4F2JC

Crystal structure of znf217 bound to dna, p6522 crystal form
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
molecule keywords 5'-D(*TP*TP*TP*GP*CP*AP*GP*AP*AP*TP*CP*GP*AP*TP*TP*CP*TP*GP*
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f2jC00
2EN8A 4R2DA 4R2AA 2EM2A 2YU8A 2EM4A 2R1FA 4R2SA 2YTJA 2ENCA 2DMIA 2YTQA 2EPPA 1A1KA 1BB8A 2EMWA 2EPUA 2EMHA 4R2EA 2WBUA 2EM3A 2EOMA 2EOFA 2EOZA 2YU5A 3MHSC 2YRMA 4F6NA 1A1IA 1X6FA 2EN7A 3UK3C 2EPXA 1A1GA 2JPAA 2EOIA 2CT1A 2EMFA 1JK2A 2EOYA 2EMAA 2VRDA 2EP3A 2WBSA 2EM8A 2RPCA 2EQ1A 1G2DC 2EM0A 3EPLA 1DGCA 2EPAA 2RSIA 1RMDA 2EMZA 4GZNC 2ELYA 2YTFA 4X9JA 2MKDA 4IJDA 2YTPA 2ADRA 5KL3A 1BBOA 2LO3A 2HGHA 2EQ3A 4R2PA 2EL6A 1TF6A 2YTEA 2YRHA 1B69A 2YTNA 2EN2A 3EPHA 2EOJA 2EOXA 2EN3A 2D9HA 2EOQA 1LLMC 1KJKA 2LV2A 1UBDC 2EMIA 4R2QA 2YTDA 2EM6A 4WSGA 2EN1A 4F2JC 2DLKA 2EMCA 2YTGA 1A1HA 2EL4A 1WJPA 2PRTA 1X3CA 2CTDA 2ENAA 2CSHA 3MHHC 2WBTA 1A1LA 1G2FC 5KL7A 1X6EA 2EL5A 1A1JA 2I13A 2NABA 3M99B 5KL4A 2LCEA 1JK1A 2EE8A 5KL6A 1YSAC 1ZAAC 2EPZA 2DRPA 2JP9A 3VHTB 2E72A 1F2IG 2EN4A 1ZU1A 5KL5A 1P47A 2YTOA 2EMLA 2EM7A 1AAYA 3EPJA 2EMGA 2MKNA 4M9VC 5KL2A 2LVHA 2WCC3 2DGCA 2YRKA 2J7JA 1X6HA 3EPKA 2EOOA 1A1FA 2EMYA 2EQ0A 2MDGA 2A25A 2EM9A 2ENHA 1TN9A 1UN6B 1Z1BA 2YSPA 4R2RA 2GHFA 2EOSA 2M9AA 1TF3A 1YUJA 2EMXA 2YSOA 4FK5C 2DLQA 2EM5A 2LT7A 1MEYC 4F6MA 2EMKA 2ELZA 2EJ4A 1X5WA 2GLIA 1YUIA 2EPRA 2EOHA 2EORA 1ZR9A 1NCSA 2EMBA 2EN6A 4R2CA 2BB8A 4IS1C 2EOEA 2YTIA 2EPCA
chains in the Genus database with same CATH superfamily
2YZTA 4BCAA 4L5NC 2RSMA 2YTJA 2YTQA 2EPPA 2DMYA 2EMWA 4O43A 2EPUA 3LLHA 4M0VA 4DUZE 2JOXA 4JI1E 2EOMA 2EOZA 1HNXE 2YRMA 2L2NA 1X6FA 2EPXA 4X65E 3THOB 1WRJA 3JTZA 1J5EE 2YT4A 2EP3A 2N8XA 1O0WA 1T38A 4DV1E 2EQ1A 1FJGE 3QG5C 1DGCA 1X48A 1GTKA 1IBME 2FTXB 2NUFA 2FV4B 4KZSA 4GZNC 2YTFA 4X9JA 3KZYA 4M30A 3HPZA 2EQ3A 3HPSA 2EL6A 1EH7A 2RQLA 1IBKE 1AH5A 1PJTA 2R76A 2YTEA 1T4NA 3DJWA 4DV3E 1TF6A 2YTNA 3EPHA 2EPMX 2EOXA 2D9HA 1LLMC 2NUGA 1IQSA 3C4TA 1GZ6A 2EN1A 2EL4A 2UU9E 1WJPA 2PRTA 3MSWA 1X3CA 2ENAA 1G2FC 4DKKA 5AE3A 2V86A 2V8QB 1PKPA 3JU0A 4J8ZA 2EE8A 1N32E 5F3WA 4B3ME 5KL6A 4ZYHA 1ZAAC 1N3GA 2MC5A 4LF9E 1ZU1A 4RHBB 4BC9A 4B3TE 4L8NA 4Q28A 3ZOQB 1P47A 2GPIA 5A6KA 2DIXA 2K7IA 3HQ1A 2I9IA 1AAYA 2MKNA 5KL2A 5IV8B 2UXDE 3EQ1A 1YPNA 4B3SE 2L2MA 1A1FA 2EMYA 5A2QC 2YPNA 2EM9A 2EWLA 4WPYA 4R2RA 2GHFA 3ADLA 1TF3A 4BC7A 1BBGA 2L8TA 4LU9A 2YSOA 4FK5C 2LT7A 3C4BA 2KHXA 4F6MA 3BGHA 4DV4E 1GQEA 3AV0A 1YUIA 4JI0E 1RC7A 1MGTA 2E1MA 1NCSA 2M4IA 2BB8A 1X49A 2EN8A 2YU8A 2EM4A 2R1FA 1IMUA 2ENCA 2DMIA 4WXCA 4GKJE 1NEIA 2B3TB 1YFHA 1YYKA 2WZOA 2EM3A 2EOFA 3F6HA 5BR8E 2ZM6E 2EN7A 2JY9A 1A1GA 2JPAA 2EOIA 4DV6E 4NZVA 1JK2A 2EMAA 3J80C 5A6AA 2ODRC 1G2DC 2EPAA 1X47A 2EPLX 2RSIA 3BIDA 1N34E 1RMDA 2LJUA 4DR6E 2MKDA 3VYXA 2KOUA 2ADRA 5KL3A 2V88A 1BBOA 2HGHA 4R2PA 3T1YE 2F8BA 1PJQA 1WHNA 4F9BB 3THNA 1N33E 5LLQA 4GKKE 5LMUE 1KJKA 1UBDC 4HTGA 5CFFE 4F2JC 2MDRA 1UHZA 2EPOA 2L92A 2JOBA 2JXPA 2CTDA 2CSHA 1A1LA 1L4SA 5KL7A 1XNRE 4KHPE 4F9CB 1N36E 4O4KA 1X6EA 1SFEA 4N4RB 2UUCE 5A6BD 1YYOA 2V83A 5T6JA 3M99B 2V87A 4ZYEA 2HHHE 4YHHE 1STUA 2E72A 2EN4A 1HNWE 4LTYA 4WXDA 2EMLA 5LL6R 4KWYA 2HJJA 3EPJA 4X62E 1ZBTA 3T1HE 2YRKA 3EPKA 4LF7E 3L00A 3ECRA 2JR1A 1EKZA 2EPNA 4LF4E 3C6KA 3DF6A 2G7HA 4DR2E 1TN9A 4BS9A 2YSPA 4JI8E 3J7AG 2M9AA 4JI2E 2EMXA 4Q35B 2EMKA 4F9AB 1X5WA 2V85A 2LE2A 1ZBQA 2LJHA 4R8OA 4JI5E 1ZR9A 3F6GA 1PDAA 2EM2A 5AC4A 2L3JA 4X8WA 2LUQA 1A1KA 1BB8A 2RS6A 4R2EA 5DNYA 3TQMA 3KZZA 4LFCE 3VK6A 2JYAA 1A1IA 2IHR1 3IWBA 3IWCA 1SR9A 4I8OA 2L2KB 1EH8A 2CT1A 2LTSA 4M2ZA 1YZ9A 2EM8A 1FKAE 3EPLA 2EMZA 1T39A 2CPNA 1I94E 4IJDA 2MC6A 2YTPA 4WFTA 2LO3A 4TUGA 2L6MA 4LF8E 2YRHA 4MLQA 1B69A 2EOJA 4NXNE 2EOQA 3BBGA 2HC5A 2LV2A 2UUAE 1XMQE 2VF1A 4OOGC 4WSGA 4WYQB 2YTGA 2EMCA 1XMOE 4JI4E 5TSEA 2DSYA 4DV0E 2EPKX 3IWDA 2JWOA 2ODRD 4DR3E 3VYYA 3MHHC 2WBTA 5AC5A 3HTXA 2EL5A 5FLXC 2L3CA 4X66E 1A1JA 2NABA 5KL4A 4OX9E 4RH8A 2LCEA 2E5LE 2N3HA 1IQOA 2F4VE 4P7DA 1YSAC 3AUZA 1YYWA 2JP9A 1UILA 3VHTB 1F2IG 5KL5A 3OTOE 4DR1E 2EM7A 2EZ6A 4BHBA 2BBGA 5LMNE 4M9VC 3K6QA 2DGCA 3JAMC 2YWQA 3RMPA 2ENHA 4DR4E 4JI7E 4LFBE 1DI2A 1YUJA 1QNTA 4P78A 2LTRA 2UXBE 3FIGA 2EM5A 2NA2A 1MEYC 2ELZA 2EJ4A 4DR5E 3HXLA 4O24A 4BMJA 2EPRA 2EOHA 5IXMB 1EH6A 1WHQA 2EN6A 1WXRA 4R2CA 1T4OA 2YTIA 1IBLE 2EPCA 2VQFE 4R2DA 4R2AA 4R2SA 4NHRA 5AE1A 2EMHA 2WBUA 4B3RE 4WSPA 2UUBE 2M7QA 3H09A 4F6NA 2YU5A 3MHSC 4LF5E 2H36X 4R03A 4F54A 3UK3C 1RQ0A 1T4LB 2B7VA 2EMFA 4DUYE 4HEIA 4DV7E 2EOYA 2VRDA 2LRSA 2WBSA 4DR7E 4BBYA 5A6JA 2RS7A 5AASA 2RPCA 4JV5E 2EM0A 3ADIA 2L33A 4YY3E 2DB2A 5IWAE 2FGGA 2NUEA 2ELYA 5IT9C 2LUPB 2RTXA 1HNZE 2B9DA 1QU6A 4AQYE 2EN2A 4JI6E 2EN3A 2K4VA 5A69A 2EMIA 2JVAA 4R2QA 2KONA 2M1SA 2YTDA 2Q8UA 2EM6A 3J7Yp 2DLKA 1A1HA 4NXME 4JI3E 4DMIA 4K0KE 4GEQB 1XNQE 2VQEE 1KYQA 5AE2A 1DQ3A 4DV2E 2I13A 4ZYDA 3P1XA 3KWRA 1JK1A 3J81C 2LMZA 2EPZA 2DRPA 3ADJA 3C6MA 4BHCA 4WX9A 3LMLA 2YTOA 4MLVA 2UXCE 2EMGA 2LVHA 2WCC3 2J7JA 1X6HA 4JYAE 2EOOA 2B7TA 1J26A 4ZYGA 2EQ0A 2MDGA 2A25A 1UN6B 2VE7C 2LBSB 1Z1BA 1HR0E 2EOSA 5A6BA 2N3GA 3BF2A 4LF6E 2DLQA 4LFAE 4O5GA 1PJSA 4X64E 2GLIA 3OMLA 4DV5E 2EORA 5ADZA 4TUIA 3ADGA 2EMBA 4IS1C 2V89A 2EOEA
chains in the Genus database with same CATH topology
2EN8A 4R2DA 4R2AA 2EM2A 2YU8A 2EM4A 2R1FA 4R2SA 2YTJA 2ENCA 2DMIA 2YTQA 2EPPA 1A1KA 1BB8A 2EMWA 2EPUA 2EMHA 4R2EA 2WBUA 2EM3A 2EOMA 2EOFA 2EOZA 2YU5A 3MHSC 2YRMA 4F6NA 1A1IA 1X6FA 2EN7A 3UK3C 2EPXA 1A1GA 2JPAA 2EOIA 2CT1A 2EMFA 1JK2A 2EOYA 2EMAA 2VRDA 2EP3A 2WBSA 2EM8A 2RPCA 2EQ1A 1G2DC 2EM0A 3EPLA 1DGCA 2EPAA 2RSIA 1RMDA 2EMZA 4GZNC 2ELYA 2YTFA 4X9JA 2MKDA 4IJDA 2YTPA 2ADRA 5KL3A 1BBOA 2LO3A 2HGHA 2EQ3A 4R2PA 2EL6A 1TF6A 2YTEA 2YRHA 1B69A 2YTNA 2EN2A 3EPHA 2EOJA 2EOXA 2EN3A 2D9HA 2EOQA 1LLMC 1KJKA 2LV2A 1UBDC 2EMIA 4R2QA 2YTDA 2EM6A 4WSGA 2EN1A 4F2JC 2DLKA 2EMCA 2YTGA 1A1HA 2EL4A 1WJPA 2PRTA 1X3CA 2CTDA 2ENAA 2CSHA 3MHHC 2WBTA 1A1LA 1G2FC 5KL7A 1X6EA 2EL5A 1A1JA 2I13A 2NABA 3M99B 5KL4A 2LCEA 1JK1A 2EE8A 5KL6A 1YSAC 1ZAAC 2EPZA 2DRPA 2JP9A 3VHTB 2E72A 1F2IG 2EN4A 1ZU1A 5KL5A 1P47A 2YTOA 2EMLA 2EM7A 1AAYA 3EPJA 2EMGA 2MKNA 4M9VC 5KL2A 2LVHA 2WCC3 2DGCA 2YRKA 2J7JA 1X6HA 3EPKA 2EOOA 1A1FA 2EMYA 2EQ0A 2MDGA 2A25A 2EM9A 2ENHA 1TN9A 1UN6B 1Z1BA 2YSPA 4R2RA 2GHFA 2EOSA 2M9AA 1TF3A 1YUJA 2EMXA 2YSOA 4FK5C 2DLQA 2EM5A 2LT7A 1MEYC 4F6MA 2EMKA 2ELZA 2EJ4A 1X5WA 2GLIA 1YUIA 2EPRA 2EOHA 2EORA 1ZR9A 1NCSA 2EMBA 2EN6A 4R2CA 2BB8A 4IS1C 2EOEA 2YTIA 2EPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN8 A;  4R2D A;  4R2A A;  2EM2 A;  2YU8 A;  2EM4 A;  2R1F A;  4R2S A;  2YTJ A;  2ENC A;  2DMI A;  2YTQ A;  2EPP A;  1A1K A;  1BB8 A;  2EMW A;  2EPU A;  2EMH A;  4R2E A;  2WBU A;  2EM3 A;  2EOM A;  2EOF A;  2EOZ A;  2YU5 A;  3MHS C;  2YRM A;  4F6N A;  1A1I A;  1X6F A;  2EN7 A;  3UK3 C;  2EPX A;  1A1G A;  2JPA A;  2EOI A;  2CT1 A;  2EMF A;  1JK2 A;  2EOY A;  2EMA A;  2VRD A;  2EP3 A;  2WBS A;  2EM8 A;  2RPC A;  2EQ1 A;  1G2D C;  2EM0 A;  3EPL A;  1DGC A;  2EPA A;  2RSI A;  1RMD A;  2EMZ A;  4GZN C;  2ELY A;  2YTF A;  4X9J A;  2MKD A;  4IJD A;  2YTP A;  2ADR A;  5KL3 A;  1BBO A;  2LO3 A;  2HGH A;  2EQ3 A;  4R2P A;  2EL6 A;  1TF6 A;  2YTE A;  2YRH A;  1B69 A;  2YTN A;  2EN2 A;  3EPH A;  2EOJ A;  2EOX A;  2EN3 A;  2D9H A;  2EOQ A;  1LLM C;  1KJK A;  2LV2 A;  1UBD C;  2EMI A;  4R2Q A;  2YTD A;  2EM6 A;  4WSG A;  2EN1 A;  4F2J C;  2DLK A;  2EMC A;  2YTG A;  1A1H A;  2EL4 A;  1WJP A;  2PRT A;  1X3C A;  2CTD A;  2ENA A;  2CSH A;  3MHH C;  2WBT A;  1A1L A;  1G2F C;  5KL7 A;  1X6E A;  2EL5 A;  1A1J A;  2I13 A;  2NAB A;  3M99 B;  5KL4 A;  2LCE A;  1JK1 A;  2EE8 A;  5KL6 A;  1YSA C;  1ZAA C;  2EPZ A;  2DRP A;  2JP9 A;  3VHT B;  2E72 A;  1F2I G;  2EN4 A;  1ZU1 A;  5KL5 A;  1P47 A;  2YTO A;  2EML A;  2EM7 A;  1AAY A;  3EPJ A;  2EMG A;  2MKN A;  4M9V C;  5KL2 A;  2LVH A;  2WCC 3;  2DGC A;  2YRK A;  2J7J A;  1X6H A;  3EPK A;  2EOO A;  1A1F A;  2EMY A;  2EQ0 A;  2MDG A;  2A25 A;  2EM9 A;  2ENH A;  1TN9 A;  1UN6 B;  1Z1B A;  2YSP A;  4R2R A;  2GHF A;  2EOS A;  2M9A A;  1TF3 A;  1YUJ A;  2EMX A;  2YSO A;  4FK5 C;  2DLQ A;  2EM5 A;  2LT7 A;  1MEY C;  4F6M A;  2EMK A;  2ELZ A;  2EJ4 A;  1X5W A;  2GLI A;  1YUI A;  2EPR A;  2EOH A;  2EOR A;  1ZR9 A;  1NCS A;  2EMB A;  2EN6 A;  4R2C A;  2BB8 A;  4IS1 C;  2EOE A;  2YTI A;  2EPC A; 
#chains in the Genus database with same CATH topology
 2YZT A;  4BCA A;  4L5N C;  2RSM A;  2YTJ A;  2YTQ A;  2EPP A;  2DMY A;  2EMW A;  4O43 A;  2EPU A;  3LLH A;  4M0V A;  4DUZ E;  2JOX A;  4JI1 E;  2EOM A;  2EOZ A;  1HNX E;  2YRM A;  2L2N A;  1X6F A;  2EPX A;  4X65 E;  3THO B;  1WRJ A;  3JTZ A;  1J5E E;  2YT4 A;  2EP3 A;  2N8X A;  1O0W A;  1T38 A;  4DV1 E;  2EQ1 A;  1FJG E;  3QG5 C;  1DGC A;  1X48 A;  1GTK A;  1IBM E;  2FTX B;  2NUF A;  2FV4 B;  4KZS A;  4GZN C;  2YTF A;  4X9J A;  3KZY A;  4M30 A;  3HPZ A;  2EQ3 A;  3HPS A;  2EL6 A;  1EH7 A;  2RQL A;  1IBK E;  1AH5 A;  1PJT A;  2R76 A;  2YTE A;  1T4N A;  3DJW A;  4DV3 E;  1TF6 A;  2YTN A;  3EPH A;  2EPM X;  2EOX A;  2D9H A;  1LLM C;  2NUG A;  1IQS A;  3C4T A;  1GZ6 A;  2EN1 A;  2EL4 A;  2UU9 E;  1WJP A;  2PRT A;  3MSW A;  1X3C A;  2ENA A;  1G2F C;  4DKK A;  5AE3 A;  2V86 A;  2V8Q B;  1PKP A;  3JU0 A;  4J8Z A;  2EE8 A;  1N32 E;  5F3W A;  4B3M E;  5KL6 A;  4ZYH A;  1ZAA C;  1N3G A;  2MC5 A;  4LF9 E;  1ZU1 A;  4RHB B;  4BC9 A;  4B3T E;  4L8N A;  4Q28 A;  3ZOQ B;  1P47 A;  2GPI A;  5A6K A;  2DIX A;  2K7I A;  3HQ1 A;  2I9I A;  1AAY A;  2MKN A;  5KL2 A;  5IV8 B;  2UXD E;  3EQ1 A;  1YPN A;  4B3S E;  2L2M A;  1A1F A;  2EMY A;  5A2Q C;  2YPN A;  2EM9 A;  2EWL A;  4WPY A;  4R2R A;  2GHF A;  3ADL A;  1TF3 A;  4BC7 A;  1BBG A;  2L8T A;  4LU9 A;  2YSO A;  4FK5 C;  2LT7 A;  3C4B A;  2KHX A;  4F6M A;  3BGH A;  4DV4 E;  1GQE A;  3AV0 A;  1YUI A;  4JI0 E;  1RC7 A;  1MGT A;  2E1M A;  1NCS A;  2M4I A;  2BB8 A;  1X49 A;  2EN8 A;  2YU8 A;  2EM4 A;  2R1F A;  1IMU A;  2ENC A;  2DMI A;  4WXC A;  4GKJ E;  1NEI A;  2B3T B;  1YFH A;  1YYK A;  2WZO A;  2EM3 A;  2EOF A;  3F6H A;  5BR8 E;  2ZM6 E;  2EN7 A;  2JY9 A;  1A1G A;  2JPA A;  2EOI A;  4DV6 E;  4NZV A;  1JK2 A;  2EMA A;  3J80 C;  5A6A A;  2ODR C;  1G2D C;  2EPA A;  1X47 A;  2EPL X;  2RSI A;  3BID A;  1N34 E;  1RMD A;  2LJU A;  4DR6 E;  2MKD A;  3VYX A;  2KOU A;  2ADR A;  5KL3 A;  2V88 A;  1BBO A;  2HGH A;  4R2P A;  3T1Y E;  2F8B A;  1PJQ A;  1WHN A;  4F9B B;  3THN A;  1N33 E;  5LLQ A;  4GKK E;  5LMU E;  1KJK A;  1UBD C;  4HTG A;  5CFF E;  4F2J C;  2MDR A;  1UHZ A;  2EPO A;  2L92 A;  2JOB A;  2JXP A;  2CTD A;  2CSH A;  1A1L A;  1L4S A;  5KL7 A;  1XNR E;  4KHP E;  4F9C B;  1N36 E;  4O4K A;  1X6E A;  1SFE A;  4N4R B;  2UUC E;  5A6B D;  1YYO A;  2V83 A;  5T6J A;  3M99 B;  2V87 A;  4ZYE A;  2HHH E;  4YHH E;  1STU A;  2E72 A;  2EN4 A;  1HNW E;  4LTY A;  4WXD A;  2EML A;  5LL6 R;  4KWY A;  2HJJ A;  3EPJ A;  4X62 E;  1ZBT A;  3T1H E;  2YRK A;  3EPK A;  4LF7 E;  3L00 A;  3ECR A;  2JR1 A;  1EKZ A;  2EPN A;  4LF4 E;  3C6K A;  3DF6 A;  2G7H A;  4DR2 E;  1TN9 A;  4BS9 A;  2YSP A;  4JI8 E;  3J7A G;  2M9A A;  4JI2 E;  2EMX A;  4Q35 B;  2EMK A;  4F9A B;  1X5W A;  2V85 A;  2LE2 A;  1ZBQ A;  2LJH A;  4R8O A;  4JI5 E;  1ZR9 A;  3F6G A;  1PDA A;  2EM2 A;  5AC4 A;  2L3J A;  4X8W A;  2LUQ A;  1A1K A;  1BB8 A;  2RS6 A;  4R2E A;  5DNY A;  3TQM A;  3KZZ A;  4LFC E;  3VK6 A;  2JYA A;  1A1I A;  2IHR 1;  3IWB A;  3IWC A;  1SR9 A;  4I8O A;  2L2K B;  1EH8 A;  2CT1 A;  2LTS A;  4M2Z A;  1YZ9 A;  2EM8 A;  1FKA E;  3EPL A;  2EMZ A;  1T39 A;  2CPN A;  1I94 E;  4IJD A;  2MC6 A;  2YTP A;  4WFT A;  2LO3 A;  4TUG A;  2L6M A;  4LF8 E;  2YRH A;  4MLQ A;  1B69 A;  2EOJ A;  4NXN E;  2EOQ A;  3BBG A;  2HC5 A;  2LV2 A;  2UUA E;  1XMQ E;  2VF1 A;  4OOG C;  4WSG A;  4WYQ B;  2YTG A;  2EMC A;  1XMO E;  4JI4 E;  5TSE A;  2DSY A;  4DV0 E;  2EPK X;  3IWD A;  2JWO A;  2ODR D;  4DR3 E;  3VYY A;  3MHH C;  2WBT A;  5AC5 A;  3HTX A;  2EL5 A;  5FLX C;  2L3C A;  4X66 E;  1A1J A;  2NAB A;  5KL4 A;  4OX9 E;  4RH8 A;  2LCE A;  2E5L E;  2N3H A;  1IQO A;  2F4V E;  4P7D A;  1YSA C;  3AUZ A;  1YYW A;  2JP9 A;  1UIL A;  3VHT B;  1F2I G;  5KL5 A;  3OTO E;  4DR1 E;  2EM7 A;  2EZ6 A;  4BHB A;  2BBG A;  5LMN E;  4M9V C;  3K6Q A;  2DGC A;  3JAM C;  2YWQ A;  3RMP A;  2ENH A;  4DR4 E;  4JI7 E;  4LFB E;  1DI2 A;  1YUJ A;  1QNT A;  4P78 A;  2LTR A;  2UXB E;  3FIG A;  2EM5 A;  2NA2 A;  1MEY C;  2ELZ A;  2EJ4 A;  4DR5 E;  3HXL A;  4O24 A;  4BMJ A;  2EPR A;  2EOH A;  5IXM B;  1EH6 A;  1WHQ A;  2EN6 A;  1WXR A;  4R2C A;  1T4O A;  2YTI A;  1IBL E;  2EPC A;  2VQF E;  4R2D A;  4R2A A;  4R2S A;  4NHR A;  5AE1 A;  2EMH A;  2WBU A;  4B3R E;  4WSP A;  2UUB E;  2M7Q A;  3H09 A;  4F6N A;  2YU5 A;  3MHS C;  4LF5 E;  2H36 X;  4R03 A;  4F54 A;  3UK3 C;  1RQ0 A;  1T4L B;  2B7V A;  2EMF A;  4DUY E;  4HEI A;  4DV7 E;  2EOY A;  2VRD A;  2LRS A;  2WBS A;  4DR7 E;  4BBY A;  5A6J A;  2RS7 A;  5AAS A;  2RPC A;  4JV5 E;  2EM0 A;  3ADI A;  2L33 A;  4YY3 E;  2DB2 A;  5IWA E;  2FGG A;  2NUE A;  2ELY A;  5IT9 C;  2LUP B;  2RTX A;  1HNZ E;  2B9D A;  1QU6 A;  4AQY E;  2EN2 A;  4JI6 E;  2EN3 A;  2K4V A;  5A69 A;  2EMI A;  2JVA A;  4R2Q A;  2KON A;  2M1S A;  2YTD A;  2Q8U A;  2EM6 A;  3J7Y p;  2DLK A;  1A1H A;  4NXM E;  4JI3 E;  4DMI A;  4K0K E;  4GEQ B;  1XNQ E;  2VQE E;  1KYQ A;  5AE2 A;  1DQ3 A;  4DV2 E;  2I13 A;  4ZYD A;  3P1X A;  3KWR A;  1JK1 A;  3J81 C;  2LMZ A;  2EPZ A;  2DRP A;  3ADJ A;  3C6M A;  4BHC A;  4WX9 A;  3LML A;  2YTO A;  4MLV A;  2UXC E;  2EMG A;  2LVH A;  2WCC 3;  2J7J A;  1X6H A;  4JYA E;  2EOO A;  2B7T A;  1J26 A;  4ZYG A;  2EQ0 A;  2MDG A;  2A25 A;  1UN6 B;  2VE7 C;  2LBS B;  1Z1B A;  1HR0 E;  2EOS A;  5A6B A;  2N3G A;  3BF2 A;  4LF6 E;  2DLQ A;  4LFA E;  4O5G A;  1PJS A;  4X64 E;  2GLI A;  3OML A;  4DV5 E;  2EOR A;  5ADZ A;  4TUI A;  3ADG A;  2EMB A;  4IS1 C;  2V89 A;  2EOE A; 
#chains in the Genus database with same CATH homology
 2EN8 A;  4R2D A;  4R2A A;  2EM2 A;  2YU8 A;  2EM4 A;  2R1F A;  4R2S A;  2YTJ A;  2ENC A;  2DMI A;  2YTQ A;  2EPP A;  1A1K A;  1BB8 A;  2EMW A;  2EPU A;  2EMH A;  4R2E A;  2WBU A;  2EM3 A;  2EOM A;  2EOF A;  2EOZ A;  2YU5 A;  3MHS C;  2YRM A;  4F6N A;  1A1I A;  1X6F A;  2EN7 A;  3UK3 C;  2EPX A;  1A1G A;  2JPA A;  2EOI A;  2CT1 A;  2EMF A;  1JK2 A;  2EOY A;  2EMA A;  2VRD A;  2EP3 A;  2WBS A;  2EM8 A;  2RPC A;  2EQ1 A;  1G2D C;  2EM0 A;  3EPL A;  1DGC A;  2EPA A;  2RSI A;  1RMD A;  2EMZ A;  4GZN C;  2ELY A;  2YTF A;  4X9J A;  2MKD A;  4IJD A;  2YTP A;  2ADR A;  5KL3 A;  1BBO A;  2LO3 A;  2HGH A;  2EQ3 A;  4R2P A;  2EL6 A;  1TF6 A;  2YTE A;  2YRH A;  1B69 A;  2YTN A;  2EN2 A;  3EPH A;  2EOJ A;  2EOX A;  2EN3 A;  2D9H A;  2EOQ A;  1LLM C;  1KJK A;  2LV2 A;  1UBD C;  2EMI A;  4R2Q A;  2YTD A;  2EM6 A;  4WSG A;  2EN1 A;  4F2J C;  2DLK A;  2EMC A;  2YTG A;  1A1H A;  2EL4 A;  1WJP A;  2PRT A;  1X3C A;  2CTD A;  2ENA A;  2CSH A;  3MHH C;  2WBT A;  1A1L A;  1G2F C;  5KL7 A;  1X6E A;  2EL5 A;  1A1J A;  2I13 A;  2NAB A;  3M99 B;  5KL4 A;  2LCE A;  1JK1 A;  2EE8 A;  5KL6 A;  1YSA C;  1ZAA C;  2EPZ A;  2DRP A;  2JP9 A;  3VHT B;  2E72 A;  1F2I G;  2EN4 A;  1ZU1 A;  5KL5 A;  1P47 A;  2YTO A;  2EML A;  2EM7 A;  1AAY A;  3EPJ A;  2EMG A;  2MKN A;  4M9V C;  5KL2 A;  2LVH A;  2WCC 3;  2DGC A;  2YRK A;  2J7J A;  1X6H A;  3EPK A;  2EOO A;  1A1F A;  2EMY A;  2EQ0 A;  2MDG A;  2A25 A;  2EM9 A;  2ENH A;  1TN9 A;  1UN6 B;  1Z1B A;  2YSP A;  4R2R A;  2GHF A;  2EOS A;  2M9A A;  1TF3 A;  1YUJ A;  2EMX A;  2YSO A;  4FK5 C;  2DLQ A;  2EM5 A;  2LT7 A;  1MEY C;  4F6M A;  2EMK A;  2ELZ A;  2EJ4 A;  1X5W A;  2GLI A;  1YUI A;  2EPR A;  2EOH A;  2EOR A;  1ZR9 A;  1NCS A;  2EMB A;  2EN6 A;  4R2C A;  2BB8 A;  4IS1 C;  2EOE A;  2YTI A;  2EPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...