4F2JC

Crystal structure of znf217 bound to dna, p6522 crystal form
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*TP*TP*GP*CP*AP*GP*AP*AP*TP*CP*GP*AP*TP*TP*CP*TP*GP*
publication title New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f2jC00
2ENHA 2E72A 2EMIA 2EN8A 1X3CA 2YSPA 2EPRA 2YTOA 1JK2A 1KJKA 1X6HA 1G2DC 2EE8A 1ZR9A 1BBOA 2EM8A 4M9VC 2EM7A 2ADRA 2EMXA 2EMCA 2EMKA 2MKNA 2EOMA 2YRHA 5KL6A 1A1JA 2EN4A 2EPAA 2VRDA 2DLQA 1YUJA 2EOOA 4IJDA 5KL7A 2A25A 1A1LA 2EN3A 2CSHA 2EMAA 2DLKA 4R2CA 1ZU1A 2D9HA 2YTDA 2YU5A 2YTFA 2EPCA 2LVHA 2YTQA 1G2FC 1RMDA 2J7JA 2JP9A 2EOYA 2GLIA 2ENCA 2CT1A 4R2DA 2EOEA 2YTEA 2EORA 1BB8A 2RPCA 5KL4A 2EM5A 2NABA 5KL5A 2LT7A 2EM6A 1X6FA 2EOXA 1B69A 3VHTB 1X6EA 1MEYC 2LV2A 2YSOA 1ZAAC 3MHHC 4F6NA 2EM2A 1A1FA 2EN6A 1JK1A 2EMHA 2PRTA 2EQ1A 2EN1A 2DRPA 2EN2A 2DGCA 2ELZA 2MKDA 4GZNC 2EOIA 3M99B 2HGHA 2WBSA 2EMYA 4R2AA 2LCEA 2WBUA 1LLMC 5KL3A 2EMGA 1A1KA 2DMIA 2EMFA 2EQ3A 2YTPA 2YRMA 1DGCA 2EOZA 2GHFA 4R2QA 2LO3A 2ENAA 2YTNA 1WJPA 2YRKA 2EPUA 2M9AA 3EPJA 4FK5C 1A1GA 2I13A 1UN6B 2R1FA 1F2IG 3EPKA 2EN7A 3MHSC 2EOSA 4X9JA 3EPLA 2EOFA 4R2SA 2EL6A 1TN9A 1TF3A 2ELYA 2EQ0A 1AAYA 1P47A 2JPAA 2EPPA 2EPXA 2WBTA 1NCSA 2EMWA 2EPZA 1YSAC 1X5WA 2YU8A 3UK3C 2EOQA 4R2PA 2BB8A 4R2RA 2EM9A 2EOHA 2EM3A 2MDGA 2YTJA 2EP3A 2EJ4A 4R2EA 2WCC3 4WSGA 2RSIA 2EMBA 1Z1BA 2YTGA 2EL4A 1A1HA 4F6MA 2YTIA 4IS1C 1A1IA 1YUIA 2EOJA 4F2JC 1UBDC 1TF6A 2EM0A 2EMLA 2EM4A 2EL5A 5KL2A 3EPHA 2EMZA 2CTDA
chains in the Genus database with same CATH superfamily
2L92A 2EN8A 4DR3E 3ZOQB 2YSPA 4BBYA 1MGTA 2UXCE 4B3TE 2EE8A 4O5GA 4M9VC 2EMXA 2EMCA 2NUFA 2K7IA 1XNQE 2EPAA 2KOUA 2UUCE 2YWQA 3K6QA 4HTGA 4NXME 4IJDA 1A1LA 2CSHA 2I9IA 4JI7E 2VQFE 2D9HA 2YTDA 4NZVA 2YTFA 4BHBA 1RMDA 4NXNE 2V86A 1SFEA 2DMYA 2EOYA 4JV5E 2CT1A 1N3GA 3VK6A 4R2DA 2EOEA 2YTEA 1UHZA 4L8NA 2EM5A 3T1YE 1YYOA 2RS7A 2N3HA 1X6EA 1B69A 5LLQA 1ZBTA 2LV2A 1EH8A 2ODRD 2EM2A 1QU6A 2V89A 4WSPA 2L3JA 4DMIA 2DGCA 2ELZA 2MKDA 2L2KB 1N32E 1X49A 2HGHA 2WBSA 2EMYA 4K0KE 1WHNA 1GQEA 4F9AB 5KL3A 1A1KA 4B3SE 3DF6A 2EQ3A 1YFHA 3JAMC 2UU9E 3EQ1A 3C6MA 1EKZA 2ENAA 3ADIA 1I94E 1UN6B 1F2IG 5A6AA 3KZZA 2FV4B 3EPLA 2LUQA 1TF3A 1ZBQA 3THOB 3JTZA 2EPXA 1YSAC 4KZSA 5AC4A 4R2PA 1FKAE 2FGGA 2V85A 2EPLX 4R2RA 4LF9E 2EOHA 1N33E 2NUEA 4WPYA 4DV2E 4MLVA 1Z1BA 2YTGA 4F6MA 2YTIA 2JY9A 4DR1E 4F2JC 1T4OA 1TF6A 1RQ0A 5KL2A 5AE3A 3THNA 3EPHA 4X8WA 2EMZA 1AAYA 4WXDA 2LCEA 2JP9A 2MC6A 2YZTA 4DV1E 5LMUE 2YTOA 2EPRA 1JK2A 1IBME 4B3RE 1KJKA 4JI1E 1G2DC 4NHRA 4BHCA 2ADRA 3ECRA 1EH6A 1SR9A 3LMLA 2JVAA 2YRHA 1AH5A 4O43A 2EN4A 2VRDA 2JR1A 2EPKX 3JU0A 3DJWA 4P7DA 5KL7A 2EN3A 2EMAA 2DLKA 3FIGA 1ZU1A 4DR6E 2LVHA 5TSEA 4DV3E 4BC9A 1DI2A 2EORA 5A2QC 1BB8A 2V83A 2RPCA 2WZOA 2LJUA 2NABA 2EPMX 2EM6A 1J5EE 3VHTB 2B9DA 1NEIA 1KYQA 2YSOA 4ZYGA 1MEYC 2EN6A 4YY3E 2EQ1A 2DRPA 2EN2A 2JOBA 2HHHE 4X65E 2L2MA 3HPZA 2EPNA 2L8TA 4R2AA 4F9CB 1XMOE 2JOXA 4BCAA 2EMGA 2RQLA 2EZ6A 2YTPA 2ODRC 2L3CA 2GHFA 3F6HA 4R2QA 2LO3A 2LMZA 2M9AA 5A69A 3F6GA 4F54A 4DUZE 3MHSC 3H09A 2NA2A 3VYYA 2EOFA 4DR4E 2EL6A 2VE7C 2R76A 3C4BA 1HNZE 2EQ0A 1T4LB 2EPPA 2EPZA 1WXRA 1HR0E 2LTSA 2EOQA 4TUGA 4I8OA 1IQSA 2BB8A 4ZYDA 4DR2E 1PKPA 2EM3A 4DV4E 2BBGA 2WCC3 4R2EA 4WSGA 3VYXA 3C6KA 2UXDE 5A6BD 5A6BA 2UXBE 5A6JA 2YPNA 1J26A 1YUIA 2EOJA 1UBDC 3RMPA 2DSYA 3MSWA 4R8OA 4LF8E 3BIDA 2EL5A 2N8XA 2V88A 4JI4E 3J80C 3OTOE 2LUPB 2EMIA 2EWLA 4DV7E 4JI0E 2B7TA 5DNYA 4AQYE 2EM8A 2G7HA 1YYKA 2LRSA 3IWBA 2MKNA 2EOMA 3HXLA 5KL6A 5ADZA 3T1HE 2EOOA 1PJQA 4KWYA 4ZYEA 2FTXB 4R03A 5IV8B 2EPCA 2KHXA 2YTQA 2L2NA 1G2FC 3J7AG 4JI2E 4M0VA 4BS9A 2J7JA 2B7VA 2GLIA 5T6JA 2ENCA 2VF1A 4BC7A 1QNTA 1T4NA 4J8ZA 2LJHA 4LFCE 2K4VA 5IWAE 3BGHA 5KL4A 5KL5A 1X6FA 4TUIA 3MHHC 2F4VE 4F6NA 1A1FA 1JK1A 4L5NC 4M30A 2EMHA 1GTKA 4GZNC 2EOIA 2LTRA 4N4RB 4B3ME 3P1XA 2E1MA 3HPSA 2E5LE 2F8BA 1LLMC 2DMIA 2KONA 2YRMA 1DGCA 4OX9E 4DV5E 2GPIA 2CPNA 1STUA 1WJPA 2YRKA 2EPUA 1T39A 2L33A 1A1GA 5AC5A 4JI6E 1HNXE 3EPKA 4DR7E 2YT4A 3QG5C 4X9JA 5BR8E 5F3WA 4R2SA 4RH8A 3J81C 4MLQA 4F9BB 2ELYA 2NUGA 1BBGA 1P47A 2JPAA 4DR5E 2EMWA 2DIXA 2RTXA 1X5WA 1GZ6A 4X66E 3UK3C 2LE2A 4LF6E 2EM9A 2MDGA 4O4KA 2YTJA 5FLXC 2EJ4A 2EMBA 2B3TB 4WFTA 4M2ZA 5AE2A 4Q28A 2V8QB 1XNRE 5A6KA 1PJSA 3LLHA 2M1SA 2YU8A 1L4SA 2ENHA 2E72A 1N34E 1X3CA 2RSMA 4JYAE 2JYAA 1X6HA 1ZR9A 3KZYA 1BBOA 2EM7A 2EMKA 1A1JA 2JWOA 2DB2A 3AUZA 2ZM6E 2DLQA 4YHHE 1YUJA 2A25A 1UILA 1YZ9A 3IWDA 4R2CA 5LL6R 3ADLA 4DUYE 4KHPE 4LFBE 2YU5A 2HC5A 2IHR1 3L00A 4BMJA 4LF4E 1YYWA 2L6MA 5AASA 1RC7A 1IBKE 2UUBE 3KWRA 3ADJA 2LT7A 2EOXA 1ZAAC 4LTYA 2LBSB 2RS6A 1PJTA 2PRTA 2EN1A 1N36E 4JI5E 3M99B 2V87A 1IQOA 4GKKE 2Q8UA 4P78A 4DV6E 2WBUA 3TQMA 4LF5E 3C4TA 4DV0E 1HNWE 3HQ1A 4GEQB 3BF2A 4Q35B 2EMFA 2HJJA 3ADGA 1WHQA 1X47A 2EOZA 3AV0A 4LU9A 2YTNA 2JXPA 2M4IA 4LF7E 2H36X 2MDRA 4WXCA 3EPJA 4FK5C 2I13A 2R1FA 4X64E 2EN7A 3IWCA 2M7QA 3OMLA 4HEIA 1PDAA 2EOSA 5LMNE 1TN9A 1XMQE 1FJGE 1IBLE 4RHBB 4GKJE 5IXMB 4LFAE 2UUAE 2WBTA 1NCSA 4OOGC 4X62E 4ZYHA 4DKKA 3J7Yp 1O0WA 1EH7A 4O24A 1T38A 5IT9C 3HTXA 5AE1A 4WYQB 1IMUA 3BBGA 4JI3E 2EP3A 2RSIA 1WRJA 1DQ3A 2N3GA 2EL4A 1A1HA 2MC5A 5CFFE 4IS1C 1A1IA 1X48A 2EM0A 2EMLA 1YPNA 2EM4A 4JI8E 4WX9A 2VQEE 2CTDA 2EPOA
chains in the Genus database with same CATH topology
2ENHA 2E72A 2EMIA 2EN8A 1X3CA 2YSPA 2EPRA 2YTOA 1JK2A 1KJKA 1X6HA 1G2DC 2EE8A 1ZR9A 1BBOA 2EM8A 4M9VC 2EM7A 2ADRA 2EMXA 2EMCA 2EMKA 2MKNA 2EOMA 2YRHA 5KL6A 1A1JA 2EN4A 2EPAA 2VRDA 2DLQA 1YUJA 2EOOA 4IJDA 5KL7A 2A25A 1A1LA 2EN3A 2CSHA 2EMAA 2DLKA 4R2CA 1ZU1A 2D9HA 2YTDA 2YU5A 2YTFA 2EPCA 2LVHA 2YTQA 1G2FC 1RMDA 2J7JA 2JP9A 2EOYA 2GLIA 2ENCA 2CT1A 4R2DA 2EOEA 2YTEA 2EORA 1BB8A 2RPCA 5KL4A 2EM5A 2NABA 5KL5A 2LT7A 2EM6A 1X6FA 2EOXA 1B69A 3VHTB 1X6EA 1MEYC 2LV2A 2YSOA 1ZAAC 3MHHC 4F6NA 2EM2A 1A1FA 2EN6A 1JK1A 2EMHA 2PRTA 2EQ1A 2EN1A 2DRPA 2EN2A 2DGCA 2ELZA 2MKDA 4GZNC 2EOIA 3M99B 2HGHA 2WBSA 2EMYA 4R2AA 2LCEA 2WBUA 1LLMC 5KL3A 2EMGA 1A1KA 2DMIA 2EMFA 2EQ3A 2YTPA 2YRMA 1DGCA 2EOZA 2GHFA 4R2QA 2LO3A 2ENAA 2YTNA 1WJPA 2YRKA 2EPUA 2M9AA 3EPJA 4FK5C 1A1GA 2I13A 1UN6B 2R1FA 1F2IG 3EPKA 2EN7A 3MHSC 2EOSA 4X9JA 3EPLA 2EOFA 4R2SA 2EL6A 1TN9A 1TF3A 2ELYA 2EQ0A 1AAYA 1P47A 2JPAA 2EPPA 2EPXA 2WBTA 1NCSA 2EMWA 2EPZA 1YSAC 1X5WA 2YU8A 3UK3C 2EOQA 4R2PA 2BB8A 4R2RA 2EM9A 2EOHA 2EM3A 2MDGA 2YTJA 2EP3A 2EJ4A 4R2EA 2WCC3 4WSGA 2RSIA 2EMBA 1Z1BA 2YTGA 2EL4A 1A1HA 4F6MA 2YTIA 4IS1C 1A1IA 1YUIA 2EOJA 4F2JC 1UBDC 1TF6A 2EM0A 2EMLA 2EM4A 2EL5A 5KL2A 3EPHA 2EMZA 2CTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENH A;  2E72 A;  2EMI A;  2EN8 A;  1X3C A;  2YSP A;  2EPR A;  2YTO A;  1JK2 A;  1KJK A;  1X6H A;  1G2D C;  2EE8 A;  1ZR9 A;  1BBO A;  2EM8 A;  4M9V C;  2EM7 A;  2ADR A;  2EMX A;  2EMC A;  2EMK A;  2MKN A;  2EOM A;  2YRH A;  5KL6 A;  1A1J A;  2EN4 A;  2EPA A;  2VRD A;  2DLQ A;  1YUJ A;  2EOO A;  4IJD A;  5KL7 A;  2A25 A;  1A1L A;  2EN3 A;  2CSH A;  2EMA A;  2DLK A;  4R2C A;  1ZU1 A;  2D9H A;  2YTD A;  2YU5 A;  2YTF A;  2EPC A;  2LVH A;  2YTQ A;  1G2F C;  1RMD A;  2J7J A;  2JP9 A;  2EOY A;  2GLI A;  2ENC A;  2CT1 A;  4R2D A;  2EOE A;  2YTE A;  2EOR A;  1BB8 A;  2RPC A;  5KL4 A;  2EM5 A;  2NAB A;  5KL5 A;  2LT7 A;  2EM6 A;  1X6F A;  2EOX A;  1B69 A;  3VHT B;  1X6E A;  1MEY C;  2LV2 A;  2YSO A;  1ZAA C;  3MHH C;  4F6N A;  2EM2 A;  1A1F A;  2EN6 A;  1JK1 A;  2EMH A;  2PRT A;  2EQ1 A;  2EN1 A;  2DRP A;  2EN2 A;  2DGC A;  2ELZ A;  2MKD A;  4GZN C;  2EOI A;  3M99 B;  2HGH A;  2WBS A;  2EMY A;  4R2A A;  2LCE A;  2WBU A;  1LLM C;  5KL3 A;  2EMG A;  1A1K A;  2DMI A;  2EMF A;  2EQ3 A;  2YTP A;  2YRM A;  1DGC A;  2EOZ A;  2GHF A;  4R2Q A;  2LO3 A;  2ENA A;  2YTN A;  1WJP A;  2YRK A;  2EPU A;  2M9A A;  3EPJ A;  4FK5 C;  1A1G A;  2I13 A;  1UN6 B;  2R1F A;  1F2I G;  3EPK A;  2EN7 A;  3MHS C;  2EOS A;  4X9J A;  3EPL A;  2EOF A;  4R2S A;  2EL6 A;  1TN9 A;  1TF3 A;  2ELY A;  2EQ0 A;  1AAY A;  1P47 A;  2JPA A;  2EPP A;  2EPX A;  2WBT A;  1NCS A;  2EMW A;  2EPZ A;  1YSA C;  1X5W A;  2YU8 A;  3UK3 C;  2EOQ A;  4R2P A;  2BB8 A;  4R2R A;  2EM9 A;  2EOH A;  2EM3 A;  2MDG A;  2YTJ A;  2EP3 A;  2EJ4 A;  4R2E A;  2WCC 3;  4WSG A;  2RSI A;  2EMB A;  1Z1B A;  2YTG A;  2EL4 A;  1A1H A;  4F6M A;  2YTI A;  4IS1 C;  1A1I A;  1YUI A;  2EOJ A;  4F2J C;  1UBD C;  1TF6 A;  2EM0 A;  2EML A;  2EM4 A;  2EL5 A;  5KL2 A;  3EPH A;  2EMZ A;  2CTD A; 
#chains in the Genus database with same CATH topology
 2L92 A;  2EN8 A;  4DR3 E;  3ZOQ B;  2YSP A;  4BBY A;  1MGT A;  2UXC E;  4B3T E;  2EE8 A;  4O5G A;  4M9V C;  2EMX A;  2EMC A;  2NUF A;  2K7I A;  1XNQ E;  2EPA A;  2KOU A;  2UUC E;  2YWQ A;  3K6Q A;  4HTG A;  4NXM E;  4IJD A;  1A1L A;  2CSH A;  2I9I A;  4JI7 E;  2VQF E;  2D9H A;  2YTD A;  4NZV A;  2YTF A;  4BHB A;  1RMD A;  4NXN E;  2V86 A;  1SFE A;  2DMY A;  2EOY A;  4JV5 E;  2CT1 A;  1N3G A;  3VK6 A;  4R2D A;  2EOE A;  2YTE A;  1UHZ A;  4L8N A;  2EM5 A;  3T1Y E;  1YYO A;  2RS7 A;  2N3H A;  1X6E A;  1B69 A;  5LLQ A;  1ZBT A;  2LV2 A;  1EH8 A;  2ODR D;  2EM2 A;  1QU6 A;  2V89 A;  4WSP A;  2L3J A;  4DMI A;  2DGC A;  2ELZ A;  2MKD A;  2L2K B;  1N32 E;  1X49 A;  2HGH A;  2WBS A;  2EMY A;  4K0K E;  1WHN A;  1GQE A;  4F9A B;  5KL3 A;  1A1K A;  4B3S E;  3DF6 A;  2EQ3 A;  1YFH A;  3JAM C;  2UU9 E;  3EQ1 A;  3C6M A;  1EKZ A;  2ENA A;  3ADI A;  1I94 E;  1UN6 B;  1F2I G;  5A6A A;  3KZZ A;  2FV4 B;  3EPL A;  2LUQ A;  1TF3 A;  1ZBQ A;  3THO B;  3JTZ A;  2EPX A;  1YSA C;  4KZS A;  5AC4 A;  4R2P A;  1FKA E;  2FGG A;  2V85 A;  2EPL X;  4R2R A;  4LF9 E;  2EOH A;  1N33 E;  2NUE A;  4WPY A;  4DV2 E;  4MLV A;  1Z1B A;  2YTG A;  4F6M A;  2YTI A;  2JY9 A;  4DR1 E;  4F2J C;  1T4O A;  1TF6 A;  1RQ0 A;  5KL2 A;  5AE3 A;  3THN A;  3EPH A;  4X8W A;  2EMZ A;  1AAY A;  4WXD A;  2LCE A;  2JP9 A;  2MC6 A;  2YZT A;  4DV1 E;  5LMU E;  2YTO A;  2EPR A;  1JK2 A;  1IBM E;  4B3R E;  1KJK A;  4JI1 E;  1G2D C;  4NHR A;  4BHC A;  2ADR A;  3ECR A;  1EH6 A;  1SR9 A;  3LML A;  2JVA A;  2YRH A;  1AH5 A;  4O43 A;  2EN4 A;  2VRD A;  2JR1 A;  2EPK X;  3JU0 A;  3DJW A;  4P7D A;  5KL7 A;  2EN3 A;  2EMA A;  2DLK A;  3FIG A;  1ZU1 A;  4DR6 E;  2LVH A;  5TSE A;  4DV3 E;  4BC9 A;  1DI2 A;  2EOR A;  5A2Q C;  1BB8 A;  2V83 A;  2RPC A;  2WZO A;  2LJU A;  2NAB A;  2EPM X;  2EM6 A;  1J5E E;  3VHT B;  2B9D A;  1NEI A;  1KYQ A;  2YSO A;  4ZYG A;  1MEY C;  2EN6 A;  4YY3 E;  2EQ1 A;  2DRP A;  2EN2 A;  2JOB A;  2HHH E;  4X65 E;  2L2M A;  3HPZ A;  2EPN A;  2L8T A;  4R2A A;  4F9C B;  1XMO E;  2JOX A;  4BCA A;  2EMG A;  2RQL A;  2EZ6 A;  2YTP A;  2ODR C;  2L3C A;  2GHF A;  3F6H A;  4R2Q A;  2LO3 A;  2LMZ A;  2M9A A;  5A69 A;  3F6G A;  4F54 A;  4DUZ E;  3MHS C;  3H09 A;  2NA2 A;  3VYY A;  2EOF A;  4DR4 E;  2EL6 A;  2VE7 C;  2R76 A;  3C4B A;  1HNZ E;  2EQ0 A;  1T4L B;  2EPP A;  2EPZ A;  1WXR A;  1HR0 E;  2LTS A;  2EOQ A;  4TUG A;  4I8O A;  1IQS A;  2BB8 A;  4ZYD A;  4DR2 E;  1PKP A;  2EM3 A;  4DV4 E;  2BBG A;  2WCC 3;  4R2E A;  4WSG A;  3VYX A;  3C6K A;  2UXD E;  5A6B D;  5A6B A;  2UXB E;  5A6J A;  2YPN A;  1J26 A;  1YUI A;  2EOJ A;  1UBD C;  3RMP A;  2DSY A;  3MSW A;  4R8O A;  4LF8 E;  3BID A;  2EL5 A;  2N8X A;  2V88 A;  4JI4 E;  3J80 C;  3OTO E;  2LUP B;  2EMI A;  2EWL A;  4DV7 E;  4JI0 E;  2B7T A;  5DNY A;  4AQY E;  2EM8 A;  2G7H A;  1YYK A;  2LRS A;  3IWB A;  2MKN A;  2EOM A;  3HXL A;  5KL6 A;  5ADZ A;  3T1H E;  2EOO A;  1PJQ A;  4KWY A;  4ZYE A;  2FTX B;  4R03 A;  5IV8 B;  2EPC A;  2KHX A;  2YTQ A;  2L2N A;  1G2F C;  3J7A G;  4JI2 E;  4M0V A;  4BS9 A;  2J7J A;  2B7V A;  2GLI A;  5T6J A;  2ENC A;  2VF1 A;  4BC7 A;  1QNT A;  1T4N A;  4J8Z A;  2LJH A;  4LFC E;  2K4V A;  5IWA E;  3BGH A;  5KL4 A;  5KL5 A;  1X6F A;  4TUI A;  3MHH C;  2F4V E;  4F6N A;  1A1F A;  1JK1 A;  4L5N C;  4M30 A;  2EMH A;  1GTK A;  4GZN C;  2EOI A;  2LTR A;  4N4R B;  4B3M E;  3P1X A;  2E1M A;  3HPS A;  2E5L E;  2F8B A;  1LLM C;  2DMI A;  2KON A;  2YRM A;  1DGC A;  4OX9 E;  4DV5 E;  2GPI A;  2CPN A;  1STU A;  1WJP A;  2YRK A;  2EPU A;  1T39 A;  2L33 A;  1A1G A;  5AC5 A;  4JI6 E;  1HNX E;  3EPK A;  4DR7 E;  2YT4 A;  3QG5 C;  4X9J A;  5BR8 E;  5F3W A;  4R2S A;  4RH8 A;  3J81 C;  4MLQ A;  4F9B B;  2ELY A;  2NUG A;  1BBG A;  1P47 A;  2JPA A;  4DR5 E;  2EMW A;  2DIX A;  2RTX A;  1X5W A;  1GZ6 A;  4X66 E;  3UK3 C;  2LE2 A;  4LF6 E;  2EM9 A;  2MDG A;  4O4K A;  2YTJ A;  5FLX C;  2EJ4 A;  2EMB A;  2B3T B;  4WFT A;  4M2Z A;  5AE2 A;  4Q28 A;  2V8Q B;  1XNR E;  5A6K A;  1PJS A;  3LLH A;  2M1S A;  2YU8 A;  1L4S A;  2ENH A;  2E72 A;  1N34 E;  1X3C A;  2RSM A;  4JYA E;  2JYA A;  1X6H A;  1ZR9 A;  3KZY A;  1BBO A;  2EM7 A;  2EMK A;  1A1J A;  2JWO A;  2DB2 A;  3AUZ A;  2ZM6 E;  2DLQ A;  4YHH E;  1YUJ A;  2A25 A;  1UIL A;  1YZ9 A;  3IWD A;  4R2C A;  5LL6 R;  3ADL A;  4DUY E;  4KHP E;  4LFB E;  2YU5 A;  2HC5 A;  2IHR 1;  3L00 A;  4BMJ A;  4LF4 E;  1YYW A;  2L6M A;  5AAS A;  1RC7 A;  1IBK E;  2UUB E;  3KWR A;  3ADJ A;  2LT7 A;  2EOX A;  1ZAA C;  4LTY A;  2LBS B;  2RS6 A;  1PJT A;  2PRT A;  2EN1 A;  1N36 E;  4JI5 E;  3M99 B;  2V87 A;  1IQO A;  4GKK E;  2Q8U A;  4P78 A;  4DV6 E;  2WBU A;  3TQM A;  4LF5 E;  3C4T A;  4DV0 E;  1HNW E;  3HQ1 A;  4GEQ B;  3BF2 A;  4Q35 B;  2EMF A;  2HJJ A;  3ADG A;  1WHQ A;  1X47 A;  2EOZ A;  3AV0 A;  4LU9 A;  2YTN A;  2JXP A;  2M4I A;  4LF7 E;  2H36 X;  2MDR A;  4WXC A;  3EPJ A;  4FK5 C;  2I13 A;  2R1F A;  4X64 E;  2EN7 A;  3IWC A;  2M7Q A;  3OML A;  4HEI A;  1PDA A;  2EOS A;  5LMN E;  1TN9 A;  1XMQ E;  1FJG E;  1IBL E;  4RHB B;  4GKJ E;  5IXM B;  4LFA E;  2UUA E;  2WBT A;  1NCS A;  4OOG C;  4X62 E;  4ZYH A;  4DKK A;  3J7Y p;  1O0W A;  1EH7 A;  4O24 A;  1T38 A;  5IT9 C;  3HTX A;  5AE1 A;  4WYQ B;  1IMU A;  3BBG A;  4JI3 E;  2EP3 A;  2RSI A;  1WRJ A;  1DQ3 A;  2N3G A;  2EL4 A;  1A1H A;  2MC5 A;  5CFF E;  4IS1 C;  1A1I A;  1X48 A;  2EM0 A;  2EML A;  1YPN A;  2EM4 A;  4JI8 E;  4WX9 A;  2VQE E;  2CTD A;  2EPO A; 
#chains in the Genus database with same CATH homology
 2ENH A;  2E72 A;  2EMI A;  2EN8 A;  1X3C A;  2YSP A;  2EPR A;  2YTO A;  1JK2 A;  1KJK A;  1X6H A;  1G2D C;  2EE8 A;  1ZR9 A;  1BBO A;  2EM8 A;  4M9V C;  2EM7 A;  2ADR A;  2EMX A;  2EMC A;  2EMK A;  2MKN A;  2EOM A;  2YRH A;  5KL6 A;  1A1J A;  2EN4 A;  2EPA A;  2VRD A;  2DLQ A;  1YUJ A;  2EOO A;  4IJD A;  5KL7 A;  2A25 A;  1A1L A;  2EN3 A;  2CSH A;  2EMA A;  2DLK A;  4R2C A;  1ZU1 A;  2D9H A;  2YTD A;  2YU5 A;  2YTF A;  2EPC A;  2LVH A;  2YTQ A;  1G2F C;  1RMD A;  2J7J A;  2JP9 A;  2EOY A;  2GLI A;  2ENC A;  2CT1 A;  4R2D A;  2EOE A;  2YTE A;  2EOR A;  1BB8 A;  2RPC A;  5KL4 A;  2EM5 A;  2NAB A;  5KL5 A;  2LT7 A;  2EM6 A;  1X6F A;  2EOX A;  1B69 A;  3VHT B;  1X6E A;  1MEY C;  2LV2 A;  2YSO A;  1ZAA C;  3MHH C;  4F6N A;  2EM2 A;  1A1F A;  2EN6 A;  1JK1 A;  2EMH A;  2PRT A;  2EQ1 A;  2EN1 A;  2DRP A;  2EN2 A;  2DGC A;  2ELZ A;  2MKD A;  4GZN C;  2EOI A;  3M99 B;  2HGH A;  2WBS A;  2EMY A;  4R2A A;  2LCE A;  2WBU A;  1LLM C;  5KL3 A;  2EMG A;  1A1K A;  2DMI A;  2EMF A;  2EQ3 A;  2YTP A;  2YRM A;  1DGC A;  2EOZ A;  2GHF A;  4R2Q A;  2LO3 A;  2ENA A;  2YTN A;  1WJP A;  2YRK A;  2EPU A;  2M9A A;  3EPJ A;  4FK5 C;  1A1G A;  2I13 A;  1UN6 B;  2R1F A;  1F2I G;  3EPK A;  2EN7 A;  3MHS C;  2EOS A;  4X9J A;  3EPL A;  2EOF A;  4R2S A;  2EL6 A;  1TN9 A;  1TF3 A;  2ELY A;  2EQ0 A;  1AAY A;  1P47 A;  2JPA A;  2EPP A;  2EPX A;  2WBT A;  1NCS A;  2EMW A;  2EPZ A;  1YSA C;  1X5W A;  2YU8 A;  3UK3 C;  2EOQ A;  4R2P A;  2BB8 A;  4R2R A;  2EM9 A;  2EOH A;  2EM3 A;  2MDG A;  2YTJ A;  2EP3 A;  2EJ4 A;  4R2E A;  2WCC 3;  4WSG A;  2RSI A;  2EMB A;  1Z1B A;  2YTG A;  2EL4 A;  1A1H A;  4F6M A;  2YTI A;  4IS1 C;  1A1I A;  1YUI A;  2EOJ A;  4F2J C;  1UBD C;  1TF6 A;  2EM0 A;  2EML A;  2EM4 A;  2EL5 A;  5KL2 A;  3EPH A;  2EMZ A;  2CTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...