2LT7A

Solution nmr structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
ANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
molecule keywords Transcriptional regulator Kaiso
total genus 31
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A02
1X3CA 1ZU1A 2ENCA 2YRMA 2LT7A 1BB8A 2CSHA 2EOFA 2BB8A 2EMHA 2EORA 2LVHA 2YRHA 2YTNA 4GZNC 1TN9A 1YUIA 1JK1A 2WCC3 2HGHA 4R2RA 2YRKA 1A1LA 2WBUA 2YTDA 1P47A 5KL5A 2RSIA 5KL6A 2DLQA 2EOIA 2EOQA 2EN4A 2DGCA 2EMWA 1A1JA 2YTEA 2EN2A 2RPCA 1A1FA 2EPUA 2ENAA 4X9JA 2EN3A 2YTIA 2LV2A 2EMCA 4IJDA 1A1GA 4R2AA 2GLIA 1G2FC 4R2SA 2YTFA 2CT1A 2EMAA 1AAYA 2EOYA 2YTQA 2EJ4A 2MDGA 2ENHA 2YU5A 2EMKA 2MKNA 1ZR9A 2EQ1A 1TF6A 2EOEA 2EOXA 1A1HA 3MHHC 1UBDC 3MHSC 2WBSA 2GHFA 2EOOA 3M99B 2EL5A 5KL3A 1X6EA 4WSGA 2EM8A 3EPHA 2DLKA 2EMYA 4M9VC 2EMZA 2LCEA 4R2CA 2J7JA 4IS1C 2YSOA 4R2PA 1Z1BA 1DGCA 2I13A 2WBTA 2EM0A 2EOMA 4F6MA 2CTDA 1X6FA 2DRPA 1ZAAC 2EQ3A 2EPCA 3UK3C 1A1IA 2M9AA 2EM3A 4F6NA 1UN6B 2EL4A 1JK2A 1YUJA 2ELYA 2EMGA 1X5WA 1BBOA 1NCSA 2EOSA 2EN7A 5KL7A 2EPAA 2VRDA 2EE8A 2EPRA 2YTJA 2EPXA 3EPLA 4R2EA 2MKDA 2EOJA 2EPZA 2YTPA 2EL6A 2LO3A 5KL4A 1B69A 2ADRA 2E72A 2EM4A 5KL2A 2YU8A 2EMFA 1KJKA 2PRTA 2EN1A 2D9HA 2NABA 2R1FA 4F2JC 2EM6A 2EMXA 2EPPA 2JP9A 2A25A 3VHTB 1RMDA 2EM9A 2ELZA 1X6HA 2EN6A 4R2QA 2EM2A 2EMBA 1A1KA 1TF3A 2DMIA 2EMIA 2EN8A 2YTOA 1WJPA 3EPKA 2EOHA 2EQ0A 4R2DA 3EPJA 2YSPA 1LLMC 2EM7A 1F2IG 2EOZA 4FK5C 2EMLA 1G2DC 2YTGA 2JPAA 1YSAC 1MEYC 2EM5A 2EP3A
chains in the Genus database with same CATH superfamily
2R76A 2E5LE 2F8BA 5AE1A 1X3CA 2LT7A 5LMUE 4KHPE 3ADGA 2LVHA 3ADLA 4LU9A 1ZBTA 2YTNA 4GZNC 2UU9E 2V8QB 3ADIA 4NHRA 2WBUA 5A69A 2YTDA 2HJJA 1T38A 2DMYA 1XNRE 2RSIA 3J81C 2EN2A 2I9IA 1UILA 2VQEE 2E1MA 5LMNE 5IT9C 4JI4E 1YYKA 4NXME 2F4VE 5CFFE 4DV2E 4R03A 2RS7A 4IJDA 2L8TA 2LBSB 1G2FC 4R2SA 2CT1A 2EMAA 2YTQA 2MDGA 1DI2A 2EMKA 3H09A 2N3GA 2L3CA 3JAMC 2EOEA 2LJUA 4GKKE 2GHFA 1T4OA 1J5EE 2DLKA 2LMZA 4R2CA 2UUCE 2YSOA 3JTZA 3RMPA 1Z1BA 2WBTA 2L92A 4F6MA 2CTDA 4ZYEA 2JY9A 4DV3E 1A1IA 2KHXA 2EM3A 1WHQA 3TQMA 2EL4A 4DMIA 2EMGA 2FTXB 4F54A 1BBOA 2JOXA 1T4LB 1NCSA 2EOSA 2YT4A 4R8OA 2VRDA 2EE8A 2EPRA 2LRSA 3EPLA 4DKKA 2EOJA 3OMLA 2UUAE 2YTPA 2EL6A 4X62E 2B7VA 4Q28A 2EM4A 3KWRA 1RQ0A 1RC7A 5KL2A 5A6AA 1O0WA 1KJKA 2YPNA 3OTOE 2R1FA 3T1HE 4DR5E 2A25A 2EM9A 3AV0A 2MC5A 2N3HA 4DR1E 1HNXE 2ELZA 1XMQE 4J8ZA 2EMBA 4RH8A 1YZ9A 2DMIA 4BC9A 1J26A 1WJPA 1STUA 4O24A 4BS9A 4M30A 4DV0E 2YSPA 3IWBA 4FK5C 2JXPA 1DQ3A 5AC4A 2JPAA 4WXCA 2EM5A 4JI7E 3MSWA 1IBME 3DJWA 3HPZA 5AE3A 2M7QA 2YRMA 3C6MA 1BB8A 2CSHA 2BB8A 2K7IA 4O5GA 4HEIA 3KZYA 1TN9A 2L2KB 1IQSA 2EPLX 2L2NA 2VE7C 4X64E 1A1LA 4LTYA 2V88A 1P47A 4OOGC 2EOIA 1YPNA 2DGCA 5F3WA 2EMWA 2RPCA 1A1FA 2V87A 2UXCE 4M0VA 3LMLA 5A6BA 1PJSA 4B3SE 4WX9A 4R2AA 1N3GA 4DR4E 1AAYA 3F6HA 2EOYA 4MLQA 2FGGA 2RTXA 2YU5A 4DV4E 4JYAE 2MDRA 4MLVA 3IWDA 1SR9A 2V89A 1TF6A 4OX9E 4JI6E 2JYAA 2LJHA 2EOXA 2WBSA 2EOOA 4BHBA 1XNQE 4YHHE 2HC5A 4DUYE 1QU6A 2EMYA 2LCEA 4DR3E 2NUFA 2J7JA 3THNA 4TUIA 1DGCA 2EM0A 1EH6A 2EPNA 4LFCE 3DF6A 1GQEA 4BHCA 2VQFE 1WRJA 2M1SA 1ZAAC 2EQ3A 2B7TA 2EPCA 2M9AA 2WZOA 2LTRA 3BBGA 4B3RE 2EZ6A 3QG5C 5KL7A 2LUPB 4BC7A 2EPAA 2V83A 4I8OA 1YYWA 3F6GA 4R2EA 2MKDA 2DIXA 2ADRA 3BF2A 1HNZE 2EMFA 4DV1E 2PRTA 4DV5E 1KYQA 4DR6E 4JI3E 1X49A 1EKZA 4O4KA 1X6HA 2IHR1 1GTKA 5T6JA 4R2QA 1FKAE 1AH5A 2JVAA 3EPKA 2EOHA 2EPKX 3VK6A 4DUZE 2EM7A 2RQLA 1F2IG 2EOZA 3K6QA 4JI1E 4LFBE 3C6KA 1SFEA 4ZYDA 1YSAC 5IWAE 2EP3A 3KZZA 2JWOA 2JR1A 4ZYGA 1ZU1A 2ENCA 4LF8E 1IBLE 2EMHA 2EORA 3C4BA 3THOB 2KONA 4L8NA 1JK1A 2WCC3 2YRKA 4B3TE 4WXDA 5AE2A 1L4SA 1PDAA 2DLQA 2EOQA 2EN4A 1A1JA 1N32E 2YTEA 2RSMA 4LF9E 1EH7A 4X9JA 4DV7E 4KWYA 2EN3A 2YTIA 4X8WA 4BCAA 3VYXA 5IXMB 3HQ1A 2EMCA 5A6KA 4DV6E 2YTFA 2ODRC 3HTXA 2MKNA 1ZR9A 2DB2A 4F9CB 1A1HA 2JOBA 4F9BB 2EPOA 3M99B 2EL5A 3EQ1A 1X6EA 4WSGA 2KOUA 3EPHA 4P7DA 1XMOE 4M2ZA 2YWQA 2EMZA 2ZM6E 4JI2E 4IS1C 4R2PA 4LFAE 2NA2A 4NXNE 2I13A 2LTSA 1N33E 2MC6A 2DRPA 4JI5E 3J7Yp 1T39A 3ADJA 1PJQA 4YY3E 2N8XA 1UN6B 1N36E 2ELYA 2EN7A 3T1YE 3L00A 4AQYE 3AUZA 2L2MA 2NUGA 2B3TB 4DR7E 2EPXA 5AASA 2LO3A 5DNYA 2BBGA 4B3ME 2M4IA 2YU8A 2EN1A 2D9HA 2NABA 2RS6A 4F2JC 2EMXA 3C4TA 1YYOA 2K4VA 1I94E 1RMDA 1N34E 4K0KE 4F9AB 2EN6A 2EM2A 2UXDE 2ODRD 1TF3A 2EMIA 2EN8A 2YTOA 2UXBE 1WXRA 4JV5E 2EMLA 1MEYC 5LLQA 5KL4A 4GEQB 5A6JA 4LF4E 4HTGA 1WHNA 1FJGE 2G7HA 2EOFA 1NEIA 1PJTA 2YRHA 4JI0E 1IQOA 1X47A 1IMUA 5A2QC 2VF1A 1YUIA 2HGHA 4R2RA 4NZVA 4L5NC 5AC5A 5KL5A 5KL6A 3P1XA 4BBYA 2V85A 2FV4B 2ENAA 2EPUA 1QNTA 2LV2A 4LF7E 2B9DA 1A1GA 2GLIA 3JU0A 2L33A 5A6BD 3ECRA 2EJ4A 2ENHA 2CPNA 3HPSA 3LLHA 5IV8B 2EPMX 2EQ1A 2LUQA 2DSYA 4WSPA 3MHHC 1ZBQA 3MHSC 3ZOQB 1YFHA 1X48A 3FIGA 3BIDA 1UBDC 5KL3A 4RHBB 2EM8A 4M9VC 2HHHE 4P78A 2GPIA 3BGHA 4JI8E 5FLXC 2EOMA 1X6FA 3UK3C 4F6NA 4N4RB 1EH8A 3IWCA 1JK2A 1YUJA 4WYQB 1X5WA 4DR2E 4GKJE 1BBGA 5BR8E 3J80C 4Q35B 2YTJA 4X66E 4KZSA 2LE2A 5TSEA 4TUGA 1PKPA 2EPZA 2EWLA 1IBKE 1B69A 5ADZA 2E72A 4WPYA 4LF5E 2EM6A 2EPPA 2L3JA 2NUEA 2JP9A 3VHTB 4X65E 3J7AG 4O43A 2Q8UA 4ZYHA 1HNWE 1MGTA 3VYYA 1UHZA 2UUBE 1A1KA 1T4NA 2L6MA 4WFTA 1GZ6A 1HR0E 2EQ0A 3HXLA 5LL6R 4R2DA 3EPJA 4BMJA 1LLMC 2YZTA 1G2DC 2YTGA 2V86A 4LF6E 2H36X
chains in the Genus database with same CATH topology
1X3CA 1ZU1A 2ENCA 2YRMA 2LT7A 1BB8A 2CSHA 2EOFA 2BB8A 2EMHA 2EORA 2LVHA 2YRHA 2YTNA 4GZNC 1TN9A 1YUIA 1JK1A 2WCC3 2HGHA 4R2RA 2YRKA 1A1LA 2WBUA 2YTDA 1P47A 5KL5A 2RSIA 5KL6A 2DLQA 2EOIA 2EOQA 2EN4A 2DGCA 2EMWA 1A1JA 2YTEA 2EN2A 2RPCA 1A1FA 2EPUA 2ENAA 4X9JA 2EN3A 2YTIA 2LV2A 2EMCA 4IJDA 1A1GA 4R2AA 2GLIA 1G2FC 4R2SA 2YTFA 2CT1A 2EMAA 1AAYA 2EOYA 2YTQA 2EJ4A 2MDGA 2ENHA 2YU5A 2EMKA 2MKNA 1ZR9A 2EQ1A 1TF6A 2EOEA 2EOXA 1A1HA 3MHHC 1UBDC 3MHSC 2WBSA 2GHFA 2EOOA 3M99B 2EL5A 5KL3A 1X6EA 4WSGA 2EM8A 3EPHA 2DLKA 2EMYA 4M9VC 2EMZA 2LCEA 4R2CA 2J7JA 4IS1C 2YSOA 4R2PA 1Z1BA 1DGCA 2I13A 2WBTA 2EM0A 2EOMA 4F6MA 2CTDA 1X6FA 2DRPA 1ZAAC 2EQ3A 2EPCA 3UK3C 1A1IA 2M9AA 2EM3A 4F6NA 1UN6B 2EL4A 1JK2A 1YUJA 2ELYA 2EMGA 1X5WA 1BBOA 1NCSA 2EOSA 2EN7A 5KL7A 2EPAA 2VRDA 2EE8A 2EPRA 2YTJA 2EPXA 3EPLA 4R2EA 2MKDA 2EOJA 2EPZA 2YTPA 2EL6A 2LO3A 5KL4A 1B69A 2ADRA 2E72A 2EM4A 5KL2A 2YU8A 2EMFA 1KJKA 2PRTA 2EN1A 2D9HA 2NABA 2R1FA 4F2JC 2EM6A 2EMXA 2EPPA 2JP9A 2A25A 3VHTB 1RMDA 2EM9A 2ELZA 1X6HA 2EN6A 4R2QA 2EM2A 2EMBA 1A1KA 1TF3A 2DMIA 2EMIA 2EN8A 2YTOA 1WJPA 3EPKA 2EOHA 2EQ0A 4R2DA 3EPJA 2YSPA 1LLMC 2EM7A 1F2IG 2EOZA 4FK5C 2EMLA 1G2DC 2YTGA 2JPAA 1YSAC 1MEYC 2EM5A 2EP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3C A;  1ZU1 A;  2ENC A;  2YRM A;  2LT7 A;  1BB8 A;  2CSH A;  2EOF A;  2BB8 A;  2EMH A;  2EOR A;  2LVH A;  2YRH A;  2YTN A;  4GZN C;  1TN9 A;  1YUI A;  1JK1 A;  2WCC 3;  2HGH A;  4R2R A;  2YRK A;  1A1L A;  2WBU A;  2YTD A;  1P47 A;  5KL5 A;  2RSI A;  5KL6 A;  2DLQ A;  2EOI A;  2EOQ A;  2EN4 A;  2DGC A;  2EMW A;  1A1J A;  2YTE A;  2EN2 A;  2RPC A;  1A1F A;  2EPU A;  2ENA A;  4X9J A;  2EN3 A;  2YTI A;  2LV2 A;  2EMC A;  4IJD A;  1A1G A;  4R2A A;  2GLI A;  1G2F C;  4R2S A;  2YTF A;  2CT1 A;  2EMA A;  1AAY A;  2EOY A;  2YTQ A;  2EJ4 A;  2MDG A;  2ENH A;  2YU5 A;  2EMK A;  2MKN A;  1ZR9 A;  2EQ1 A;  1TF6 A;  2EOE A;  2EOX A;  1A1H A;  3MHH C;  1UBD C;  3MHS C;  2WBS A;  2GHF A;  2EOO A;  3M99 B;  2EL5 A;  5KL3 A;  1X6E A;  4WSG A;  2EM8 A;  3EPH A;  2DLK A;  2EMY A;  4M9V C;  2EMZ A;  2LCE A;  4R2C A;  2J7J A;  4IS1 C;  2YSO A;  4R2P A;  1Z1B A;  1DGC A;  2I13 A;  2WBT A;  2EM0 A;  2EOM A;  4F6M A;  2CTD A;  1X6F A;  2DRP A;  1ZAA C;  2EQ3 A;  2EPC A;  3UK3 C;  1A1I A;  2M9A A;  2EM3 A;  4F6N A;  1UN6 B;  2EL4 A;  1JK2 A;  1YUJ A;  2ELY A;  2EMG A;  1X5W A;  1BBO A;  1NCS A;  2EOS A;  2EN7 A;  5KL7 A;  2EPA A;  2VRD A;  2EE8 A;  2EPR A;  2YTJ A;  2EPX A;  3EPL A;  4R2E A;  2MKD A;  2EOJ A;  2EPZ A;  2YTP A;  2EL6 A;  2LO3 A;  5KL4 A;  1B69 A;  2ADR A;  2E72 A;  2EM4 A;  5KL2 A;  2YU8 A;  2EMF A;  1KJK A;  2PRT A;  2EN1 A;  2D9H A;  2NAB A;  2R1F A;  4F2J C;  2EM6 A;  2EMX A;  2EPP A;  2JP9 A;  2A25 A;  3VHT B;  1RMD A;  2EM9 A;  2ELZ A;  1X6H A;  2EN6 A;  4R2Q A;  2EM2 A;  2EMB A;  1A1K A;  1TF3 A;  2DMI A;  2EMI A;  2EN8 A;  2YTO A;  1WJP A;  3EPK A;  2EOH A;  2EQ0 A;  4R2D A;  3EPJ A;  2YSP A;  1LLM C;  2EM7 A;  1F2I G;  2EOZ A;  4FK5 C;  2EML A;  1G2D C;  2YTG A;  2JPA A;  1YSA C;  1MEY C;  2EM5 A;  2EP3 A; 
#chains in the Genus database with same CATH topology
 2R76 A;  2E5L E;  2F8B A;  5AE1 A;  1X3C A;  2LT7 A;  5LMU E;  4KHP E;  3ADG A;  2LVH A;  3ADL A;  4LU9 A;  1ZBT A;  2YTN A;  4GZN C;  2UU9 E;  2V8Q B;  3ADI A;  4NHR A;  2WBU A;  5A69 A;  2YTD A;  2HJJ A;  1T38 A;  2DMY A;  1XNR E;  2RSI A;  3J81 C;  2EN2 A;  2I9I A;  1UIL A;  2VQE E;  2E1M A;  5LMN E;  5IT9 C;  4JI4 E;  1YYK A;  4NXM E;  2F4V E;  5CFF E;  4DV2 E;  4R03 A;  2RS7 A;  4IJD A;  2L8T A;  2LBS B;  1G2F C;  4R2S A;  2CT1 A;  2EMA A;  2YTQ A;  2MDG A;  1DI2 A;  2EMK A;  3H09 A;  2N3G A;  2L3C A;  3JAM C;  2EOE A;  2LJU A;  4GKK E;  2GHF A;  1T4O A;  1J5E E;  2DLK A;  2LMZ A;  4R2C A;  2UUC E;  2YSO A;  3JTZ A;  3RMP A;  1Z1B A;  2WBT A;  2L92 A;  4F6M A;  2CTD A;  4ZYE A;  2JY9 A;  4DV3 E;  1A1I A;  2KHX A;  2EM3 A;  1WHQ A;  3TQM A;  2EL4 A;  4DMI A;  2EMG A;  2FTX B;  4F54 A;  1BBO A;  2JOX A;  1T4L B;  1NCS A;  2EOS A;  2YT4 A;  4R8O A;  2VRD A;  2EE8 A;  2EPR A;  2LRS A;  3EPL A;  4DKK A;  2EOJ A;  3OML A;  2UUA E;  2YTP A;  2EL6 A;  4X62 E;  2B7V A;  4Q28 A;  2EM4 A;  3KWR A;  1RQ0 A;  1RC7 A;  5KL2 A;  5A6A A;  1O0W A;  1KJK A;  2YPN A;  3OTO E;  2R1F A;  3T1H E;  4DR5 E;  2A25 A;  2EM9 A;  3AV0 A;  2MC5 A;  2N3H A;  4DR1 E;  1HNX E;  2ELZ A;  1XMQ E;  4J8Z A;  2EMB A;  4RH8 A;  1YZ9 A;  2DMI A;  4BC9 A;  1J26 A;  1WJP A;  1STU A;  4O24 A;  4BS9 A;  4M30 A;  4DV0 E;  2YSP A;  3IWB A;  4FK5 C;  2JXP A;  1DQ3 A;  5AC4 A;  2JPA A;  4WXC A;  2EM5 A;  4JI7 E;  3MSW A;  1IBM E;  3DJW A;  3HPZ A;  5AE3 A;  2M7Q A;  2YRM A;  3C6M A;  1BB8 A;  2CSH A;  2BB8 A;  2K7I A;  4O5G A;  4HEI A;  3KZY A;  1TN9 A;  2L2K B;  1IQS A;  2EPL X;  2L2N A;  2VE7 C;  4X64 E;  1A1L A;  4LTY A;  2V88 A;  1P47 A;  4OOG C;  2EOI A;  1YPN A;  2DGC A;  5F3W A;  2EMW A;  2RPC A;  1A1F A;  2V87 A;  2UXC E;  4M0V A;  3LML A;  5A6B A;  1PJS A;  4B3S E;  4WX9 A;  4R2A A;  1N3G A;  4DR4 E;  1AAY A;  3F6H A;  2EOY A;  4MLQ A;  2FGG A;  2RTX A;  2YU5 A;  4DV4 E;  4JYA E;  2MDR A;  4MLV A;  3IWD A;  1SR9 A;  2V89 A;  1TF6 A;  4OX9 E;  4JI6 E;  2JYA A;  2LJH A;  2EOX A;  2WBS A;  2EOO A;  4BHB A;  1XNQ E;  4YHH E;  2HC5 A;  4DUY E;  1QU6 A;  2EMY A;  2LCE A;  4DR3 E;  2NUF A;  2J7J A;  3THN A;  4TUI A;  1DGC A;  2EM0 A;  1EH6 A;  2EPN A;  4LFC E;  3DF6 A;  1GQE A;  4BHC A;  2VQF E;  1WRJ A;  2M1S A;  1ZAA C;  2EQ3 A;  2B7T A;  2EPC A;  2M9A A;  2WZO A;  2LTR A;  3BBG A;  4B3R E;  2EZ6 A;  3QG5 C;  5KL7 A;  2LUP B;  4BC7 A;  2EPA A;  2V83 A;  4I8O A;  1YYW A;  3F6G A;  4R2E A;  2MKD A;  2DIX A;  2ADR A;  3BF2 A;  1HNZ E;  2EMF A;  4DV1 E;  2PRT A;  4DV5 E;  1KYQ A;  4DR6 E;  4JI3 E;  1X49 A;  1EKZ A;  4O4K A;  1X6H A;  2IHR 1;  1GTK A;  5T6J A;  4R2Q A;  1FKA E;  1AH5 A;  2JVA A;  3EPK A;  2EOH A;  2EPK X;  3VK6 A;  4DUZ E;  2EM7 A;  2RQL A;  1F2I G;  2EOZ A;  3K6Q A;  4JI1 E;  4LFB E;  3C6K A;  1SFE A;  4ZYD A;  1YSA C;  5IWA E;  2EP3 A;  3KZZ A;  2JWO A;  2JR1 A;  4ZYG A;  1ZU1 A;  2ENC A;  4LF8 E;  1IBL E;  2EMH A;  2EOR A;  3C4B A;  3THO B;  2KON A;  4L8N A;  1JK1 A;  2WCC 3;  2YRK A;  4B3T E;  4WXD A;  5AE2 A;  1L4S A;  1PDA A;  2DLQ A;  2EOQ A;  2EN4 A;  1A1J A;  1N32 E;  2YTE A;  2RSM A;  4LF9 E;  1EH7 A;  4X9J A;  4DV7 E;  4KWY A;  2EN3 A;  2YTI A;  4X8W A;  4BCA A;  3VYX A;  5IXM B;  3HQ1 A;  2EMC A;  5A6K A;  4DV6 E;  2YTF A;  2ODR C;  3HTX A;  2MKN A;  1ZR9 A;  2DB2 A;  4F9C B;  1A1H A;  2JOB A;  4F9B B;  2EPO A;  3M99 B;  2EL5 A;  3EQ1 A;  1X6E A;  4WSG A;  2KOU A;  3EPH A;  4P7D A;  1XMO E;  4M2Z A;  2YWQ A;  2EMZ A;  2ZM6 E;  4JI2 E;  4IS1 C;  4R2P A;  4LFA E;  2NA2 A;  4NXN E;  2I13 A;  2LTS A;  1N33 E;  2MC6 A;  2DRP A;  4JI5 E;  3J7Y p;  1T39 A;  3ADJ A;  1PJQ A;  4YY3 E;  2N8X A;  1UN6 B;  1N36 E;  2ELY A;  2EN7 A;  3T1Y E;  3L00 A;  4AQY E;  3AUZ A;  2L2M A;  2NUG A;  2B3T B;  4DR7 E;  2EPX A;  5AAS A;  2LO3 A;  5DNY A;  2BBG A;  4B3M E;  2M4I A;  2YU8 A;  2EN1 A;  2D9H A;  2NAB A;  2RS6 A;  4F2J C;  2EMX A;  3C4T A;  1YYO A;  2K4V A;  1I94 E;  1RMD A;  1N34 E;  4K0K E;  4F9A B;  2EN6 A;  2EM2 A;  2UXD E;  2ODR D;  1TF3 A;  2EMI A;  2EN8 A;  2YTO A;  2UXB E;  1WXR A;  4JV5 E;  2EML A;  1MEY C;  5LLQ A;  5KL4 A;  4GEQ B;  5A6J A;  4LF4 E;  4HTG A;  1WHN A;  1FJG E;  2G7H A;  2EOF A;  1NEI A;  1PJT A;  2YRH A;  4JI0 E;  1IQO A;  1X47 A;  1IMU A;  5A2Q C;  2VF1 A;  1YUI A;  2HGH A;  4R2R A;  4NZV A;  4L5N C;  5AC5 A;  5KL5 A;  5KL6 A;  3P1X A;  4BBY A;  2V85 A;  2FV4 B;  2ENA A;  2EPU A;  1QNT A;  2LV2 A;  4LF7 E;  2B9D A;  1A1G A;  2GLI A;  3JU0 A;  2L33 A;  5A6B D;  3ECR A;  2EJ4 A;  2ENH A;  2CPN A;  3HPS A;  3LLH A;  5IV8 B;  2EPM X;  2EQ1 A;  2LUQ A;  2DSY A;  4WSP A;  3MHH C;  1ZBQ A;  3MHS C;  3ZOQ B;  1YFH A;  1X48 A;  3FIG A;  3BID A;  1UBD C;  5KL3 A;  4RHB B;  2EM8 A;  4M9V C;  2HHH E;  4P78 A;  2GPI A;  3BGH A;  4JI8 E;  5FLX C;  2EOM A;  1X6F A;  3UK3 C;  4F6N A;  4N4R B;  1EH8 A;  3IWC A;  1JK2 A;  1YUJ A;  4WYQ B;  1X5W A;  4DR2 E;  4GKJ E;  1BBG A;  5BR8 E;  3J80 C;  4Q35 B;  2YTJ A;  4X66 E;  4KZS A;  2LE2 A;  5TSE A;  4TUG A;  1PKP A;  2EPZ A;  2EWL A;  1IBK E;  1B69 A;  5ADZ A;  2E72 A;  4WPY A;  4LF5 E;  2EM6 A;  2EPP A;  2L3J A;  2NUE A;  2JP9 A;  3VHT B;  4X65 E;  3J7A G;  4O43 A;  2Q8U A;  4ZYH A;  1HNW E;  1MGT A;  3VYY A;  1UHZ A;  2UUB E;  1A1K A;  1T4N A;  2L6M A;  4WFT A;  1GZ6 A;  1HR0 E;  2EQ0 A;  3HXL A;  5LL6 R;  4R2D A;  3EPJ A;  4BMJ A;  1LLM C;  2YZT A;  1G2D C;  2YTG A;  2V86 A;  4LF6 E;  2H36 X; 
#chains in the Genus database with same CATH homology
 1X3C A;  1ZU1 A;  2ENC A;  2YRM A;  2LT7 A;  1BB8 A;  2CSH A;  2EOF A;  2BB8 A;  2EMH A;  2EOR A;  2LVH A;  2YRH A;  2YTN A;  4GZN C;  1TN9 A;  1YUI A;  1JK1 A;  2WCC 3;  2HGH A;  4R2R A;  2YRK A;  1A1L A;  2WBU A;  2YTD A;  1P47 A;  5KL5 A;  2RSI A;  5KL6 A;  2DLQ A;  2EOI A;  2EOQ A;  2EN4 A;  2DGC A;  2EMW A;  1A1J A;  2YTE A;  2EN2 A;  2RPC A;  1A1F A;  2EPU A;  2ENA A;  4X9J A;  2EN3 A;  2YTI A;  2LV2 A;  2EMC A;  4IJD A;  1A1G A;  4R2A A;  2GLI A;  1G2F C;  4R2S A;  2YTF A;  2CT1 A;  2EMA A;  1AAY A;  2EOY A;  2YTQ A;  2EJ4 A;  2MDG A;  2ENH A;  2YU5 A;  2EMK A;  2MKN A;  1ZR9 A;  2EQ1 A;  1TF6 A;  2EOE A;  2EOX A;  1A1H A;  3MHH C;  1UBD C;  3MHS C;  2WBS A;  2GHF A;  2EOO A;  3M99 B;  2EL5 A;  5KL3 A;  1X6E A;  4WSG A;  2EM8 A;  3EPH A;  2DLK A;  2EMY A;  4M9V C;  2EMZ A;  2LCE A;  4R2C A;  2J7J A;  4IS1 C;  2YSO A;  4R2P A;  1Z1B A;  1DGC A;  2I13 A;  2WBT A;  2EM0 A;  2EOM A;  4F6M A;  2CTD A;  1X6F A;  2DRP A;  1ZAA C;  2EQ3 A;  2EPC A;  3UK3 C;  1A1I A;  2M9A A;  2EM3 A;  4F6N A;  1UN6 B;  2EL4 A;  1JK2 A;  1YUJ A;  2ELY A;  2EMG A;  1X5W A;  1BBO A;  1NCS A;  2EOS A;  2EN7 A;  5KL7 A;  2EPA A;  2VRD A;  2EE8 A;  2EPR A;  2YTJ A;  2EPX A;  3EPL A;  4R2E A;  2MKD A;  2EOJ A;  2EPZ A;  2YTP A;  2EL6 A;  2LO3 A;  5KL4 A;  1B69 A;  2ADR A;  2E72 A;  2EM4 A;  5KL2 A;  2YU8 A;  2EMF A;  1KJK A;  2PRT A;  2EN1 A;  2D9H A;  2NAB A;  2R1F A;  4F2J C;  2EM6 A;  2EMX A;  2EPP A;  2JP9 A;  2A25 A;  3VHT B;  1RMD A;  2EM9 A;  2ELZ A;  1X6H A;  2EN6 A;  4R2Q A;  2EM2 A;  2EMB A;  1A1K A;  1TF3 A;  2DMI A;  2EMI A;  2EN8 A;  2YTO A;  1WJP A;  3EPK A;  2EOH A;  2EQ0 A;  4R2D A;  3EPJ A;  2YSP A;  1LLM C;  2EM7 A;  1F2I G;  2EOZ A;  4FK5 C;  2EML A;  1G2D C;  2YTG A;  2JPA A;  1YSA C;  1MEY C;  2EM5 A;  2EP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...