 4JI5E 3VYXA 4JI1E 3P1XA 3IWBA 3AV0A 3EPHA 2YTEA 1DI2A 4GKJE 4M2ZA 1N32E 4F9CB 2ENCA 5A6AA 4DR2E 3TQMA 1TN9A 4JI7E 3K6QA 5IT9C 2EPXA 4FK5C 4B3RE 5LMNE 2IHR1 2WCC3 2VE7C 2EMYA 4Q28A 5A6KA 2DLKA 2JWOA 1J5EE 1ZAAC 4LF8E 1YFHA 1YUJA 1A1FA 1Z1BA 1X5WA 2DIXA 2EM8A 3C4BA 3VYYA 4N4RB 2H36X 2YTGA 1IBME 2L2NA 1A1GA 2RSMA 4YY3E 4O4KA 4DR3E 4LF7E 1X48A 1HR0E 2YSPA 2EPUA 2N3GA 2N8XA 1AH5A 4LF4E 2B3TB 2YRHA 4P7DA 5KL3A 1FJGE 3J7AG 2UXBE 1X47A 4BC7A 4WYQB 1IBLE 4MLVA 4TUGA 1GQEA 1TF3A 5KL4A 4X64E 1N34E 4R2RA 4JI0E 2M7QA 2EN2A 2GLIA 4DV6E 2F4VE 1PKPA 3M99B 1BBOA 4JV5E 2MDRA 3LLHA 1IBKE 2EPRA 2E1MA 3C6KA 3HXLA 4M0VA 1YYOA 2CT1A 4B3SE 3MHSC 1RQ0A 1B69A 2RPCA 4RHBB 2LO3A 4JI4E 2LVHA 2EM9A 1T39A 2MC5A 2UUBE 4R2SA 2MKNA 2EMGA 1N36E 2EM3A 2VF1A 2B9DA 2I13A 3F6HA 2YPNA 2M9AA 2EPOA 4R03A 3VHTB 3HTXA 3DJWA 4YHHE 3H09A 2J7JA 2EMLA 3KZYA 4BMJA 5KL5A 3OMLA 2GPIA 1XMQE 3FIGA 4R2QA 2LUQA 2RS7A 2JR1A 4F6NA 2KOUA 3HPSA 3OTOE 4R2PA 2R76A 3ECRA 1ZR9A 3ZOQB 2DSYA 1UN6B 1ZBTA 1FKAE 1GTKA 2CSHA 1J26A 1NEIA 2HGHA 1X6FA 2RQLA 4X62E 2EOOA 2EOEA 2V8QB 4OX9E 4GZNC 1WHNA 2K4VA 5KL2A 2BB8A 2EM5A 2JXPA 2MKDA 1O0WA 1XMOE 2NUGA 3DF6A 4DV1E 2MC6A 1SR9A 2UXCE 1YZ9A 2BBGA 3IWDA 2ELZA 4DKKA 4X8WA 4IS1C 4BHCA 4O24A 2YTJA 1JK1A 2NABA 1WHQA 2WBTA 4DV4E 4ZYGA 2L2MA 3HQ1A 2EOJA 4BHBA 3RMPA 2UU9E 3EPJA 2D9HA 2EMAA 4DV0E 1NCSA 2EOIA 3C4TA 2E5LE 4HTGA 5AASA 3ADGA 2EM7A 2EQ1A 2VRDA 1AAYA 4X65E 5AC4A 3AUZA 5FLXC 4ZYEA 3J81C 1DQ3A 5T6JA 1DGCA 2V88A 5AC5A 4TUIA 2ELYA 4MLQA 4OOGC 2EN4A 2LRSA 1WJPA 3THNA 2NUFA 1A1HA 2UUCE 1LLMC 4IJDA 4KZSA 2Q8UA 2YT4A 2EM2A 4Q35B 1QNTA 2L6MA 2EZ6A 2EPZA 1HNXE 2EN1A 1ZU1A 5LL6R 1UILA 3T1HE 3HPZA 1N33E 2EOXA 4R2DA 2ODRD 2CPNA 2K7IA 2WBUA 2EMWA 4BS9A 2EMZA 2NA2A 3THOB 4DR1E 3ADJA 4I8OA 2EQ0A 2ZM6E 4KHPE 2DB2A 2L3CA 1PDAA 4GKKE 1MGTA 4BBYA 4AQYE 1XNRE 2LCEA 4ZYHA 2LUPB 1EKZA 2EOSA 2EORA 4DR5E 1X3CA 2KHXA 2VQEE 1BB8A 2JY9A 4R2CA 1A1KA 2LTRA 5KL6A 5A6JA 1IMUA 5A6BD 1TF6A 2N3HA 4NXME 2V86A 2YZTA 2B7VA 1EH7A 4JI2E 2YWQA 1ZBQA 3MSWA 2YSOA 3BIDA 2RTXA 2R1FA 2V87A 5A69A 3UK3C 4LFCE 4B3TE 2EMCA 2YU5A 1WRJA 4LF5E 2WBSA 4DMIA 4P78A 2JVAA 2ADRA 5AE2A 2FGGA 3L00A 3JTZA 1IQOA 3LMLA 2HJJA 2V85A 1STUA 2YTQA 1PJQA 2RS6A 2EQ3A 4JYAE 3KWRA 2WZOA 1IQSA 2A25A 4DUZE 2M4IA 4DR4E 2L92A 2YU8A 2LT7A 5IWAE 5A2QC 1X49A 4F6MA 4M9VC 4O43A 3EPKA 2FV4B 2EPLX 4BC9A 2DGCA 1T4NA 2EOQA 3BF2A 1I94E 1SFEA 4JI8E 5DNYA 3JU0A 4J8ZA 5AE1A 2ENHA 1EH6A 2L2KB 4LTYA 2EN8A 1T4OA 1JK2A 5CFFE 2F8BA 3IWCA 4JI3E 2EPMX 1YPNA 2I9IA 5LLQA 1GZ6A 2EOFA 2EMIA 2EM0A 2L33A 5ADZA 3J7Yp 2EOHA 2E72A 3ADLA 4WSPA 3BBGA 2EP3A 2DMYA 1A1JA 1YSAC 5BR8E 2JPAA 2EMXA 2JP9A 5IV8B 2EPNA 2L3JA 4B3ME 2EL5A 2EOZA 4X66E 4DV3E 2UUAE 5F3WA 2KONA 2JOBA 2G7HA 4F2JC 4LFBE 2EN3A 4F9BB 2V83A 2B7TA 4WPYA 2EL6A 2EPCA 2UXDE 2EWLA 1A1LA 2HC5A 1KYQA 2EMBA 2PRTA 4HEIA 5AE3A 4F54A 2NUEA 2RSIA 4LFAE 2V89A 2DMIA 3J80C 2EN6A 1HNZE 5LMUE 4RH8A 2LJHA 1L4SA 2EOYA 2YTDA 4DV7E 4R8OA 4LF6E 2MDGA 5TSEA 4O5GA 4NZVA 1N3GA 1F2IG 2EMFA 3MHHC 1A1IA 3JAMC 2EJ4A 2EPAA 2EN7A 4NXNE 1G2DC 4KWYA 4LU9A 1UBDC 2EPKX 1X6EA 2GHFA 1HNWE 2LV2A 2YTNA 2YTPA 2YTFA 2EOMA 3EQ1A 3VK6A 1YYWA 2EE8A 1EH8A 2LJUA 3KZZA 2LBSB 4WSGA 1YYKA 2JOXA 4WXCA 1MEYC 4M30A 4LF9E 2L8TA 2EMKA 4DR6E 4K0KE 2YRKA 1UHZA 3QG5C 2JYAA 2M1SA 4WFTA 4R2EA 5KL7A 2EL4A 4BCAA
chains in the Genus database with same CATH topology
1BBOA 2DLQA 2EN8A 1A1HA 1LLMC 2EPRA 4IJDA 2YTOA 1JK2A 2ENAA 2EM2A 2CT1A 2EOFA 2EMHA 3MHSC 2EPZA 2EMIA 2RPCA 2EM0A 1ZU1A 2EN1A 2EPPA 2LO3A 2EM4A 1KJKA 2EOHA 2LVHA 2E72A 1P47A 2EM9A 4R2SA 2EP3A 2YRMA 1A1JA 2EOXA 1YSAC 2MKNA 1RMDA 2JPAA 2EMXA 2EMGA 4R2DA 2YTIA 2JP9A 4X9JA 2EM3A 2WBUA 2EMWA 3EPLA 2EM6A 2I13A 2EMZA 2M9AA 2EL5A 2EOZA 1YUIA 3VHTB 2EQ0A 1G2FC 2J7JA 2EMLA 1B69A 2DRPA 1X6HA 4F2JC 5KL5A 2EN3A 2CTDA 2LCEA 4R2AA 4R2QA 2EL6A 2EOSA 2EPCA 2EORA 1X3CA 1A1LA 4F6NA 1BB8A 4R2CA 4R2PA 3EPHA 1A1KA 2YTEA 5KL6A 2EMBA 1ZR9A 2PRTA 1UN6B 1TF6A 2ENCA 2CSHA 1TN9A 2HGHA 1X6FA 2EPXA 2RSIA 4FK5C 2EOOA 2EOEA 2WCC3 2DMIA 2EMYA 2EN6A 4GZNC 2EOYA 2YSOA 2YTDA 5KL2A 2R1FA 2BB8A 2DLKA 1ZAAC 2EM5A 3UK3C 2MKDA 2MDGA 2EMCA 1F2IG 2YU5A 2EMFA 3MHHC 1A1IA 2WBSA 2EJ4A 2EPAA 2ADRA 2EN7A 2ELZA 1YUJA 1A1FA 4IS1C 1G2DC 2YTJA 1JK1A 1UBDC 1Z1BA 1X5WA 2NABA 1X6EA 2GHFA 2EM8A 2LV2A 2YTNA 2WBTA 2YTFA 2YTQA 2YTPA 2YTGA 2EQ3A 2EOMA 2EOJA 1A1GA 2A25A 2EE8A 3EPJA 2YU8A 2LT7A 2D9HA 2EMAA 2YSPA 2EPUA 4WSGA 1NCSA 4F6MA 4M9VC 2YRHA 2EOIA 5KL3A 3EPKA 2EM7A 2EQ1A 2VRDA 1AAYA 1MEYC 2DGCA 2EOQA 2EMKA 1DGCA 1TF3A 2YRKA 5KL4A 4R2RA 2EN2A 2ELYA 2GLIA 4R2EA 2EN4A 5KL7A 2ENHA 2EL4A 1WJPA 3M99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBO A;  2DLQ A;  2EN8 A;  1A1H A;  1LLM C;  2EPR A;  4IJD A;  2YTO A;  1JK2 A;  2ENA A;  2EM2 A;  2CT1 A;  2EOF A;  2EMH A;  3MHS C;  2EPZ A;  2EMI A;  2RPC A;  2EM0 A;  1ZU1 A;  2EN1 A;  2EPP A;  2LO3 A;  2EM4 A;  1KJK A;  2EOH A;  2LVH A;  2E72 A;  1P47 A;  2EM9 A;  4R2S A;  2EP3 A;  2YRM A;  1A1J A;  2EOX A;  1YSA C;  2MKN A;  1RMD A;  2JPA A;  2EMX A;  2EMG A;  4R2D A;  2YTI A;  2JP9 A;  4X9J A;  2EM3 A;  2WBU A;  2EMW A;  3EPL A;  2EM6 A;  2I13 A;  2EMZ A;  2M9A A;  2EL5 A;  2EOZ A;  1YUI A;  3VHT B;  2EQ0 A;  1G2F C;  2J7J A;  2EML A;  1B69 A;  2DRP A;  1X6H A;  4F2J C;  5KL5 A;  2EN3 A;  2CTD A;  2LCE A;  4R2A A;  4R2Q A;  2EL6 A;  2EOS A;  2EPC A;  2EOR A;  1X3C A;  1A1L A;  4F6N A;  1BB8 A;  4R2C A;  4R2P A;  3EPH A;  1A1K A;  2YTE A;  5KL6 A;  2EMB A;  1ZR9 A;  2PRT A;  1UN6 B;  1TF6 A;  2ENC A;  2CSH A;  1TN9 A;  2HGH A;  1X6F A;  2EPX A;  2RSI A;  4FK5 C;  2EOO A;  2EOE A;  2WCC 3;  2DMI A;  2EMY A;  2EN6 A;  4GZN C;  2EOY A;  2YSO A;  2YTD A;  5KL2 A;  2R1F A;  2BB8 A;  2DLK A;  1ZAA C;  2EM5 A;  3UK3 C;  2MKD A;  2MDG A;  2EMC A;  1F2I G;  2YU5 A;  2EMF A;  3MHH C;  1A1I A;  2WBS A;  2EJ4 A;  2EPA A;  2ADR A;  2EN7 A;  2ELZ A;  1YUJ A;  1A1F A;  4IS1 C;  1G2D C;  2YTJ A;  1JK1 A;  1UBD C;  1Z1B A;  1X5W A;  2NAB A;  1X6E A;  2GHF A;  2EM8 A;  2LV2 A;  2YTN A;  2WBT A;  2YTF A;  2YTQ A;  2YTP A;  2YTG A;  2EQ3 A;  2EOM A;  2EOJ A;  1A1G A;  2A25 A;  2EE8 A;  3EPJ A;  2YU8 A;  2LT7 A;  2D9H A;  2EMA A;  2YSP A;  2EPU A;  4WSG A;  1NCS A;  4F6M A;  4M9V C;  2YRH A;  2EOI A;  5KL3 A;  3EPK A;  2EM7 A;  2EQ1 A;  2VRD A;  1AAY A;  1MEY C;  2DGC A;  2EOQ A;  2EMK A;  1DGC A;  1TF3 A;  2YRK A;  5KL4 A;  4R2R A;  2EN2 A;  2ELY A;  2GLI A;  4R2E A;  2EN4 A;  5KL7 A;  2ENH A;  2EL4 A;  1WJP A;  3M99 B; 
#chains in the Genus database with same CATH topology
 1QU6 A;  2DLQ A;  4DV2 E;  1T38 A;  2LTS A;  4L8N A;  3F6G A;  2YTO A;  4F9A B;  2ENA A;  1WXR A;  1PJT A;  4NHR A;  4L5N C;  2EMH A;  2EPP A;  1KJK A;  4WX9 A;  2EM4 A;  5IXM B;  4DUY E;  1P47 A;  2LE2 A;  3T1Y E;  4JI6 E;  2YRM A;  3C6M A;  1RMD A;  2YTI A;  4GEQ B;  1PJS A;  4X9J A;  3EPL A;  2EM6 A;  1T4L B;  3ADI A;  4WXD A;  1YUI A;  2VQF E;  1G2F C;  2FTX B;  4DV5 E;  2DRP A;  2HHH E;  1X6H A;  1RC7 A;  4DR7 E;  4ZYD A;  2CTD A;  1BBG A;  3BGH A;  2ODR C;  4R2A A;  5A6B A;  2LMZ A;  1XNQ E;  4JI5 E;  3VYX A;  4JI1 E;  3P1X A;  3IWB A;  3AV0 A;  3EPH A;  2YTE A;  1DI2 A;  4GKJ E;  4M2Z A;  1N32 E;  4F9C B;  2ENC A;  5A6A A;  4DR2 E;  3TQM A;  1TN9 A;  4JI7 E;  3K6Q A;  5IT9 C;  2EPX A;  4FK5 C;  4B3R E;  5LMN E;  2IHR 1;  2WCC 3;  2VE7 C;  2EMY A;  4Q28 A;  5A6K A;  2DLK A;  2JWO A;  1J5E E;  1ZAA C;  4LF8 E;  1YFH A;  1YUJ A;  1A1F A;  1Z1B A;  1X5W A;  2DIX A;  2EM8 A;  3C4B A;  3VYY A;  4N4R B;  2H36 X;  2YTG A;  1IBM E;  2L2N A;  1A1G A;  2RSM A;  4YY3 E;  4O4K A;  4DR3 E;  4LF7 E;  1X48 A;  1HR0 E;  2YSP A;  2EPU A;  2N3G A;  2N8X A;  1AH5 A;  4LF4 E;  2B3T B;  2YRH A;  4P7D A;  5KL3 A;  1FJG E;  3J7A G;  2UXB E;  1X47 A;  4BC7 A;  4WYQ B;  1IBL E;  4MLV A;  4TUG A;  1GQE A;  1TF3 A;  5KL4 A;  4X64 E;  1N34 E;  4R2R A;  4JI0 E;  2M7Q A;  2EN2 A;  2GLI A;  4DV6 E;  2F4V E;  1PKP A;  3M99 B;  1BBO A;  4JV5 E;  2MDR A;  3LLH A;  1IBK E;  2EPR A;  2E1M A;  3C6K A;  3HXL A;  4M0V A;  1YYO A;  2CT1 A;  4B3S E;  3MHS C;  1RQ0 A;  1B69 A;  2RPC A;  4RHB B;  2LO3 A;  4JI4 E;  2LVH A;  2EM9 A;  1T39 A;  2MC5 A;  2UUB E;  4R2S A;  2MKN A;  2EMG A;  1N36 E;  2EM3 A;  2VF1 A;  2B9D A;  2I13 A;  3F6H A;  2YPN A;  2M9A A;  2EPO A;  4R03 A;  3VHT B;  3HTX A;  3DJW A;  4YHH E;  3H09 A;  2J7J A;  2EML A;  3KZY A;  4BMJ A;  5KL5 A;  3OML A;  2GPI A;  1XMQ E;  3FIG A;  4R2Q A;  2LUQ A;  2RS7 A;  2JR1 A;  4F6N A;  2KOU A;  3HPS A;  3OTO E;  4R2P A;  2R76 A;  3ECR A;  1ZR9 A;  3ZOQ B;  2DSY A;  1UN6 B;  1ZBT A;  1FKA E;  1GTK A;  2CSH A;  1J26 A;  1NEI A;  2HGH A;  1X6F A;  2RQL A;  4X62 E;  2EOO A;  2EOE A;  2V8Q B;  4OX9 E;  4GZN C;  1WHN A;  2K4V A;  5KL2 A;  2BB8 A;  2EM5 A;  2JXP A;  2MKD A;  1O0W A;  1XMO E;  2NUG A;  3DF6 A;  4DV1 E;  2MC6 A;  1SR9 A;  2UXC E;  1YZ9 A;  2BBG A;  3IWD A;  2ELZ A;  4DKK A;  4X8W A;  4IS1 C;  4BHC A;  4O24 A;  2YTJ A;  1JK1 A;  2NAB A;  1WHQ A;  2WBT A;  4DV4 E;  4ZYG A;  2L2M A;  3HQ1 A;  2EOJ A;  4BHB A;  3RMP A;  2UU9 E;  3EPJ A;  2D9H A;  2EMA A;  4DV0 E;  1NCS A;  2EOI A;  3C4T A;  2E5L E;  4HTG A;  5AAS A;  3ADG A;  2EM7 A;  2EQ1 A;  2VRD A;  1AAY A;  4X65 E;  5AC4 A;  3AUZ A;  5FLX C;  4ZYE A;  3J81 C;  1DQ3 A;  5T6J A;  1DGC A;  2V88 A;  5AC5 A;  4TUI A;  2ELY A;  4MLQ A;  4OOG C;  2EN4 A;  2LRS A;  1WJP A;  3THN A;  2NUF A;  1A1H A;  2UUC E;  1LLM C;  4IJD A;  4KZS A;  2Q8U A;  2YT4 A;  2EM2 A;  4Q35 B;  1QNT A;  2L6M A;  2EZ6 A;  2EPZ A;  1HNX E;  2EN1 A;  1ZU1 A;  5LL6 R;  1UIL A;  3T1H E;  3HPZ A;  1N33 E;  2EOX A;  4R2D A;  2ODR D;  2CPN A;  2K7I A;  2WBU A;  2EMW A;  4BS9 A;  2EMZ A;  2NA2 A;  3THO B;  4DR1 E;  3ADJ A;  4I8O A;  2EQ0 A;  2ZM6 E;  4KHP E;  2DB2 A;  2L3C A;  1PDA A;  4GKK E;  1MGT A;  4BBY A;  4AQY E;  1XNR E;  2LCE A;  4ZYH A;  2LUP B;  1EKZ A;  2EOS A;  2EOR A;  4DR5 E;  1X3C A;  2KHX A;  2VQE E;  1BB8 A;  2JY9 A;  4R2C A;  1A1K A;  2LTR A;  5KL6 A;  5A6J A;  1IMU A;  5A6B D;  1TF6 A;  2N3H A;  4NXM E;  2V86 A;  2YZT A;  2B7V A;  1EH7 A;  4JI2 E;  2YWQ A;  1ZBQ A;  3MSW A;  2YSO A;  3BID A;  2RTX A;  2R1F A;  2V87 A;  5A69 A;  3UK3 C;  4LFC E;  4B3T E;  2EMC A;  2YU5 A;  1WRJ A;  4LF5 E;  2WBS A;  4DMI A;  4P78 A;  2JVA A;  2ADR A;  5AE2 A;  2FGG A;  3L00 A;  3JTZ A;  1IQO A;  3LML A;  2HJJ A;  2V85 A;  1STU A;  2YTQ A;  1PJQ A;  2RS6 A;  2EQ3 A;  4JYA E;  3KWR A;  2WZO A;  1IQS A;  2A25 A;  4DUZ E;  2M4I A;  4DR4 E;  2L92 A;  2YU8 A;  2LT7 A;  5IWA E;  5A2Q C;  1X49 A;  4F6M A;  4M9V C;  4O43 A;  3EPK A;  2FV4 B;  2EPL X;  4BC9 A;  2DGC A;  1T4N A;  2EOQ A;  3BF2 A;  1I94 E;  1SFE A;  4JI8 E;  5DNY A;  3JU0 A;  4J8Z A;  5AE1 A;  2ENH A;  1EH6 A;  2L2K B;  4LTY A;  2EN8 A;  1T4O A;  1JK2 A;  5CFF E;  2F8B A;  3IWC A;  4JI3 E;  2EPM X;  1YPN A;  2I9I A;  5LLQ A;  1GZ6 A;  2EOF A;  2EMI A;  2EM0 A;  2L33 A;  5ADZ A;  3J7Y p;  2EOH A;  2E72 A;  3ADL A;  4WSP A;  3BBG A;  2EP3 A;  2DMY A;  1A1J A;  1YSA C;  5BR8 E;  2JPA A;  2EMX A;  2JP9 A;  5IV8 B;  2EPN A;  2L3J A;  4B3M E;  2EL5 A;  2EOZ A;  4X66 E;  4DV3 E;  2UUA E;  5F3W A;  2KON A;  2JOB A;  2G7H A;  4F2J C;  4LFB E;  2EN3 A;  4F9B B;  2V83 A;  2B7T A;  4WPY A;  2EL6 A;  2EPC A;  2UXD E;  2EWL A;  1A1L A;  2HC5 A;  1KYQ A;  2EMB A;  2PRT A;  4HEI A;  5AE3 A;  4F54 A;  2NUE A;  2RSI A;  4LFA E;  2V89 A;  2DMI A;  3J80 C;  2EN6 A;  1HNZ E;  5LMU E;  4RH8 A;  2LJH A;  1L4S A;  2EOY A;  2YTD A;  4DV7 E;  4R8O A;  4LF6 E;  2MDG A;  5TSE A;  4O5G A;  4NZV A;  1N3G A;  1F2I G;  2EMF A;  3MHH C;  1A1I A;  3JAM C;  2EJ4 A;  2EPA A;  2EN7 A;  4NXN E;  1G2D C;  4KWY A;  4LU9 A;  1UBD C;  2EPK X;  1X6E A;  2GHF A;  1HNW E;  2LV2 A;  2YTN A;  2YTP A;  2YTF A;  2EOM A;  3EQ1 A;  3VK6 A;  1YYW A;  2EE8 A;  1EH8 A;  2LJU A;  3KZZ A;  2LBS B;  4WSG A;  1YYK A;  2JOX A;  4WXC A;  1MEY C;  4M30 A;  4LF9 E;  2L8T A;  2EMK A;  4DR6 E;  4K0K E;  2YRK A;  1UHZ A;  3QG5 C;  2JYA A;  2M1S A;  4WFT A;  4R2E A;  5KL7 A;  2EL4 A;  4BCA A; 
#chains in the Genus database with same CATH homology
 1BBO A;  2DLQ A;  2EN8 A;  1A1H A;  1LLM C;  2EPR A;  4IJD A;  2YTO A;  1JK2 A;  2ENA A;  2EM2 A;  2CT1 A;  2EOF A;  2EMH A;  3MHS C;  2EPZ A;  2EMI A;  2RPC A;  2EM0 A;  1ZU1 A;  2EN1 A;  2EPP A;  2LO3 A;  2EM4 A;  1KJK A;  2EOH A;  2LVH A;  2E72 A;  1P47 A;  2EM9 A;  4R2S A;  2EP3 A;  2YRM A;  1A1J A;  2EOX A;  1YSA C;  2MKN A;  1RMD A;  2JPA A;  2EMX A;  2EMG A;  4R2D A;  2YTI A;  2JP9 A;  4X9J A;  2EM3 A;  2WBU A;  2EMW A;  3EPL A;  2EM6 A;  2I13 A;  2EMZ A;  2M9A A;  2EL5 A;  2EOZ A;  1YUI A;  3VHT B;  2EQ0 A;  1G2F C;  2J7J A;  2EML A;  1B69 A;  2DRP A;  1X6H A;  4F2J C;  5KL5 A;  2EN3 A;  2CTD A;  2LCE A;  4R2A A;  4R2Q A;  2EL6 A;  2EOS A;  2EPC A;  2EOR A;  1X3C A;  1A1L A;  4F6N A;  1BB8 A;  4R2C A;  4R2P A;  3EPH A;  1A1K A;  2YTE A;  5KL6 A;  2EMB A;  1ZR9 A;  2PRT A;  1UN6 B;  1TF6 A;  2ENC A;  2CSH A;  1TN9 A;  2HGH A;  1X6F A;  2EPX A;  2RSI A;  4FK5 C;  2EOO A;  2EOE A;  2WCC 3;  2DMI A;  2EMY A;  2EN6 A;  4GZN C;  2EOY A;  2YSO A;  2YTD A;  5KL2 A;  2R1F A;  2BB8 A;  2DLK A;  1ZAA C;  2EM5 A;  3UK3 C;  2MKD A;  2MDG A;  2EMC A;  1F2I G;  2YU5 A;  2EMF A;  3MHH C;  1A1I A;  2WBS A;  2EJ4 A;  2EPA A;  2ADR A;  2EN7 A;  2ELZ A;  1YUJ A;  1A1F A;  4IS1 C;  1G2D C;  2YTJ A;  1JK1 A;  1UBD C;  1Z1B A;  1X5W A;  2NAB A;  1X6E A;  2GHF A;  2EM8 A;  2LV2 A;  2YTN A;  2WBT A;  2YTF A;  2YTQ A;  2YTP A;  2YTG A;  2EQ3 A;  2EOM A;  2EOJ A;  1A1G A;  2A25 A;  2EE8 A;  3EPJ A;  2YU8 A;  2LT7 A;  2D9H A;  2EMA A;  2YSP A;  2EPU A;  4WSG A;  1NCS A;  4F6M A;  4M9V C;  2YRH A;  2EOI A;  5KL3 A;  3EPK A;  2EM7 A;  2EQ1 A;  2VRD A;  1AAY A;  1MEY C;  2DGC A;  2EOQ A;  2EMK A;  1DGC A;  1TF3 A;  2YRK A;  5KL4 A;  4R2R A;  2EN2 A;  2ELY A;  2GLI A;  4R2E A;  2EN4 A;  5KL7 A;  2ENH A;  2EL4 A;  1WJP A;  3M99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...