4F2JC

Crystal structure of znf217 bound to dna, p6522 crystal form
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein/dna
molecule keywords 5'-D(*TP*TP*TP*GP*CP*AP*GP*AP*AP*TP*CP*GP*AP*TP*TP*CP*TP*GP*
publication title New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f2jC00
2EM2A 2EOQA 2EM7A 2LV2A 2EMLA 2YTOA 2WBTA 2EOSA 2YTNA 1LLMC 2NABA 2LCEA 2CT1A 2EE8A 1Z1BA 3M99B 2EPCA 1A1LA 2JP9A 2EQ0A 2EM6A 2EPZA 4F6MA 2YSPA 2DMIA 5KL6A 4R2QA 4IJDA 2EL5A 2MKNA 2EMCA 1YSAC 1A1JA 2MKDA 2PRTA 1ZU1A 1F2IG 1TF3A 2A25A 2J7JA 2YTPA 2EN6A 2EN1A 1G2DC 2EOXA 1X3CA 3EPJA 1UBDC 2EN7A 2EPUA 1ZR9A 1TN9A 2EM9A 2EMFA 1JK2A 2EJ4A 2YTIA 1A1KA 2GLIA 1X5WA 3MHSC 4R2SA 2HGHA 2EMXA 2WBUA 4M9VC 2EN8A 2YTQA 2EM4A 2YTGA 2EQ3A 1A1IA 4R2PA 2YTJA 2ENHA 3UK3C 2DGCA 2LVHA 2JPAA 2ELZA 2CTDA 1BBOA 2ELYA 4F6NA 2YRHA 2MDGA 5KL7A 2EOFA 5KL3A 2EMKA 2EPAA 1P47A 2EMIA 2EM8A 4R2CA 1UN6B 2EQ1A 4F2JC 1NCSA 3VHTB 2I13A 2EMWA 2LO3A 3EPLA 2EOZA 1X6EA 2EMYA 2EM3A 2M9AA 2DRPA 1B69A 2EN3A 2EMHA 2ENAA 2YTFA 2YRKA 4FK5C 2D9HA 2EOMA 2RSIA 2CSHA 2E72A 2YSOA 2YTEA 2YU8A 3EPKA 2EN4A 1YUJA 1KJKA 1WJPA 2EMAA 1G2FC 2DLKA 2EOIA 2YTDA 2VRDA 2BB8A 2RPCA 1MEYC 2WBSA 1DGCA 1AAYA 2EP3A 2EL4A 2EOYA 2R1FA 2EPPA 4R2AA 5KL2A 1A1FA 2EM0A 1A1HA 2DLQA 1X6HA 2EN2A 2EPXA 2GHFA 3EPHA 1TF6A 1YUIA 1X6FA 2WCC3 2EOJA 2LT7A 2EOOA 5KL4A 2EMZA 2ADRA 2EOHA 1ZAAC 2EMBA 2YU5A 2EOEA 2EM5A 1A1GA 2EORA 5KL5A 1JK1A 4WSGA 1RMDA 4X9JA 2EMGA 3MHHC 2YRMA 4IS1C 2EL6A 4R2EA 4R2RA 4GZNC 4R2DA 1BB8A 2ENCA 2EPRA
chains in the Genus database with same CATH superfamily
2EM2A 3K6QA 2EM7A 1N34E 2YTOA 2JYAA 2LTRA 2YTNA 1HNWE 2RQLA 2BBGA 3T1HE 5A6JA 3C6MA 1A1LA 2EQ0A 2LJHA 2EM6A 5FLXC 4F6MA 3TQMA 2YSPA 5KL6A 4O5GA 4IJDA 2EL5A 1ZBQA 1YYOA 2PRTA 3P1XA 2A25A 2G7HA 2J7JA 4DUZE 1UILA 3VK6A 4WXCA 4X62E 1X3CA 4B3ME 2EN7A 1ZR9A 2LMZA 4M30A 1EKZA 2HGHA 4DR3E 4LFAE 4KZSA 1PJQA 1A1IA 2LRSA 2YTJA 2VE7C 2DGCA 4R03A 3J7Yp 4KHPE 2MDGA 2V85A 2EPAA 5AE1A 2EM8A 4WSPA 2EQ1A 3BIDA 4RH8A 3VHTB 2UXCE 2LO3A 3H09A 2DSYA 2EOZA 1X6EA 2EMYA 1HNXE 2RS7A 4M2ZA 1BBGA 2EMHA 2VF1A 1IBME 2YRKA 2UXDE 2RSIA 2EWLA 2YTEA 3HXLA 5IV8B 3EPKA 3JAMC 4R8OA 2JR1A 1G2FC 4GKKE 2FGGA 2EOIA 4DV3E 4JI5E 5LL6R 3DF6A 2LTSA 4LTYA 1MEYC 4DV4E 4DR2E 2YT4A 2R1FA 4BHCA 1HNZE 4R2AA 4LF5E 3L00A 1PKPA 4YY3E 1IQSA 3J80C 3IWBA 1YUIA 2L33A 3IWCA 2R76A 2EPKX 2EOJA 4ZYEA 4WYQB 2YPNA 2EPLX 2HHHE 4NXNE 2EMZA 4OOGC 4DV2E 1XMOE 2N3GA 1EH7A 1SR9A 1ZAAC 2EOEA 5BR8E 1X47A 2EM5A 5AASA 5KL5A 1KYQA 1MGTA 4WSGA 1RMDA 1SFEA 4IS1C 2EL6A 3OMLA 2UU9E 2YZTA 1YYWA 2LUPB 3BGHA 2EOQA 2EMLA 2WBTA 4P78A 1WXRA 2NABA 1Z1BA 4B3TE 4LF4E 2JP9A 4WXDA 2EPMX 1T4OA 1UHZA 2MKNA 2CPNA 1GZ6A 1F2IG 4MLVA 1TF3A 4Q35B 1GTKA 1YZ9A 1G2DC 1T4NA 1N32E 1UBDC 2F4VE 4B3RE 2EPUA 1TN9A 4ZYHA 4LF7E 2V8QB 2GLIA 4R2SA 3OTOE 2EMXA 4M9VC 4YHHE 4DV6E 3RMPA 2RS6A 2EM4A 2NA2A 1XNQE 1X48A 2ENHA 3UK3C 4K0KE 2NUEA 2JPAA 2ELYA 2YRHA 1P47A 5IT9C 2YWQA 5A69A 4LFCE 3KZZA 2M7QA 2EMWA 1N33E 3VYYA 5TSEA 3F6GA 2ENAA 4FK5C 2FTXB 1L4SA 2JY9A 2D9HA 2KHXA 1KJKA 5AC5A 1N36E 2EN4A 1WJPA 2DLKA 3ADLA 2UXBE 2VRDA 3ADIA 4LF9E 4X8WA 2M1SA 2EP3A 2JOBA 1EH8A 4J8ZA 3JTZA 2EPPA 1A1FA 2NUGA 3FIGA 2DLQA 2EN2A 1NEIA 2IHR1 3EPHA 2WCC3 4GKJE 4X66E 1XMQE 5KL4A 2ZM6E 4F9BB 3IWDA 2ADRA 2N3HA 2V87A 2L2MA 3THOB 2F8BA 4MLQA 2L8TA 4NZVA 2EORA 4O4KA 2EMGA 3MHHC 2MDRA 1N3GA 2YRMA 4HTGA 4RHBB 4R2RA 2K4VA 5F3WA 3T1YE 4DV5E 1I94E 2JWOA 3F6HA 1IMUA 5IXMB 2MC6A 2LV2A 4JI7E 3KWRA 2EOSA 4DR1E 4JI1E 1LLMC 2LCEA 1J5EE 1AH5A 3ZOQB 4BC7A 4TUIA 4JI3E 2EPZA 2B7VA 3ADGA 4O43A 4TUGA 4DUYE 4X64E 3HPZA 2EMCA 5A2QC 4DV0E 1ZU1A 2K7IA 1RC7A 3HPSA 2L3CA 2E1MA 4BC9A 2DB2A 2EOXA 1FJGE 1JK2A 2YTIA 1A1KA 1X5WA 5DNYA 2UUBE 2WBUA 2EN8A 2YTQA 3BBGA 4GEQB 2KOUA 2LVHA 4O24A 2ELZA 4F6NA 1STUA 5KL7A 5KL3A 4JI0E 3LMLA 1UN6B 1WHQA 1NCSA 4NHRA 5A6BA 4X65E 2I13A 2LBSB 3EPLA 3BF2A 2M9AA 2DRPA 2YTFA 2EOMA 4DKKA 2CSHA 2E72A 2YSOA 4BS9A 1YUJA 1DI2A 4JI2E 1IBKE 3J7AG 2VQEE 4LFBE 4HEIA 2V89A 3ADJA 4I8OA 3THNA 3C4BA 2L92A 3HTXA 1WRJA 2VQFE 2EM0A 1A1HA 2E5LE 2EPXA 5ADZA 3C4TA 1TF6A 4BMJA 4LF6E 1PJTA 1PJSA 4WPYA 2EOOA 1O0WA 2EPOA 2LE2A 2DMYA 4OX9E 1FKAE 2KONA 5AC4A 2RTXA 4JYAE 2HJJA 4DR6E 1A1GA 1JK1A 3AUZA 4ZYGA 2H36X 2I9IA 1YYKA 3JU0A 4GZNC 4R2DA 2EZ6A 4F54A 3QG5C 3J81C 2GPIA 2JOXA 1YFHA 1RQ0A 2L3JA 2ODRC 2CT1A 2EE8A 5A6BD 3EQ1A 3M99B 4LU9A 2B3TB 2EPCA 2FV4B 3HQ1A 1T38A 2V86A 4B3SE 4M0VA 1J26A 2UUCE 4R2QA 2DMIA 4JI6E 4L8NA 1YSAC 2DIXA 2MKDA 1A1JA 4JI4E 1IQOA 4L5NC 2YTPA 5T6JA 4AQYE 4BCAA 2EN6A 2EN1A 3EPJA 1DQ3A 1ZBTA 5LLQA 2EM9A 2EMFA 3KZYA 2EJ4A 3MHSC 4BBYA 2EPNA 2YTGA 2EQ3A 3LLHA 4DV1E 4R2PA 3VYXA 2B9DA 2RSMA 2L6MA 1GQEA 2ODRD 1YPNA 2CTDA 1T39A 1BBOA 4BHBA 2EOFA 1T4LB 2EMKA 4Q28A 2Q8UA 2EMIA 2V88A 4R2CA 3AV0A 5LMNE 5IWAE 2UUAE 4WX9A 4F2JC 5A6KA 4KWYA 1QNTA 4ZYDA 4N4RB 2EM3A 3DJWA 1B69A 2EN3A 5CFFE 4DMIA 2YU8A 2L2KB 1WHNA 4WFTA 5AE2A 4DR7E 2EMAA 4LF8E 4DV7E 2YTDA 1QU6A 2BB8A 2RPCA 2WBSA 4DR5E 1DGCA 4P7DA 1AAYA 3ECRA 2EL4A 2EOYA 1X49A 5LMUE 5KL2A 2HC5A 2LUQA 1X6HA 2GHFA 3C6KA 2NUFA 1X6FA 2LT7A 4DR4E 2JVAA 4F9AB 2JXPA 1XNRE 2EOHA 2WZOA 1PDAA 2V83A 2N8XA 2B7TA 2MC5A 2EMBA 4F9CB 2YU5A 2L2NA 2M4IA 1EH6A 4JI8E 3MSWA 4X9JA 2LJUA 4R2EA 1IBLE 1HR0E 1BB8A 4JV5E 4NXME 5AE3A 5A6AA 2ENCA 2EPRA
chains in the Genus database with same CATH topology
2EM2A 2EOQA 2EM7A 2LV2A 2EMLA 2YTOA 2WBTA 2EOSA 2YTNA 1LLMC 2NABA 2LCEA 2CT1A 2EE8A 1Z1BA 3M99B 2EPCA 1A1LA 2JP9A 2EQ0A 2EM6A 2EPZA 4F6MA 2YSPA 2DMIA 5KL6A 4R2QA 4IJDA 2EL5A 2MKNA 2EMCA 1YSAC 1A1JA 2MKDA 2PRTA 1ZU1A 1F2IG 1TF3A 2A25A 2J7JA 2YTPA 2EN6A 2EN1A 1G2DC 2EOXA 1X3CA 3EPJA 1UBDC 2EN7A 2EPUA 1ZR9A 1TN9A 2EM9A 2EMFA 1JK2A 2EJ4A 2YTIA 1A1KA 2GLIA 1X5WA 3MHSC 4R2SA 2HGHA 2EMXA 2WBUA 4M9VC 2EN8A 2YTQA 2EM4A 2YTGA 2EQ3A 1A1IA 4R2PA 2YTJA 2ENHA 3UK3C 2DGCA 2LVHA 2JPAA 2ELZA 2CTDA 1BBOA 2ELYA 4F6NA 2YRHA 2MDGA 5KL7A 2EOFA 5KL3A 2EMKA 2EPAA 1P47A 2EMIA 2EM8A 4R2CA 1UN6B 2EQ1A 4F2JC 1NCSA 3VHTB 2I13A 2EMWA 2LO3A 3EPLA 2EOZA 1X6EA 2EMYA 2EM3A 2M9AA 2DRPA 1B69A 2EN3A 2EMHA 2ENAA 2YTFA 2YRKA 4FK5C 2D9HA 2EOMA 2RSIA 2CSHA 2E72A 2YSOA 2YTEA 2YU8A 3EPKA 2EN4A 1YUJA 1KJKA 1WJPA 2EMAA 1G2FC 2DLKA 2EOIA 2YTDA 2VRDA 2BB8A 2RPCA 1MEYC 2WBSA 1DGCA 1AAYA 2EP3A 2EL4A 2EOYA 2R1FA 2EPPA 4R2AA 5KL2A 1A1FA 2EM0A 1A1HA 2DLQA 1X6HA 2EN2A 2EPXA 2GHFA 3EPHA 1TF6A 1YUIA 1X6FA 2WCC3 2EOJA 2LT7A 2EOOA 5KL4A 2EMZA 2ADRA 2EOHA 1ZAAC 2EMBA 2YU5A 2EOEA 2EM5A 1A1GA 2EORA 5KL5A 1JK1A 4WSGA 1RMDA 4X9JA 2EMGA 3MHHC 2YRMA 4IS1C 2EL6A 4R2EA 4R2RA 4GZNC 4R2DA 1BB8A 2ENCA 2EPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM2 A;  2EOQ A;  2EM7 A;  2LV2 A;  2EML A;  2YTO A;  2WBT A;  2EOS A;  2YTN A;  1LLM C;  2NAB A;  2LCE A;  2CT1 A;  2EE8 A;  1Z1B A;  3M99 B;  2EPC A;  1A1L A;  2JP9 A;  2EQ0 A;  2EM6 A;  2EPZ A;  4F6M A;  2YSP A;  2DMI A;  5KL6 A;  4R2Q A;  4IJD A;  2EL5 A;  2MKN A;  2EMC A;  1YSA C;  1A1J A;  2MKD A;  2PRT A;  1ZU1 A;  1F2I G;  1TF3 A;  2A25 A;  2J7J A;  2YTP A;  2EN6 A;  2EN1 A;  1G2D C;  2EOX A;  1X3C A;  3EPJ A;  1UBD C;  2EN7 A;  2EPU A;  1ZR9 A;  1TN9 A;  2EM9 A;  2EMF A;  1JK2 A;  2EJ4 A;  2YTI A;  1A1K A;  2GLI A;  1X5W A;  3MHS C;  4R2S A;  2HGH A;  2EMX A;  2WBU A;  4M9V C;  2EN8 A;  2YTQ A;  2EM4 A;  2YTG A;  2EQ3 A;  1A1I A;  4R2P A;  2YTJ A;  2ENH A;  3UK3 C;  2DGC A;  2LVH A;  2JPA A;  2ELZ A;  2CTD A;  1BBO A;  2ELY A;  4F6N A;  2YRH A;  2MDG A;  5KL7 A;  2EOF A;  5KL3 A;  2EMK A;  2EPA A;  1P47 A;  2EMI A;  2EM8 A;  4R2C A;  1UN6 B;  2EQ1 A;  4F2J C;  1NCS A;  3VHT B;  2I13 A;  2EMW A;  2LO3 A;  3EPL A;  2EOZ A;  1X6E A;  2EMY A;  2EM3 A;  2M9A A;  2DRP A;  1B69 A;  2EN3 A;  2EMH A;  2ENA A;  2YTF A;  2YRK A;  4FK5 C;  2D9H A;  2EOM A;  2RSI A;  2CSH A;  2E72 A;  2YSO A;  2YTE A;  2YU8 A;  3EPK A;  2EN4 A;  1YUJ A;  1KJK A;  1WJP A;  2EMA A;  1G2F C;  2DLK A;  2EOI A;  2YTD A;  2VRD A;  2BB8 A;  2RPC A;  1MEY C;  2WBS A;  1DGC A;  1AAY A;  2EP3 A;  2EL4 A;  2EOY A;  2R1F A;  2EPP A;  4R2A A;  5KL2 A;  1A1F A;  2EM0 A;  1A1H A;  2DLQ A;  1X6H A;  2EN2 A;  2EPX A;  2GHF A;  3EPH A;  1TF6 A;  1YUI A;  1X6F A;  2WCC 3;  2EOJ A;  2LT7 A;  2EOO A;  5KL4 A;  2EMZ A;  2ADR A;  2EOH A;  1ZAA C;  2EMB A;  2YU5 A;  2EOE A;  2EM5 A;  1A1G A;  2EOR A;  5KL5 A;  1JK1 A;  4WSG A;  1RMD A;  4X9J A;  2EMG A;  3MHH C;  2YRM A;  4IS1 C;  2EL6 A;  4R2E A;  4R2R A;  4GZN C;  4R2D A;  1BB8 A;  2ENC A;  2EPR A; 
#chains in the Genus database with same CATH topology
 2EM2 A;  3K6Q A;  2EM7 A;  1N34 E;  2YTO A;  2JYA A;  2LTR A;  2YTN A;  1HNW E;  2RQL A;  2BBG A;  3T1H E;  5A6J A;  3C6M A;  1A1L A;  2EQ0 A;  2LJH A;  2EM6 A;  5FLX C;  4F6M A;  3TQM A;  2YSP A;  5KL6 A;  4O5G A;  4IJD A;  2EL5 A;  1ZBQ A;  1YYO A;  2PRT A;  3P1X A;  2A25 A;  2G7H A;  2J7J A;  4DUZ E;  1UIL A;  3VK6 A;  4WXC A;  4X62 E;  1X3C A;  4B3M E;  2EN7 A;  1ZR9 A;  2LMZ A;  4M30 A;  1EKZ A;  2HGH A;  4DR3 E;  4LFA E;  4KZS A;  1PJQ A;  1A1I A;  2LRS A;  2YTJ A;  2VE7 C;  2DGC A;  4R03 A;  3J7Y p;  4KHP E;  2MDG A;  2V85 A;  2EPA A;  5AE1 A;  2EM8 A;  4WSP A;  2EQ1 A;  3BID A;  4RH8 A;  3VHT B;  2UXC E;  2LO3 A;  3H09 A;  2DSY A;  2EOZ A;  1X6E A;  2EMY A;  1HNX E;  2RS7 A;  4M2Z A;  1BBG A;  2EMH A;  2VF1 A;  1IBM E;  2YRK A;  2UXD E;  2RSI A;  2EWL A;  2YTE A;  3HXL A;  5IV8 B;  3EPK A;  3JAM C;  4R8O A;  2JR1 A;  1G2F C;  4GKK E;  2FGG A;  2EOI A;  4DV3 E;  4JI5 E;  5LL6 R;  3DF6 A;  2LTS A;  4LTY A;  1MEY C;  4DV4 E;  4DR2 E;  2YT4 A;  2R1F A;  4BHC A;  1HNZ E;  4R2A A;  4LF5 E;  3L00 A;  1PKP A;  4YY3 E;  1IQS A;  3J80 C;  3IWB A;  1YUI A;  2L33 A;  3IWC A;  2R76 A;  2EPK X;  2EOJ A;  4ZYE A;  4WYQ B;  2YPN A;  2EPL X;  2HHH E;  4NXN E;  2EMZ A;  4OOG C;  4DV2 E;  1XMO E;  2N3G A;  1EH7 A;  1SR9 A;  1ZAA C;  2EOE A;  5BR8 E;  1X47 A;  2EM5 A;  5AAS A;  5KL5 A;  1KYQ A;  1MGT A;  4WSG A;  1RMD A;  1SFE A;  4IS1 C;  2EL6 A;  3OML A;  2UU9 E;  2YZT A;  1YYW A;  2LUP B;  3BGH A;  2EOQ A;  2EML A;  2WBT A;  4P78 A;  1WXR A;  2NAB A;  1Z1B A;  4B3T E;  4LF4 E;  2JP9 A;  4WXD A;  2EPM X;  1T4O A;  1UHZ A;  2MKN A;  2CPN A;  1GZ6 A;  1F2I G;  4MLV A;  1TF3 A;  4Q35 B;  1GTK A;  1YZ9 A;  1G2D C;  1T4N A;  1N32 E;  1UBD C;  2F4V E;  4B3R E;  2EPU A;  1TN9 A;  4ZYH A;  4LF7 E;  2V8Q B;  2GLI A;  4R2S A;  3OTO E;  2EMX A;  4M9V C;  4YHH E;  4DV6 E;  3RMP A;  2RS6 A;  2EM4 A;  2NA2 A;  1XNQ E;  1X48 A;  2ENH A;  3UK3 C;  4K0K E;  2NUE A;  2JPA A;  2ELY A;  2YRH A;  1P47 A;  5IT9 C;  2YWQ A;  5A69 A;  4LFC E;  3KZZ A;  2M7Q A;  2EMW A;  1N33 E;  3VYY A;  5TSE A;  3F6G A;  2ENA A;  4FK5 C;  2FTX B;  1L4S A;  2JY9 A;  2D9H A;  2KHX A;  1KJK A;  5AC5 A;  1N36 E;  2EN4 A;  1WJP A;  2DLK A;  3ADL A;  2UXB E;  2VRD A;  3ADI A;  4LF9 E;  4X8W A;  2M1S A;  2EP3 A;  2JOB A;  1EH8 A;  4J8Z A;  3JTZ A;  2EPP A;  1A1F A;  2NUG A;  3FIG A;  2DLQ A;  2EN2 A;  1NEI A;  2IHR 1;  3EPH A;  2WCC 3;  4GKJ E;  4X66 E;  1XMQ E;  5KL4 A;  2ZM6 E;  4F9B B;  3IWD A;  2ADR A;  2N3H A;  2V87 A;  2L2M A;  3THO B;  2F8B A;  4MLQ A;  2L8T A;  4NZV A;  2EOR A;  4O4K A;  2EMG A;  3MHH C;  2MDR A;  1N3G A;  2YRM A;  4HTG A;  4RHB B;  4R2R A;  2K4V A;  5F3W A;  3T1Y E;  4DV5 E;  1I94 E;  2JWO A;  3F6H A;  1IMU A;  5IXM B;  2MC6 A;  2LV2 A;  4JI7 E;  3KWR A;  2EOS A;  4DR1 E;  4JI1 E;  1LLM C;  2LCE A;  1J5E E;  1AH5 A;  3ZOQ B;  4BC7 A;  4TUI A;  4JI3 E;  2EPZ A;  2B7V A;  3ADG A;  4O43 A;  4TUG A;  4DUY E;  4X64 E;  3HPZ A;  2EMC A;  5A2Q C;  4DV0 E;  1ZU1 A;  2K7I A;  1RC7 A;  3HPS A;  2L3C A;  2E1M A;  4BC9 A;  2DB2 A;  2EOX A;  1FJG E;  1JK2 A;  2YTI A;  1A1K A;  1X5W A;  5DNY A;  2UUB E;  2WBU A;  2EN8 A;  2YTQ A;  3BBG A;  4GEQ B;  2KOU A;  2LVH A;  4O24 A;  2ELZ A;  4F6N A;  1STU A;  5KL7 A;  5KL3 A;  4JI0 E;  3LML A;  1UN6 B;  1WHQ A;  1NCS A;  4NHR A;  5A6B A;  4X65 E;  2I13 A;  2LBS B;  3EPL A;  3BF2 A;  2M9A A;  2DRP A;  2YTF A;  2EOM A;  4DKK A;  2CSH A;  2E72 A;  2YSO A;  4BS9 A;  1YUJ A;  1DI2 A;  4JI2 E;  1IBK E;  3J7A G;  2VQE E;  4LFB E;  4HEI A;  2V89 A;  3ADJ A;  4I8O A;  3THN A;  3C4B A;  2L92 A;  3HTX A;  1WRJ A;  2VQF E;  2EM0 A;  1A1H A;  2E5L E;  2EPX A;  5ADZ A;  3C4T A;  1TF6 A;  4BMJ A;  4LF6 E;  1PJT A;  1PJS A;  4WPY A;  2EOO A;  1O0W A;  2EPO A;  2LE2 A;  2DMY A;  4OX9 E;  1FKA E;  2KON A;  5AC4 A;  2RTX A;  4JYA E;  2HJJ A;  4DR6 E;  1A1G A;  1JK1 A;  3AUZ A;  4ZYG A;  2H36 X;  2I9I A;  1YYK A;  3JU0 A;  4GZN C;  4R2D A;  2EZ6 A;  4F54 A;  3QG5 C;  3J81 C;  2GPI A;  2JOX A;  1YFH A;  1RQ0 A;  2L3J A;  2ODR C;  2CT1 A;  2EE8 A;  5A6B D;  3EQ1 A;  3M99 B;  4LU9 A;  2B3T B;  2EPC A;  2FV4 B;  3HQ1 A;  1T38 A;  2V86 A;  4B3S E;  4M0V A;  1J26 A;  2UUC E;  4R2Q A;  2DMI A;  4JI6 E;  4L8N A;  1YSA C;  2DIX A;  2MKD A;  1A1J A;  4JI4 E;  1IQO A;  4L5N C;  2YTP A;  5T6J A;  4AQY E;  4BCA A;  2EN6 A;  2EN1 A;  3EPJ A;  1DQ3 A;  1ZBT A;  5LLQ A;  2EM9 A;  2EMF A;  3KZY A;  2EJ4 A;  3MHS C;  4BBY A;  2EPN A;  2YTG A;  2EQ3 A;  3LLH A;  4DV1 E;  4R2P A;  3VYX A;  2B9D A;  2RSM A;  2L6M A;  1GQE A;  2ODR D;  1YPN A;  2CTD A;  1T39 A;  1BBO A;  4BHB A;  2EOF A;  1T4L B;  2EMK A;  4Q28 A;  2Q8U A;  2EMI A;  2V88 A;  4R2C A;  3AV0 A;  5LMN E;  5IWA E;  2UUA E;  4WX9 A;  4F2J C;  5A6K A;  4KWY A;  1QNT A;  4ZYD A;  4N4R B;  2EM3 A;  3DJW A;  1B69 A;  2EN3 A;  5CFF E;  4DMI A;  2YU8 A;  2L2K B;  1WHN A;  4WFT A;  5AE2 A;  4DR7 E;  2EMA A;  4LF8 E;  4DV7 E;  2YTD A;  1QU6 A;  2BB8 A;  2RPC A;  2WBS A;  4DR5 E;  1DGC A;  4P7D A;  1AAY A;  3ECR A;  2EL4 A;  2EOY A;  1X49 A;  5LMU E;  5KL2 A;  2HC5 A;  2LUQ A;  1X6H A;  2GHF A;  3C6K A;  2NUF A;  1X6F A;  2LT7 A;  4DR4 E;  2JVA A;  4F9A B;  2JXP A;  1XNR E;  2EOH A;  2WZO A;  1PDA A;  2V83 A;  2N8X A;  2B7T A;  2MC5 A;  2EMB A;  4F9C B;  2YU5 A;  2L2N A;  2M4I A;  1EH6 A;  4JI8 E;  3MSW A;  4X9J A;  2LJU A;  4R2E A;  1IBL E;  1HR0 E;  1BB8 A;  4JV5 E;  4NXM E;  5AE3 A;  5A6A A;  2ENC A;  2EPR A; 
#chains in the Genus database with same CATH homology
 2EM2 A;  2EOQ A;  2EM7 A;  2LV2 A;  2EML A;  2YTO A;  2WBT A;  2EOS A;  2YTN A;  1LLM C;  2NAB A;  2LCE A;  2CT1 A;  2EE8 A;  1Z1B A;  3M99 B;  2EPC A;  1A1L A;  2JP9 A;  2EQ0 A;  2EM6 A;  2EPZ A;  4F6M A;  2YSP A;  2DMI A;  5KL6 A;  4R2Q A;  4IJD A;  2EL5 A;  2MKN A;  2EMC A;  1YSA C;  1A1J A;  2MKD A;  2PRT A;  1ZU1 A;  1F2I G;  1TF3 A;  2A25 A;  2J7J A;  2YTP A;  2EN6 A;  2EN1 A;  1G2D C;  2EOX A;  1X3C A;  3EPJ A;  1UBD C;  2EN7 A;  2EPU A;  1ZR9 A;  1TN9 A;  2EM9 A;  2EMF A;  1JK2 A;  2EJ4 A;  2YTI A;  1A1K A;  2GLI A;  1X5W A;  3MHS C;  4R2S A;  2HGH A;  2EMX A;  2WBU A;  4M9V C;  2EN8 A;  2YTQ A;  2EM4 A;  2YTG A;  2EQ3 A;  1A1I A;  4R2P A;  2YTJ A;  2ENH A;  3UK3 C;  2DGC A;  2LVH A;  2JPA A;  2ELZ A;  2CTD A;  1BBO A;  2ELY A;  4F6N A;  2YRH A;  2MDG A;  5KL7 A;  2EOF A;  5KL3 A;  2EMK A;  2EPA A;  1P47 A;  2EMI A;  2EM8 A;  4R2C A;  1UN6 B;  2EQ1 A;  4F2J C;  1NCS A;  3VHT B;  2I13 A;  2EMW A;  2LO3 A;  3EPL A;  2EOZ A;  1X6E A;  2EMY A;  2EM3 A;  2M9A A;  2DRP A;  1B69 A;  2EN3 A;  2EMH A;  2ENA A;  2YTF A;  2YRK A;  4FK5 C;  2D9H A;  2EOM A;  2RSI A;  2CSH A;  2E72 A;  2YSO A;  2YTE A;  2YU8 A;  3EPK A;  2EN4 A;  1YUJ A;  1KJK A;  1WJP A;  2EMA A;  1G2F C;  2DLK A;  2EOI A;  2YTD A;  2VRD A;  2BB8 A;  2RPC A;  1MEY C;  2WBS A;  1DGC A;  1AAY A;  2EP3 A;  2EL4 A;  2EOY A;  2R1F A;  2EPP A;  4R2A A;  5KL2 A;  1A1F A;  2EM0 A;  1A1H A;  2DLQ A;  1X6H A;  2EN2 A;  2EPX A;  2GHF A;  3EPH A;  1TF6 A;  1YUI A;  1X6F A;  2WCC 3;  2EOJ A;  2LT7 A;  2EOO A;  5KL4 A;  2EMZ A;  2ADR A;  2EOH A;  1ZAA C;  2EMB A;  2YU5 A;  2EOE A;  2EM5 A;  1A1G A;  2EOR A;  5KL5 A;  1JK1 A;  4WSG A;  1RMD A;  4X9J A;  2EMG A;  3MHH C;  2YRM A;  4IS1 C;  2EL6 A;  4R2E A;  4R2R A;  4GZN C;  4R2D A;  1BB8 A;  2ENC A;  2EPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...