4F2JC

Crystal structure of znf217 bound to dna, p6522 crystal form
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
molecule keywords 5'-D(*TP*TP*TP*GP*CP*AP*GP*AP*AP*TP*CP*GP*AP*TP*TP*CP*TP*GP*
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f2jC00
2EN3A 2EMFA 3EPLA 2EM8A 2ENCA 1BBOA 1WJPA 2MDGA 1X6EA 2M9AA 1A1FA 1X5WA 2NABA 2EOQA 2EM7A 2EN6A 4R2EA 2YTOA 4F6NA 2CTDA 2EE8A 2LVHA 4F6MA 2YTJA 4X9JA 1TF3A 2EP3A 2EMHA 2EN1A 2EPXA 2EOZA 3M99B 5KL5A 2EL4A 1DGCA 2EN4A 4IJDA 1X6FA 2EMAA 4R2SA 2YTEA 2YTDA 1UBDC 1A1JA 1A1KA 4FK5C 1JK1A 2ELZA 4R2PA 2EOFA 2EOXA 2R1FA 4F2JC 2EOEA 1ZU1A 4IS1C 1F2IG 1AAYA 1TF6A 2GLIA 2EOIA 2EMYA 2EN7A 2EPCA 2CSHA 2DGCA 3MHSC 2LT7A 2YRMA 1ZAAC 1YUJA 2I13A 2MKNA 2JPAA 2PRTA 4M9VC 1RMDA 2DLQA 2EPAA 5KL3A 2EM2A 2DMIA 2EM4A 2ELYA 2YTIA 2EMKA 1NCSA 2EMCA 2EOHA 2EM5A 2EMLA 2E72A 4R2DA 2MKDA 2YRHA 2DLKA 2YU8A 2WBSA 2YTGA 1X3CA 2EMWA 2EOMA 2EQ1A 2EQ0A 2EORA 2YSPA 4R2AA 2LO3A 1LLMC 1A1LA 2VRDA 2HGHA 3MHHC 2EMXA 2YTQA 3VHTB 2WBUA 2JP9A 1P47A 2EJ4A 1JK2A 2WBTA 4WSGA 1UN6B 2D9HA 1KJKA 2EQ3A 2EM9A 2EL6A 2LCEA 5KL7A 2J7JA 1G2FC 2YRKA 2EM3A 2RSIA 2EM6A 1YSAC 2EMBA 2EMZA 2EMIA 2YU5A 1B69A 1TN9A 2EOSA 2GHFA 1BB8A 3EPHA 2EN2A 1X6HA 5KL6A 2LV2A 3EPJA 2ENHA 2EOJA 2RPCA 2YTPA 2EL5A 2YTNA 1MEYC 2CT1A 2WCC3 2ADRA 2EMGA 1YUIA 5KL2A 4R2CA 4R2QA 1Z1BA 2BB8A 2ENAA 2EPZA 5KL4A 1A1GA 2EM0A 2YSOA 2EOOA 4R2RA 3EPKA 2EN8A 1A1HA 2A25A 3UK3C 2DRPA 1ZR9A 1G2DC 1A1IA 2YTFA 2EPRA 2EPPA 4GZNC 2EOYA 2EPUA
chains in the Genus database with same CATH superfamily
2EN3A 2EMFA 2LBSB 5BR8E 2KHXA 2ENCA 1PDAA 1A1FA 4DUZE 2ODRD 4LFBE 3J7Yp 4M30A 4DV1E 4LF8E 2ZM6E 1STUA 1IQSA 1RQ0A 2L8TA 1I94E 1HNWE 4X9JA 3TQMA 3AV0A 3DF6A 2EMHA 2EN1A 5KL5A 3M99B 2YPNA 4KZSA 4DV7E 4F9CB 4ZYGA 4IJDA 2DSYA 3F6GA 2JY9A 2YTDA 4ZYEA 5A6JA 2EPKX 1A1KA 1JK1A 2ELZA 4R2PA 4JYAE 4TUGA 2R1FA 1TF6A 4IS1C 4DV3E 2EOIA 1J26A 2GPIA 2VQEE 2LJHA 2RS6A 3LLHA 2I13A 1RMDA 2V85A 2EM2A 5IXMB 2ELYA 2EPOA 1XMOE 2MKDA 3C4TA 3C6MA 2WBSA 4DUYE 4R2AA 4JI3E 2EQ1A 2HGHA 1LLMC 3ZOQB 4DV5E 2N3HA 3DJWA 4X66E 2L92A 2EMXA 2YTQA 2JP9A 2EWLA 4WSGA 2D9HA 2EQ3A 4MLVA 4BBYA 4GKJE 5KL7A 1G2FC 2FV4B 4ZYHA 5A6AA 2HJJA 2V83A 1YSAC 3HPSA 1HR0E 1T39A 1TN9A 2EOSA 2YZTA 2GHFA 2NA2A 2E5LE 4DV6E 2K4VA 4DR7E 4RHBB 2EN2A 1GZ6A 3HXLA 2LV2A 4X64E 2ENHA 1IBKE 2RPCA 2EL5A 2YTNA 1PKPA 4R2QA 2B9DA 2Q8UA 2ENAA 1EH8A 4Q35B 1A1GA 4LU9A 2YSOA 2EOOA 2LUQA 3EPKA 4LFCE 1ZR9A 2N3GA 3T1YE 2UUBE 1X48A 4R03A 2YTFA 2JYAA 2LE2A 2EPPA 4GZNC 4R2CA 1N34E 2I9IA 4JI2E 5AE2A 2YWQA 1BBOA 1PJTA 2MDGA 1N33E 2M9AA 1X5WA 2NABA 2EM7A 2L2NA 2F8BA 4YY3E 2YTOA 5A6BD 4F6NA 2CTDA 4BMJA 2JVAA 1DI2A 4F6MA 2F4VE 1TF3A 5LL6R 3K6QA 2EP3A 4DR6E 5AE1A 2EPXA 1WHNA 2EL4A 2UU9E 4RH8A 3JU0A 5DNYA 4K0KE 2YTEA 2IHR1 5AC5A 2HHHE 3IWBA 2EOXA 1F2IG 2DMYA 2EPCA 3VK6A 2CSHA 3MHSC 3HTXA 2R76A 1SFEA 1EH6A 3KZYA 3THNA 2JPAA 2MKNA 2PRTA 4M9VC 5TSEA 2EPAA 2UUAE 4ZYDA 2DMIA 5T6JA 4BCAA 5A6KA 4GEQB 5IV8B 4LF5E 2UUCE 1IBLE 2DLKA 1YYOA 2EMWA 2VRDA 3F6HA 2EJ4A 5LLQA 3VYYA 2WBTA 1KJKA 1XNRE 2EL6A 2LCEA 1ZBTA 2YRKA 4DV2E 4B3SE 5LMNE 1X47A 2B7TA 3LMLA 2EMZA 4F54A 2JXPA 4DV0E 3QG5C 1BB8A 4NXNE 4R8OA 4DV4E 1X6HA 3C6KA 3P1XA 3EPJA 3H09A 4JI8E 2VF1A 4JI5E 2CT1A 4LF4E 2KONA 1YUIA 5KL2A 1YZ9A 4BS9A 1EH7A 2EPZA 1YFHA 2DIXA 2UXDE 2EN8A 1SR9A 2JOXA 2A25A 5A69A 3UK3C 2DRPA 1N32E 1G2DC 4BHCA 2ODRC 2JWOA 4BC7A 1A1IA 2B3TB 5F3WA 2N8XA 1BBGA 2NUGA 3OMLA 1YPNA 3EPLA 2EM8A 2EOQA 4YHHE 1ZBQA 1QNTA 2LVHA 4JI1E 4B3RE 4J8ZA 1HNXE 4WSPA 1DGCA 2EN4A 1X6FA 4L5NC 2LJUA 3RMPA 2BBGA 1DQ3A 3MSWA 2UXBE 4AQYE 1T4OA 2LTSA 2EPNA 4F2JC 2EOEA 1ZU1A 2GLIA 3ADGA 1GQEA 2EMYA 2RQLA 3VYXA 2B7VA 4O24A 4WFTA 2LT7A 2YRMA 2FGGA 1T38A 1ZAAC 4I8OA 4B3TE 3HPZA 1YUJA 5AASA 4DR1E 3ADLA 4P78A 2DLQA 5KL3A 2UXCE 2EM4A 1N3GA 4L8NA 2YTIA 2EMKA 2EMCA 2EOHA 2EM5A 1N36E 2CPNA 2EMLA 2E72A 4R2DA 5ADZA 2K7IA 2YU8A 4NHRA 1X3CA 2EQ0A 2EOMA 2YSPA 2LO3A 1NEIA 1KYQA 4F9BB 4MLQA 1P47A 3C4BA 4WPYA 1JK2A 1UN6B 3IWDA 4Q28A 2L6MA 4LF9E 2RS7A 2HC5A 2J7JA 2EMBA 2YU5A 1B69A 1XNQE 2RTXA 4DR5E 4JV5E 2JR1A 3J81C 1WRJA 3EPHA 3ADJA 3IWCA 4DR4E 2EOJA 4JI4E 4DR2E 2DB2A 2YTPA 2ADRA 4DR3E 2EMGA 1UILA 3JTZA 4NXME 1FKAE 2BB8A 2FTXB 2M4IA 2EM0A 4BHBA 4R2RA 3JAMC 1YYWA 2LRSA 5A6BA 4O43A 2L2MA 2EOYA 4WXDA 2V87A 1IBME 2LUPB 5A2QC 4TUIA 4X62E 4NZVA 4B3ME 3ADIA 4JI0E 3BIDA 1WJPA 1X6EA 2VE7C 4O4KA 4N4RB 2EN6A 4R2EA 4KWYA 1FJGE 4M2ZA 1T4NA 2EE8A 2YTJA 4HEIA 2JOBA 1J5EE 1PJSA 2EOZA 2MC5A 4OOGC 1YYKA 1EKZA 3HQ1A 2L33A 5FLXC 3BF2A 2EMAA 4R2SA 1L4SA 2LTRA 5IT9C 4GKKE 2G7HA 3FIGA 2L3CA 1UBDC 1A1JA 4FK5C 1GTKA 2EOFA 1AAYA 1HNZE 4OX9E 4P7DA 2EN7A 2DGCA 4DKKA 4DMIA 4M0VA 2EPMX 2MDRA 2L3JA 1XMQE 2VQFE 4LF6E 5LMUE 3EQ1A 3ECRA 1NCSA 4BC9A 1WHQA 4KHPE 3J7AG 2V8QB 5AC4A 4HTGA 2YRHA 2YTGA 4WYQB 2V88A 2MC6A 2V89A 1A1LA 2EORA 2RSMA 3MHHC 3BGHA 2KOUA 3VHTB 2WBUA 3OTOE 4JI6E 2EM9A 1RC7A 5AE3A 2EM3A 3KZZA 1O0WA 2EM6A 2RSIA 1QU6A 4F9AB 1WXRA 2EMIA 5CFFE 1IMUA 2YT4A 4LFAE 2V86A 3J80C 3L00A 5KL6A 2M7QA 5IWAE 4WX9A 2H36X 2NUEA 2E1MA 2EZ6A 1UHZA 2NUFA 1MEYC 1IQOA 2WZOA 3BBGA 2WCC3 2M1SA 4WXCA 4JI7E 2L2KB 1Z1BA 1AH5A 1MGTA 4LTYA 3THOB 5KL4A 3T1HE 1A1HA 2LMZA 4X65E 1PJQA 2EPLX 4LF7E 4X8WA 1T4LB 1X49A 3KWRA 3AUZA 4O5GA 2EPRA 2EPUA
chains in the Genus database with same CATH topology
2EN3A 2EMFA 3EPLA 2EM8A 2ENCA 1BBOA 1WJPA 2MDGA 1X6EA 2M9AA 1A1FA 1X5WA 2NABA 2EOQA 2EM7A 2EN6A 4R2EA 2YTOA 4F6NA 2CTDA 2EE8A 2LVHA 4F6MA 2YTJA 4X9JA 1TF3A 2EP3A 2EMHA 2EN1A 2EPXA 2EOZA 3M99B 5KL5A 2EL4A 1DGCA 2EN4A 4IJDA 1X6FA 2EMAA 4R2SA 2YTEA 2YTDA 1UBDC 1A1JA 1A1KA 4FK5C 1JK1A 2ELZA 4R2PA 2EOFA 2EOXA 2R1FA 4F2JC 2EOEA 1ZU1A 4IS1C 1F2IG 1AAYA 1TF6A 2GLIA 2EOIA 2EMYA 2EN7A 2EPCA 2CSHA 2DGCA 3MHSC 2LT7A 2YRMA 1ZAAC 1YUJA 2I13A 2MKNA 2JPAA 2PRTA 4M9VC 1RMDA 2DLQA 2EPAA 5KL3A 2EM2A 2DMIA 2EM4A 2ELYA 2YTIA 2EMKA 1NCSA 2EMCA 2EOHA 2EM5A 2EMLA 2E72A 4R2DA 2MKDA 2YRHA 2DLKA 2YU8A 2WBSA 2YTGA 1X3CA 2EMWA 2EOMA 2EQ1A 2EQ0A 2EORA 2YSPA 4R2AA 2LO3A 1LLMC 1A1LA 2VRDA 2HGHA 3MHHC 2EMXA 2YTQA 3VHTB 2WBUA 2JP9A 1P47A 2EJ4A 1JK2A 2WBTA 4WSGA 1UN6B 2D9HA 1KJKA 2EQ3A 2EM9A 2EL6A 2LCEA 5KL7A 2J7JA 1G2FC 2YRKA 2EM3A 2RSIA 2EM6A 1YSAC 2EMBA 2EMZA 2EMIA 2YU5A 1B69A 1TN9A 2EOSA 2GHFA 1BB8A 3EPHA 2EN2A 1X6HA 5KL6A 2LV2A 3EPJA 2ENHA 2EOJA 2RPCA 2YTPA 2EL5A 2YTNA 1MEYC 2CT1A 2WCC3 2ADRA 2EMGA 1YUIA 5KL2A 4R2CA 4R2QA 1Z1BA 2BB8A 2ENAA 2EPZA 5KL4A 1A1GA 2EM0A 2YSOA 2EOOA 4R2RA 3EPKA 2EN8A 1A1HA 2A25A 3UK3C 2DRPA 1ZR9A 1G2DC 1A1IA 2YTFA 2EPRA 2EPPA 4GZNC 2EOYA 2EPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN3 A;  2EMF A;  3EPL A;  2EM8 A;  2ENC A;  1BBO A;  1WJP A;  2MDG A;  1X6E A;  2M9A A;  1A1F A;  1X5W A;  2NAB A;  2EOQ A;  2EM7 A;  2EN6 A;  4R2E A;  2YTO A;  4F6N A;  2CTD A;  2EE8 A;  2LVH A;  4F6M A;  2YTJ A;  4X9J A;  1TF3 A;  2EP3 A;  2EMH A;  2EN1 A;  2EPX A;  2EOZ A;  3M99 B;  5KL5 A;  2EL4 A;  1DGC A;  2EN4 A;  4IJD A;  1X6F A;  2EMA A;  4R2S A;  2YTE A;  2YTD A;  1UBD C;  1A1J A;  1A1K A;  4FK5 C;  1JK1 A;  2ELZ A;  4R2P A;  2EOF A;  2EOX A;  2R1F A;  4F2J C;  2EOE A;  1ZU1 A;  4IS1 C;  1F2I G;  1AAY A;  1TF6 A;  2GLI A;  2EOI A;  2EMY A;  2EN7 A;  2EPC A;  2CSH A;  2DGC A;  3MHS C;  2LT7 A;  2YRM A;  1ZAA C;  1YUJ A;  2I13 A;  2MKN A;  2JPA A;  2PRT A;  4M9V C;  1RMD A;  2DLQ A;  2EPA A;  5KL3 A;  2EM2 A;  2DMI A;  2EM4 A;  2ELY A;  2YTI A;  2EMK A;  1NCS A;  2EMC A;  2EOH A;  2EM5 A;  2EML A;  2E72 A;  4R2D A;  2MKD A;  2YRH A;  2DLK A;  2YU8 A;  2WBS A;  2YTG A;  1X3C A;  2EMW A;  2EOM A;  2EQ1 A;  2EQ0 A;  2EOR A;  2YSP A;  4R2A A;  2LO3 A;  1LLM C;  1A1L A;  2VRD A;  2HGH A;  3MHH C;  2EMX A;  2YTQ A;  3VHT B;  2WBU A;  2JP9 A;  1P47 A;  2EJ4 A;  1JK2 A;  2WBT A;  4WSG A;  1UN6 B;  2D9H A;  1KJK A;  2EQ3 A;  2EM9 A;  2EL6 A;  2LCE A;  5KL7 A;  2J7J A;  1G2F C;  2YRK A;  2EM3 A;  2RSI A;  2EM6 A;  1YSA C;  2EMB A;  2EMZ A;  2EMI A;  2YU5 A;  1B69 A;  1TN9 A;  2EOS A;  2GHF A;  1BB8 A;  3EPH A;  2EN2 A;  1X6H A;  5KL6 A;  2LV2 A;  3EPJ A;  2ENH A;  2EOJ A;  2RPC A;  2YTP A;  2EL5 A;  2YTN A;  1MEY C;  2CT1 A;  2WCC 3;  2ADR A;  2EMG A;  1YUI A;  5KL2 A;  4R2C A;  4R2Q A;  1Z1B A;  2BB8 A;  2ENA A;  2EPZ A;  5KL4 A;  1A1G A;  2EM0 A;  2YSO A;  2EOO A;  4R2R A;  3EPK A;  2EN8 A;  1A1H A;  2A25 A;  3UK3 C;  2DRP A;  1ZR9 A;  1G2D C;  1A1I A;  2YTF A;  2EPR A;  2EPP A;  4GZN C;  2EOY A;  2EPU A; 
#chains in the Genus database with same CATH topology
 2EN3 A;  2EMF A;  2LBS B;  5BR8 E;  2KHX A;  2ENC A;  1PDA A;  1A1F A;  4DUZ E;  2ODR D;  4LFB E;  3J7Y p;  4M30 A;  4DV1 E;  4LF8 E;  2ZM6 E;  1STU A;  1IQS A;  1RQ0 A;  2L8T A;  1I94 E;  1HNW E;  4X9J A;  3TQM A;  3AV0 A;  3DF6 A;  2EMH A;  2EN1 A;  5KL5 A;  3M99 B;  2YPN A;  4KZS A;  4DV7 E;  4F9C B;  4ZYG A;  4IJD A;  2DSY A;  3F6G A;  2JY9 A;  2YTD A;  4ZYE A;  5A6J A;  2EPK X;  1A1K A;  1JK1 A;  2ELZ A;  4R2P A;  4JYA E;  4TUG A;  2R1F A;  1TF6 A;  4IS1 C;  4DV3 E;  2EOI A;  1J26 A;  2GPI A;  2VQE E;  2LJH A;  2RS6 A;  3LLH A;  2I13 A;  1RMD A;  2V85 A;  2EM2 A;  5IXM B;  2ELY A;  2EPO A;  1XMO E;  2MKD A;  3C4T A;  3C6M A;  2WBS A;  4DUY E;  4R2A A;  4JI3 E;  2EQ1 A;  2HGH A;  1LLM C;  3ZOQ B;  4DV5 E;  2N3H A;  3DJW A;  4X66 E;  2L92 A;  2EMX A;  2YTQ A;  2JP9 A;  2EWL A;  4WSG A;  2D9H A;  2EQ3 A;  4MLV A;  4BBY A;  4GKJ E;  5KL7 A;  1G2F C;  2FV4 B;  4ZYH A;  5A6A A;  2HJJ A;  2V83 A;  1YSA C;  3HPS A;  1HR0 E;  1T39 A;  1TN9 A;  2EOS A;  2YZT A;  2GHF A;  2NA2 A;  2E5L E;  4DV6 E;  2K4V A;  4DR7 E;  4RHB B;  2EN2 A;  1GZ6 A;  3HXL A;  2LV2 A;  4X64 E;  2ENH A;  1IBK E;  2RPC A;  2EL5 A;  2YTN A;  1PKP A;  4R2Q A;  2B9D A;  2Q8U A;  2ENA A;  1EH8 A;  4Q35 B;  1A1G A;  4LU9 A;  2YSO A;  2EOO A;  2LUQ A;  3EPK A;  4LFC E;  1ZR9 A;  2N3G A;  3T1Y E;  2UUB E;  1X48 A;  4R03 A;  2YTF A;  2JYA A;  2LE2 A;  2EPP A;  4GZN C;  4R2C A;  1N34 E;  2I9I A;  4JI2 E;  5AE2 A;  2YWQ A;  1BBO A;  1PJT A;  2MDG A;  1N33 E;  2M9A A;  1X5W A;  2NAB A;  2EM7 A;  2L2N A;  2F8B A;  4YY3 E;  2YTO A;  5A6B D;  4F6N A;  2CTD A;  4BMJ A;  2JVA A;  1DI2 A;  4F6M A;  2F4V E;  1TF3 A;  5LL6 R;  3K6Q A;  2EP3 A;  4DR6 E;  5AE1 A;  2EPX A;  1WHN A;  2EL4 A;  2UU9 E;  4RH8 A;  3JU0 A;  5DNY A;  4K0K E;  2YTE A;  2IHR 1;  5AC5 A;  2HHH E;  3IWB A;  2EOX A;  1F2I G;  2DMY A;  2EPC A;  3VK6 A;  2CSH A;  3MHS C;  3HTX A;  2R76 A;  1SFE A;  1EH6 A;  3KZY A;  3THN A;  2JPA A;  2MKN A;  2PRT A;  4M9V C;  5TSE A;  2EPA A;  2UUA E;  4ZYD A;  2DMI A;  5T6J A;  4BCA A;  5A6K A;  4GEQ B;  5IV8 B;  4LF5 E;  2UUC E;  1IBL E;  2DLK A;  1YYO A;  2EMW A;  2VRD A;  3F6H A;  2EJ4 A;  5LLQ A;  3VYY A;  2WBT A;  1KJK A;  1XNR E;  2EL6 A;  2LCE A;  1ZBT A;  2YRK A;  4DV2 E;  4B3S E;  5LMN E;  1X47 A;  2B7T A;  3LML A;  2EMZ A;  4F54 A;  2JXP A;  4DV0 E;  3QG5 C;  1BB8 A;  4NXN E;  4R8O A;  4DV4 E;  1X6H A;  3C6K A;  3P1X A;  3EPJ A;  3H09 A;  4JI8 E;  2VF1 A;  4JI5 E;  2CT1 A;  4LF4 E;  2KON A;  1YUI A;  5KL2 A;  1YZ9 A;  4BS9 A;  1EH7 A;  2EPZ A;  1YFH A;  2DIX A;  2UXD E;  2EN8 A;  1SR9 A;  2JOX A;  2A25 A;  5A69 A;  3UK3 C;  2DRP A;  1N32 E;  1G2D C;  4BHC A;  2ODR C;  2JWO A;  4BC7 A;  1A1I A;  2B3T B;  5F3W A;  2N8X A;  1BBG A;  2NUG A;  3OML A;  1YPN A;  3EPL A;  2EM8 A;  2EOQ A;  4YHH E;  1ZBQ A;  1QNT A;  2LVH A;  4JI1 E;  4B3R E;  4J8Z A;  1HNX E;  4WSP A;  1DGC A;  2EN4 A;  1X6F A;  4L5N C;  2LJU A;  3RMP A;  2BBG A;  1DQ3 A;  3MSW A;  2UXB E;  4AQY E;  1T4O A;  2LTS A;  2EPN A;  4F2J C;  2EOE A;  1ZU1 A;  2GLI A;  3ADG A;  1GQE A;  2EMY A;  2RQL A;  3VYX A;  2B7V A;  4O24 A;  4WFT A;  2LT7 A;  2YRM A;  2FGG A;  1T38 A;  1ZAA C;  4I8O A;  4B3T E;  3HPZ A;  1YUJ A;  5AAS A;  4DR1 E;  3ADL A;  4P78 A;  2DLQ A;  5KL3 A;  2UXC E;  2EM4 A;  1N3G A;  4L8N A;  2YTI A;  2EMK A;  2EMC A;  2EOH A;  2EM5 A;  1N36 E;  2CPN A;  2EML A;  2E72 A;  4R2D A;  5ADZ A;  2K7I A;  2YU8 A;  4NHR A;  1X3C A;  2EQ0 A;  2EOM A;  2YSP A;  2LO3 A;  1NEI A;  1KYQ A;  4F9B B;  4MLQ A;  1P47 A;  3C4B A;  4WPY A;  1JK2 A;  1UN6 B;  3IWD A;  4Q28 A;  2L6M A;  4LF9 E;  2RS7 A;  2HC5 A;  2J7J A;  2EMB A;  2YU5 A;  1B69 A;  1XNQ E;  2RTX A;  4DR5 E;  4JV5 E;  2JR1 A;  3J81 C;  1WRJ A;  3EPH A;  3ADJ A;  3IWC A;  4DR4 E;  2EOJ A;  4JI4 E;  4DR2 E;  2DB2 A;  2YTP A;  2ADR A;  4DR3 E;  2EMG A;  1UIL A;  3JTZ A;  4NXM E;  1FKA E;  2BB8 A;  2FTX B;  2M4I A;  2EM0 A;  4BHB A;  4R2R A;  3JAM C;  1YYW A;  2LRS A;  5A6B A;  4O43 A;  2L2M A;  2EOY A;  4WXD A;  2V87 A;  1IBM E;  2LUP B;  5A2Q C;  4TUI A;  4X62 E;  4NZV A;  4B3M E;  3ADI A;  4JI0 E;  3BID A;  1WJP A;  1X6E A;  2VE7 C;  4O4K A;  4N4R B;  2EN6 A;  4R2E A;  4KWY A;  1FJG E;  4M2Z A;  1T4N A;  2EE8 A;  2YTJ A;  4HEI A;  2JOB A;  1J5E E;  1PJS A;  2EOZ A;  2MC5 A;  4OOG C;  1YYK A;  1EKZ A;  3HQ1 A;  2L33 A;  5FLX C;  3BF2 A;  2EMA A;  4R2S A;  1L4S A;  2LTR A;  5IT9 C;  4GKK E;  2G7H A;  3FIG A;  2L3C A;  1UBD C;  1A1J A;  4FK5 C;  1GTK A;  2EOF A;  1AAY A;  1HNZ E;  4OX9 E;  4P7D A;  2EN7 A;  2DGC A;  4DKK A;  4DMI A;  4M0V A;  2EPM X;  2MDR A;  2L3J A;  1XMQ E;  2VQF E;  4LF6 E;  5LMU E;  3EQ1 A;  3ECR A;  1NCS A;  4BC9 A;  1WHQ A;  4KHP E;  3J7A G;  2V8Q B;  5AC4 A;  4HTG A;  2YRH A;  2YTG A;  4WYQ B;  2V88 A;  2MC6 A;  2V89 A;  1A1L A;  2EOR A;  2RSM A;  3MHH C;  3BGH A;  2KOU A;  3VHT B;  2WBU A;  3OTO E;  4JI6 E;  2EM9 A;  1RC7 A;  5AE3 A;  2EM3 A;  3KZZ A;  1O0W A;  2EM6 A;  2RSI A;  1QU6 A;  4F9A B;  1WXR A;  2EMI A;  5CFF E;  1IMU A;  2YT4 A;  4LFA E;  2V86 A;  3J80 C;  3L00 A;  5KL6 A;  2M7Q A;  5IWA E;  4WX9 A;  2H36 X;  2NUE A;  2E1M A;  2EZ6 A;  1UHZ A;  2NUF A;  1MEY C;  1IQO A;  2WZO A;  3BBG A;  2WCC 3;  2M1S A;  4WXC A;  4JI7 E;  2L2K B;  1Z1B A;  1AH5 A;  1MGT A;  4LTY A;  3THO B;  5KL4 A;  3T1H E;  1A1H A;  2LMZ A;  4X65 E;  1PJQ A;  2EPL X;  4LF7 E;  4X8W A;  1T4L B;  1X49 A;  3KWR A;  3AUZ A;  4O5G A;  2EPR A;  2EPU A; 
#chains in the Genus database with same CATH homology
 2EN3 A;  2EMF A;  3EPL A;  2EM8 A;  2ENC A;  1BBO A;  1WJP A;  2MDG A;  1X6E A;  2M9A A;  1A1F A;  1X5W A;  2NAB A;  2EOQ A;  2EM7 A;  2EN6 A;  4R2E A;  2YTO A;  4F6N A;  2CTD A;  2EE8 A;  2LVH A;  4F6M A;  2YTJ A;  4X9J A;  1TF3 A;  2EP3 A;  2EMH A;  2EN1 A;  2EPX A;  2EOZ A;  3M99 B;  5KL5 A;  2EL4 A;  1DGC A;  2EN4 A;  4IJD A;  1X6F A;  2EMA A;  4R2S A;  2YTE A;  2YTD A;  1UBD C;  1A1J A;  1A1K A;  4FK5 C;  1JK1 A;  2ELZ A;  4R2P A;  2EOF A;  2EOX A;  2R1F A;  4F2J C;  2EOE A;  1ZU1 A;  4IS1 C;  1F2I G;  1AAY A;  1TF6 A;  2GLI A;  2EOI A;  2EMY A;  2EN7 A;  2EPC A;  2CSH A;  2DGC A;  3MHS C;  2LT7 A;  2YRM A;  1ZAA C;  1YUJ A;  2I13 A;  2MKN A;  2JPA A;  2PRT A;  4M9V C;  1RMD A;  2DLQ A;  2EPA A;  5KL3 A;  2EM2 A;  2DMI A;  2EM4 A;  2ELY A;  2YTI A;  2EMK A;  1NCS A;  2EMC A;  2EOH A;  2EM5 A;  2EML A;  2E72 A;  4R2D A;  2MKD A;  2YRH A;  2DLK A;  2YU8 A;  2WBS A;  2YTG A;  1X3C A;  2EMW A;  2EOM A;  2EQ1 A;  2EQ0 A;  2EOR A;  2YSP A;  4R2A A;  2LO3 A;  1LLM C;  1A1L A;  2VRD A;  2HGH A;  3MHH C;  2EMX A;  2YTQ A;  3VHT B;  2WBU A;  2JP9 A;  1P47 A;  2EJ4 A;  1JK2 A;  2WBT A;  4WSG A;  1UN6 B;  2D9H A;  1KJK A;  2EQ3 A;  2EM9 A;  2EL6 A;  2LCE A;  5KL7 A;  2J7J A;  1G2F C;  2YRK A;  2EM3 A;  2RSI A;  2EM6 A;  1YSA C;  2EMB A;  2EMZ A;  2EMI A;  2YU5 A;  1B69 A;  1TN9 A;  2EOS A;  2GHF A;  1BB8 A;  3EPH A;  2EN2 A;  1X6H A;  5KL6 A;  2LV2 A;  3EPJ A;  2ENH A;  2EOJ A;  2RPC A;  2YTP A;  2EL5 A;  2YTN A;  1MEY C;  2CT1 A;  2WCC 3;  2ADR A;  2EMG A;  1YUI A;  5KL2 A;  4R2C A;  4R2Q A;  1Z1B A;  2BB8 A;  2ENA A;  2EPZ A;  5KL4 A;  1A1G A;  2EM0 A;  2YSO A;  2EOO A;  4R2R A;  3EPK A;  2EN8 A;  1A1H A;  2A25 A;  3UK3 C;  2DRP A;  1ZR9 A;  1G2D C;  1A1I A;  2YTF A;  2EPR A;  2EPP A;  4GZN C;  2EOY A;  2EPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...