2LT7A

Solution nmr structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
ANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
molecule keywords Transcriptional regulator Kaiso
total genus 31
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lt7A02
2YRMA 2ENAA 2ENCA 3M99B 2EMZA 2ELZA 3EPKA 1RMDA 2GHFA 2LVHA 2EMCA 2YRHA 2EMYA 2EM9A 2YSOA 2WCC3 1WJPA 2EM3A 2EJ4A 2DLQA 2EMHA 2EOJA 2MKDA 2EMKA 2DRPA 4R2SA 1F2IG 4GZNC 1ZAAC 2EN6A 3VHTB 1TF3A 4IJDA 1G2DC 4F2JC 5KL6A 4R2RA 2EN2A 1X6FA 2YTEA 2DGCA 2EOQA 2HGHA 2YTPA 1A1LA 4IS1C 3UK3C 1DGCA 2EL6A 2MDGA 2EOOA 2MKNA 2EOSA 2EN8A 2J7JA 4FK5C 5KL5A 1G2FC 1YUIA 2EE8A 1KJKA 2EOZA 2EN3A 3MHHC 2EM6A 2WBSA 2LO3A 4F6MA 1A1JA 1TF6A 2EM8A 2YTDA 2EMLA 2EOHA 2ADRA 1MEYC 1A1GA 1X3CA 2EMAA 2EMFA 2VRDA 4R2CA 2M9AA 2EOYA 2WBTA 2D9HA 2EL5A 2LCEA 2R1FA 4R2DA 2EPPA 2EQ1A 2EOFA 5KL3A 2EQ0A 2LV2A 2YTJA 3EPJA 1A1IA 2EM7A 3EPLA 2EN4A 5KL2A 1LLMC 1UN6B 2YU5A 3EPHA 2PRTA 1X6EA 2YTIA 1X5WA 2JP9A 1A1HA 2A25A 2EM4A 2LT7A 1UBDC 4R2PA 1Z1BA 1X6HA 2BB8A 2YSPA 2DMIA 2EL4A 2EM2A 2EN7A 2YTQA 2EOXA 2EOIA 2E72A 4M9VC 2CTDA 2EMBA 4WSGA 2EP3A 2CSHA 2EOEA 2ENHA 1P47A 1A1FA 2RSIA 2YTGA 2EMGA 2DLKA 4R2EA 2RPCA 5KL4A 2EPZA 2YRKA 2EPUA 1JK1A 2WBUA 2EN1A 2EORA 2I13A 3MHSC 2EPAA 2GLIA 2CT1A 1JK2A 2EPCA 1YUJA 2YTNA 1NCSA 2EMIA 2EM5A 4X9JA 1YSAC 2EPRA 1BBOA 2EMWA 2EQ3A 1TN9A 4R2QA 4F6NA 2EOMA 1BB8A 2YU8A 2JPAA 5KL7A 1A1KA 2EM0A 4R2AA 1ZR9A 2NABA 1AAYA 2EMXA 2YTOA 2ELYA 2YTFA 2EPXA 1B69A 1ZU1A
chains in the Genus database with same CATH superfamily
5A69A 2ENCA 3K6QA 1RMDA 2GHFA 2EM9A 2UXBE 1YPNA 2EM3A 3T1HE 4BBYA 4J8ZA 2L2NA 3AV0A 3VHTB 2UXCE 4TUIA 3C6MA 2BBGA 2JWOA 3ADJA 2EOOA 3IWBA 1IQSA 4JI2E 2V8QB 2EE8A 2WBSA 2EN3A 2RQLA 1T38A 1EKZA 4LF7E 5LMNE 1DQ3A 3THNA 3HQ1A 3ADIA 4NZVA 4BHCA 3IWDA 2L3CA 2L2KB 4DR3E 2EOYA 2D9HA 3DJWA 5AE1A 4R2DA 2EWLA 2EQ1A 1N36E 3EPLA 2EN4A 3IWCA 2PRTA 2NUEA 4B3SE 3HTXA 5A2QC 3C4TA 4P7DA 2A25A 2JY9A 2LT7A 5IV8B 1Z1BA 2NUGA 3QG5C 4RHBB 2EPOA 4F9BB 2EL4A 4F9CB 2DIXA 3KZZA 2H36X 2EMBA 4WSGA 2K4VA 2NA2A 2YTGA 1HNWE 2LTSA 2DLKA 3VYYA 2LRSA 3KWRA 2B9DA 1J5EE 4OX9E 2V86A 2EPZA 2YRKA 2EPUA 2I13A 2FGGA 3MHSC 2EPAA 3MSWA 1JK2A 5AC4A 2EM5A 4X9JA 4Q35B 4DR4E 1TN9A 2M1SA 2EOMA 1N3GA 2JPAA 2EM0A 3P1XA 5IXMB 3C4BA 2N3HA 1ZR9A 4O4KA 4BMJA 4M30A 1O0WA 4MLVA 3OMLA 1SR9A 2EPMX 5AASA 3M99B 5ADZA 2V87A 2EMZA 3BGHA 3EPKA 1DI2A 2LVHA 1HR0E 2E1MA 4R03A 2WCC3 5A6AA 2EJ4A 2DLQA 4DMIA 2EOJA 2MKDA 3J7Yp 2EMKA 2UXDE 4R2SA 1F2IG 1PJTA 3JTZA 4KHPE 1ZAAC 2JVAA 4F2JC 5KL6A 1T39A 1ZBQA 1X6FA 2CPNA 4GEQB 4WFTA 4IS1C 1A1LA 3UK3C 4M2ZA 2ZM6E 1XMOE 4FK5C 1KYQA 4Q28A 1G2FC 1UHZA 2EOZA 4LF4E 4F6MA 4L5NC 3VK6A 1TF6A 1L4SA 4JV5E 1XMQE 2EMLA 2EOHA 5AE2A 2L33A 3ECRA 4LFAE 3EQ1A 4LF8E 2EMAA 4R2CA 4WYQB 2M9AA 4BCAA 2WBTA 2K7IA 3C6KA 5KL3A 2EQ0A 2YT4A 2RTXA 4DR2E 2LBSB 2EPKX 1PDAA 2LJUA 2YU5A 1UILA 2B7TA 1X5WA 3TQMA 2MC5A 5FLXC 3THOB 2IHR1 1UBDC 4R2PA 2V89A 1X6HA 1QNTA 2F8BA 4HEIA 4BS9A 1XNQE 5AC5A 2YTQA 4O5GA 4X8WA 2FTXB 1YFHA 4TUGA 2CSHA 2ENHA 5TSEA 1A1FA 2UUCE 3HXLA 3J7AG 2V85A 4JYAE 4JI6E 1AH5A 2RPCA 4NHRA 5KL4A 3BBGA 4R8OA 4BC9A 2EN1A 4DUZE 1WXRA 3ZOQB 2B7VA 1FKAE 2Q8UA 2EPCA 2RS7A 2YTNA 1NCSA 1EH8A 2EPRA 2HC5A 2LJHA 4F6NA 2YWQA 2G7HA 1IBLE 5KL7A 4WXCA 1A1KA 2WZOA 4HTGA 4R2AA 4ZYGA 3J80C 1T4OA 2EMXA 2YPNA 2ELYA 2YTFA 1EH6A 3HPSA 2EPXA 1ZU1A 3VYXA 2ODRC 1X48A 4LF5E 3RMPA 2M4IA 2ELZA 1J26A 2YSOA 4JI1E 1WJPA 3DF6A 4YY3E 4K0KE 3T1YE 3BF2A 2GPIA 4GZNC 2EN6A 4OOGC 1TF3A 4IJDA 1G2DC 2RS6A 4R2RA 4YHHE 2EN2A 2YTEA 2DGCA 2HGHA 4ZYEA 2YTPA 4BHBA 1DGCA 2MDGA 2MKNA 1ZBTA 2EOSA 3LMLA 5KL5A 1STUA 2EM6A 2LO3A 4KWYA 5LMUE 2MC6A 1HNZE 2ADRA 5A6BA 1MEYC 4L8NA 1X3CA 2L92A 4JI5E 4DR1E 4DV1E 4LU9A 1IMUA 2EMFA 2VRDA 1IBKE 1X47A 4LF6E 4ZYHA 2R1FA 3L00A 2EPPA 2FV4B 2EOFA 4LFBE 2YTJA 2DB2A 2LV2A 3EPJA 1RQ0A 2EM7A 4B3RE 4DR6E 2JOBA 5A6JA 1WRJA 5KL2A 1I94E 1LLMC 1UN6B 3EPHA 1RC7A 1X6EA 2DSYA 4DV7E 2F4VE 1A1HA 2EM4A 4P78A 5DNYA 2JOXA 1GZ6A 1SFEA 2BB8A 2YSPA 4O43A 2R76A 2EN7A 2MDRA 3LLHA 2EOIA 2E72A 4LF9E 2CTDA 4O24A 2N3GA 4JI8E 2EP3A 2DMYA 2RSIA 2HJJA 4MLQA 2LUPB 4X65E 4DV0E 1JK1A 1HNXE 1GQEA 2EORA 2VF1A 3BIDA 4BC7A 1YSAC 1BBOA 4RH8A 4WX9A 1N34E 2EMWA 2EQ3A 4R2QA 5A6KA 3ADGA 1BB8A 1XNRE 1X49A 2I9IA 4B3TE 1AAYA 1YZ9A 4WSPA 3JAMC 5LLQA 4DV3E 1B69A 1WHNA 2YRMA 2ENAA 4DV2E 2KHXA 2EMCA 2LMZA 2YRHA 2EMYA 3JU0A 4LTYA 4GKJE 5IT9C 2YZTA 2EMHA 4JI7E 3AUZA 2DRPA 2JYAA 2LUQA 1FJGE 1GTKA 1PJSA 3H09A 4DV6E 2M7QA 1WHQA 2EOQA 2KONA 1MGTA 3ADLA 5AE3A 2EL6A 4WPYA 2EN8A 2UUBE 2V83A 2J7JA 1YUIA 1KJKA 3MHHC 1A1JA 1QU6A 2EM8A 4DR5E 2YTDA 4X66E 1IQOA 1PJQA 1A1GA 4B3ME 1T4NA 4JI0E 5LL6R 2L2MA 4F9AB 4GKKE 5IWAE 4DV4E 2EL5A 2LCEA 5A6BD 2E5LE 2EPLX 2V88A 4I8OA 2JR1A 1A1IA 4DKKA 2LE2A 1T4LB 2RSMA 4DV5E 4KZSA 3KZYA 3FIGA 2YTIA 2JP9A 2VQFE 1YYWA 4F54A 4NXNE 4N4RB 1YYKA 3F6HA 5T6JA 5F3WA 2EPNA 2DMIA 2EM2A 1IBME 1N33E 1BBGA 2B3TB 5BR8E 4DR7E 2EOXA 4ZYDA 2N8XA 4X64E 4M9VC 1YYOA 2L8TA 2EOEA 1P47A 2HHHE 1PKPA 2EMGA 2VQEE 2LTRA 2VE7C 4R2EA 4DUYE 4JI4E 4NXME 2UUAE 3J81C 2WBUA 3OTOE 4WXDA 4M0VA 2GLIA 2CT1A 3F6GA 3HPZA 1YUJA 2KOUA 2JXPA 1EH7A 2EMIA 1N32E 2L6MA 2UU9E 2YU8A 2NUFA 1NEIA 4X62E 4AQYE 2NABA 2L3JA 2EZ6A 2YTOA 2ODRD 4JI3E 4LFCE 5CFFE
chains in the Genus database with same CATH topology
2YRMA 2ENAA 2ENCA 3M99B 2EMZA 2ELZA 3EPKA 1RMDA 2GHFA 2LVHA 2EMCA 2YRHA 2EMYA 2EM9A 2YSOA 2WCC3 1WJPA 2EM3A 2EJ4A 2DLQA 2EMHA 2EOJA 2MKDA 2EMKA 2DRPA 4R2SA 1F2IG 4GZNC 1ZAAC 2EN6A 3VHTB 1TF3A 4IJDA 1G2DC 4F2JC 5KL6A 4R2RA 2EN2A 1X6FA 2YTEA 2DGCA 2EOQA 2HGHA 2YTPA 1A1LA 4IS1C 3UK3C 1DGCA 2EL6A 2MDGA 2EOOA 2MKNA 2EOSA 2EN8A 2J7JA 4FK5C 5KL5A 1G2FC 1YUIA 2EE8A 1KJKA 2EOZA 2EN3A 3MHHC 2EM6A 2WBSA 2LO3A 4F6MA 1A1JA 1TF6A 2EM8A 2YTDA 2EMLA 2EOHA 2ADRA 1MEYC 1A1GA 1X3CA 2EMAA 2EMFA 2VRDA 4R2CA 2M9AA 2EOYA 2WBTA 2D9HA 2EL5A 2LCEA 2R1FA 4R2DA 2EPPA 2EQ1A 2EOFA 5KL3A 2EQ0A 2LV2A 2YTJA 3EPJA 1A1IA 2EM7A 3EPLA 2EN4A 5KL2A 1LLMC 1UN6B 2YU5A 3EPHA 2PRTA 1X6EA 2YTIA 1X5WA 2JP9A 1A1HA 2A25A 2EM4A 2LT7A 1UBDC 4R2PA 1Z1BA 1X6HA 2BB8A 2YSPA 2DMIA 2EL4A 2EM2A 2EN7A 2YTQA 2EOXA 2EOIA 2E72A 4M9VC 2CTDA 2EMBA 4WSGA 2EP3A 2CSHA 2EOEA 2ENHA 1P47A 1A1FA 2RSIA 2YTGA 2EMGA 2DLKA 4R2EA 2RPCA 5KL4A 2EPZA 2YRKA 2EPUA 1JK1A 2WBUA 2EN1A 2EORA 2I13A 3MHSC 2EPAA 2GLIA 2CT1A 1JK2A 2EPCA 1YUJA 2YTNA 1NCSA 2EMIA 2EM5A 4X9JA 1YSAC 2EPRA 1BBOA 2EMWA 2EQ3A 1TN9A 4R2QA 4F6NA 2EOMA 1BB8A 2YU8A 2JPAA 5KL7A 1A1KA 2EM0A 4R2AA 1ZR9A 2NABA 1AAYA 2EMXA 2YTOA 2ELYA 2YTFA 2EPXA 1B69A 1ZU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRM A;  2ENA A;  2ENC A;  3M99 B;  2EMZ A;  2ELZ A;  3EPK A;  1RMD A;  2GHF A;  2LVH A;  2EMC A;  2YRH A;  2EMY A;  2EM9 A;  2YSO A;  2WCC 3;  1WJP A;  2EM3 A;  2EJ4 A;  2DLQ A;  2EMH A;  2EOJ A;  2MKD A;  2EMK A;  2DRP A;  4R2S A;  1F2I G;  4GZN C;  1ZAA C;  2EN6 A;  3VHT B;  1TF3 A;  4IJD A;  1G2D C;  4F2J C;  5KL6 A;  4R2R A;  2EN2 A;  1X6F A;  2YTE A;  2DGC A;  2EOQ A;  2HGH A;  2YTP A;  1A1L A;  4IS1 C;  3UK3 C;  1DGC A;  2EL6 A;  2MDG A;  2EOO A;  2MKN A;  2EOS A;  2EN8 A;  2J7J A;  4FK5 C;  5KL5 A;  1G2F C;  1YUI A;  2EE8 A;  1KJK A;  2EOZ A;  2EN3 A;  3MHH C;  2EM6 A;  2WBS A;  2LO3 A;  4F6M A;  1A1J A;  1TF6 A;  2EM8 A;  2YTD A;  2EML A;  2EOH A;  2ADR A;  1MEY C;  1A1G A;  1X3C A;  2EMA A;  2EMF A;  2VRD A;  4R2C A;  2M9A A;  2EOY A;  2WBT A;  2D9H A;  2EL5 A;  2LCE A;  2R1F A;  4R2D A;  2EPP A;  2EQ1 A;  2EOF A;  5KL3 A;  2EQ0 A;  2LV2 A;  2YTJ A;  3EPJ A;  1A1I A;  2EM7 A;  3EPL A;  2EN4 A;  5KL2 A;  1LLM C;  1UN6 B;  2YU5 A;  3EPH A;  2PRT A;  1X6E A;  2YTI A;  1X5W A;  2JP9 A;  1A1H A;  2A25 A;  2EM4 A;  2LT7 A;  1UBD C;  4R2P A;  1Z1B A;  1X6H A;  2BB8 A;  2YSP A;  2DMI A;  2EL4 A;  2EM2 A;  2EN7 A;  2YTQ A;  2EOX A;  2EOI A;  2E72 A;  4M9V C;  2CTD A;  2EMB A;  4WSG A;  2EP3 A;  2CSH A;  2EOE A;  2ENH A;  1P47 A;  1A1F A;  2RSI A;  2YTG A;  2EMG A;  2DLK A;  4R2E A;  2RPC A;  5KL4 A;  2EPZ A;  2YRK A;  2EPU A;  1JK1 A;  2WBU A;  2EN1 A;  2EOR A;  2I13 A;  3MHS C;  2EPA A;  2GLI A;  2CT1 A;  1JK2 A;  2EPC A;  1YUJ A;  2YTN A;  1NCS A;  2EMI A;  2EM5 A;  4X9J A;  1YSA C;  2EPR A;  1BBO A;  2EMW A;  2EQ3 A;  1TN9 A;  4R2Q A;  4F6N A;  2EOM A;  1BB8 A;  2YU8 A;  2JPA A;  5KL7 A;  1A1K A;  2EM0 A;  4R2A A;  1ZR9 A;  2NAB A;  1AAY A;  2EMX A;  2YTO A;  2ELY A;  2YTF A;  2EPX A;  1B69 A;  1ZU1 A; 
#chains in the Genus database with same CATH topology
 5A69 A;  2ENC A;  3K6Q A;  1RMD A;  2GHF A;  2EM9 A;  2UXB E;  1YPN A;  2EM3 A;  3T1H E;  4BBY A;  4J8Z A;  2L2N A;  3AV0 A;  3VHT B;  2UXC E;  4TUI A;  3C6M A;  2BBG A;  2JWO A;  3ADJ A;  2EOO A;  3IWB A;  1IQS A;  4JI2 E;  2V8Q B;  2EE8 A;  2WBS A;  2EN3 A;  2RQL A;  1T38 A;  1EKZ A;  4LF7 E;  5LMN E;  1DQ3 A;  3THN A;  3HQ1 A;  3ADI A;  4NZV A;  4BHC A;  3IWD A;  2L3C A;  2L2K B;  4DR3 E;  2EOY A;  2D9H A;  3DJW A;  5AE1 A;  4R2D A;  2EWL A;  2EQ1 A;  1N36 E;  3EPL A;  2EN4 A;  3IWC A;  2PRT A;  2NUE A;  4B3S E;  3HTX A;  5A2Q C;  3C4T A;  4P7D A;  2A25 A;  2JY9 A;  2LT7 A;  5IV8 B;  1Z1B A;  2NUG A;  3QG5 C;  4RHB B;  2EPO A;  4F9B B;  2EL4 A;  4F9C B;  2DIX A;  3KZZ A;  2H36 X;  2EMB A;  4WSG A;  2K4V A;  2NA2 A;  2YTG A;  1HNW E;  2LTS A;  2DLK A;  3VYY A;  2LRS A;  3KWR A;  2B9D A;  1J5E E;  4OX9 E;  2V86 A;  2EPZ A;  2YRK A;  2EPU A;  2I13 A;  2FGG A;  3MHS C;  2EPA A;  3MSW A;  1JK2 A;  5AC4 A;  2EM5 A;  4X9J A;  4Q35 B;  4DR4 E;  1TN9 A;  2M1S A;  2EOM A;  1N3G A;  2JPA A;  2EM0 A;  3P1X A;  5IXM B;  3C4B A;  2N3H A;  1ZR9 A;  4O4K A;  4BMJ A;  4M30 A;  1O0W A;  4MLV A;  3OML A;  1SR9 A;  2EPM X;  5AAS A;  3M99 B;  5ADZ A;  2V87 A;  2EMZ A;  3BGH A;  3EPK A;  1DI2 A;  2LVH A;  1HR0 E;  2E1M A;  4R03 A;  2WCC 3;  5A6A A;  2EJ4 A;  2DLQ A;  4DMI A;  2EOJ A;  2MKD A;  3J7Y p;  2EMK A;  2UXD E;  4R2S A;  1F2I G;  1PJT A;  3JTZ A;  4KHP E;  1ZAA C;  2JVA A;  4F2J C;  5KL6 A;  1T39 A;  1ZBQ A;  1X6F A;  2CPN A;  4GEQ B;  4WFT A;  4IS1 C;  1A1L A;  3UK3 C;  4M2Z A;  2ZM6 E;  1XMO E;  4FK5 C;  1KYQ A;  4Q28 A;  1G2F C;  1UHZ A;  2EOZ A;  4LF4 E;  4F6M A;  4L5N C;  3VK6 A;  1TF6 A;  1L4S A;  4JV5 E;  1XMQ E;  2EML A;  2EOH A;  5AE2 A;  2L33 A;  3ECR A;  4LFA E;  3EQ1 A;  4LF8 E;  2EMA A;  4R2C A;  4WYQ B;  2M9A A;  4BCA A;  2WBT A;  2K7I A;  3C6K A;  5KL3 A;  2EQ0 A;  2YT4 A;  2RTX A;  4DR2 E;  2LBS B;  2EPK X;  1PDA A;  2LJU A;  2YU5 A;  1UIL A;  2B7T A;  1X5W A;  3TQM A;  2MC5 A;  5FLX C;  3THO B;  2IHR 1;  1UBD C;  4R2P A;  2V89 A;  1X6H A;  1QNT A;  2F8B A;  4HEI A;  4BS9 A;  1XNQ E;  5AC5 A;  2YTQ A;  4O5G A;  4X8W A;  2FTX B;  1YFH A;  4TUG A;  2CSH A;  2ENH A;  5TSE A;  1A1F A;  2UUC E;  3HXL A;  3J7A G;  2V85 A;  4JYA E;  4JI6 E;  1AH5 A;  2RPC A;  4NHR A;  5KL4 A;  3BBG A;  4R8O A;  4BC9 A;  2EN1 A;  4DUZ E;  1WXR A;  3ZOQ B;  2B7V A;  1FKA E;  2Q8U A;  2EPC A;  2RS7 A;  2YTN A;  1NCS A;  1EH8 A;  2EPR A;  2HC5 A;  2LJH A;  4F6N A;  2YWQ A;  2G7H A;  1IBL E;  5KL7 A;  4WXC A;  1A1K A;  2WZO A;  4HTG A;  4R2A A;  4ZYG A;  3J80 C;  1T4O A;  2EMX A;  2YPN A;  2ELY A;  2YTF A;  1EH6 A;  3HPS A;  2EPX A;  1ZU1 A;  3VYX A;  2ODR C;  1X48 A;  4LF5 E;  3RMP A;  2M4I A;  2ELZ A;  1J26 A;  2YSO A;  4JI1 E;  1WJP A;  3DF6 A;  4YY3 E;  4K0K E;  3T1Y E;  3BF2 A;  2GPI A;  4GZN C;  2EN6 A;  4OOG C;  1TF3 A;  4IJD A;  1G2D C;  2RS6 A;  4R2R A;  4YHH E;  2EN2 A;  2YTE A;  2DGC A;  2HGH A;  4ZYE A;  2YTP A;  4BHB A;  1DGC A;  2MDG A;  2MKN A;  1ZBT A;  2EOS A;  3LML A;  5KL5 A;  1STU A;  2EM6 A;  2LO3 A;  4KWY A;  5LMU E;  2MC6 A;  1HNZ E;  2ADR A;  5A6B A;  1MEY C;  4L8N A;  1X3C A;  2L92 A;  4JI5 E;  4DR1 E;  4DV1 E;  4LU9 A;  1IMU A;  2EMF A;  2VRD A;  1IBK E;  1X47 A;  4LF6 E;  4ZYH A;  2R1F A;  3L00 A;  2EPP A;  2FV4 B;  2EOF A;  4LFB E;  2YTJ A;  2DB2 A;  2LV2 A;  3EPJ A;  1RQ0 A;  2EM7 A;  4B3R E;  4DR6 E;  2JOB A;  5A6J A;  1WRJ A;  5KL2 A;  1I94 E;  1LLM C;  1UN6 B;  3EPH A;  1RC7 A;  1X6E A;  2DSY A;  4DV7 E;  2F4V E;  1A1H A;  2EM4 A;  4P78 A;  5DNY A;  2JOX A;  1GZ6 A;  1SFE A;  2BB8 A;  2YSP A;  4O43 A;  2R76 A;  2EN7 A;  2MDR A;  3LLH A;  2EOI A;  2E72 A;  4LF9 E;  2CTD A;  4O24 A;  2N3G A;  4JI8 E;  2EP3 A;  2DMY A;  2RSI A;  2HJJ A;  4MLQ A;  2LUP B;  4X65 E;  4DV0 E;  1JK1 A;  1HNX E;  1GQE A;  2EOR A;  2VF1 A;  3BID A;  4BC7 A;  1YSA C;  1BBO A;  4RH8 A;  4WX9 A;  1N34 E;  2EMW A;  2EQ3 A;  4R2Q A;  5A6K A;  3ADG A;  1BB8 A;  1XNR E;  1X49 A;  2I9I A;  4B3T E;  1AAY A;  1YZ9 A;  4WSP A;  3JAM C;  5LLQ A;  4DV3 E;  1B69 A;  1WHN A;  2YRM A;  2ENA A;  4DV2 E;  2KHX A;  2EMC A;  2LMZ A;  2YRH A;  2EMY A;  3JU0 A;  4LTY A;  4GKJ E;  5IT9 C;  2YZT A;  2EMH A;  4JI7 E;  3AUZ A;  2DRP A;  2JYA A;  2LUQ A;  1FJG E;  1GTK A;  1PJS A;  3H09 A;  4DV6 E;  2M7Q A;  1WHQ A;  2EOQ A;  2KON A;  1MGT A;  3ADL A;  5AE3 A;  2EL6 A;  4WPY A;  2EN8 A;  2UUB E;  2V83 A;  2J7J A;  1YUI A;  1KJK A;  3MHH C;  1A1J A;  1QU6 A;  2EM8 A;  4DR5 E;  2YTD A;  4X66 E;  1IQO A;  1PJQ A;  1A1G A;  4B3M E;  1T4N A;  4JI0 E;  5LL6 R;  2L2M A;  4F9A B;  4GKK E;  5IWA E;  4DV4 E;  2EL5 A;  2LCE A;  5A6B D;  2E5L E;  2EPL X;  2V88 A;  4I8O A;  2JR1 A;  1A1I A;  4DKK A;  2LE2 A;  1T4L B;  2RSM A;  4DV5 E;  4KZS A;  3KZY A;  3FIG A;  2YTI A;  2JP9 A;  2VQF E;  1YYW A;  4F54 A;  4NXN E;  4N4R B;  1YYK A;  3F6H A;  5T6J A;  5F3W A;  2EPN A;  2DMI A;  2EM2 A;  1IBM E;  1N33 E;  1BBG A;  2B3T B;  5BR8 E;  4DR7 E;  2EOX A;  4ZYD A;  2N8X A;  4X64 E;  4M9V C;  1YYO A;  2L8T A;  2EOE A;  1P47 A;  2HHH E;  1PKP A;  2EMG A;  2VQE E;  2LTR A;  2VE7 C;  4R2E A;  4DUY E;  4JI4 E;  4NXM E;  2UUA E;  3J81 C;  2WBU A;  3OTO E;  4WXD A;  4M0V A;  2GLI A;  2CT1 A;  3F6G A;  3HPZ A;  1YUJ A;  2KOU A;  2JXP A;  1EH7 A;  2EMI A;  1N32 E;  2L6M A;  2UU9 E;  2YU8 A;  2NUF A;  1NEI A;  4X62 E;  4AQY E;  2NAB A;  2L3J A;  2EZ6 A;  2YTO A;  2ODR D;  4JI3 E;  4LFC E;  5CFF E; 
#chains in the Genus database with same CATH homology
 2YRM A;  2ENA A;  2ENC A;  3M99 B;  2EMZ A;  2ELZ A;  3EPK A;  1RMD A;  2GHF A;  2LVH A;  2EMC A;  2YRH A;  2EMY A;  2EM9 A;  2YSO A;  2WCC 3;  1WJP A;  2EM3 A;  2EJ4 A;  2DLQ A;  2EMH A;  2EOJ A;  2MKD A;  2EMK A;  2DRP A;  4R2S A;  1F2I G;  4GZN C;  1ZAA C;  2EN6 A;  3VHT B;  1TF3 A;  4IJD A;  1G2D C;  4F2J C;  5KL6 A;  4R2R A;  2EN2 A;  1X6F A;  2YTE A;  2DGC A;  2EOQ A;  2HGH A;  2YTP A;  1A1L A;  4IS1 C;  3UK3 C;  1DGC A;  2EL6 A;  2MDG A;  2EOO A;  2MKN A;  2EOS A;  2EN8 A;  2J7J A;  4FK5 C;  5KL5 A;  1G2F C;  1YUI A;  2EE8 A;  1KJK A;  2EOZ A;  2EN3 A;  3MHH C;  2EM6 A;  2WBS A;  2LO3 A;  4F6M A;  1A1J A;  1TF6 A;  2EM8 A;  2YTD A;  2EML A;  2EOH A;  2ADR A;  1MEY C;  1A1G A;  1X3C A;  2EMA A;  2EMF A;  2VRD A;  4R2C A;  2M9A A;  2EOY A;  2WBT A;  2D9H A;  2EL5 A;  2LCE A;  2R1F A;  4R2D A;  2EPP A;  2EQ1 A;  2EOF A;  5KL3 A;  2EQ0 A;  2LV2 A;  2YTJ A;  3EPJ A;  1A1I A;  2EM7 A;  3EPL A;  2EN4 A;  5KL2 A;  1LLM C;  1UN6 B;  2YU5 A;  3EPH A;  2PRT A;  1X6E A;  2YTI A;  1X5W A;  2JP9 A;  1A1H A;  2A25 A;  2EM4 A;  2LT7 A;  1UBD C;  4R2P A;  1Z1B A;  1X6H A;  2BB8 A;  2YSP A;  2DMI A;  2EL4 A;  2EM2 A;  2EN7 A;  2YTQ A;  2EOX A;  2EOI A;  2E72 A;  4M9V C;  2CTD A;  2EMB A;  4WSG A;  2EP3 A;  2CSH A;  2EOE A;  2ENH A;  1P47 A;  1A1F A;  2RSI A;  2YTG A;  2EMG A;  2DLK A;  4R2E A;  2RPC A;  5KL4 A;  2EPZ A;  2YRK A;  2EPU A;  1JK1 A;  2WBU A;  2EN1 A;  2EOR A;  2I13 A;  3MHS C;  2EPA A;  2GLI A;  2CT1 A;  1JK2 A;  2EPC A;  1YUJ A;  2YTN A;  1NCS A;  2EMI A;  2EM5 A;  4X9J A;  1YSA C;  2EPR A;  1BBO A;  2EMW A;  2EQ3 A;  1TN9 A;  4R2Q A;  4F6N A;  2EOM A;  1BB8 A;  2YU8 A;  2JPA A;  5KL7 A;  1A1K A;  2EM0 A;  4R2A A;  1ZR9 A;  2NAB A;  1AAY A;  2EMX A;  2YTO A;  2ELY A;  2YTF A;  2EPX A;  1B69 A;  1ZU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...