4F2JC

Crystal structure of znf217 bound to dna, p6522 crystal form
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
b'RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*TP*TP*GP*CP*AP*GP*AP*AP*TP*CP*GP*AP*TP*TP*CP*TP*GP*
publication title New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f2jC00
1X3CA 2CSHA 2YTQA 2EN7A 2EOHA 2RSIA 4GZNC 2I13A 1A1FA 2EN3A 2EM5A 1UBDC 2EOFA 2EM6A 1DGCA 1RMDA 2EMLA 4F6NA 2DMIA 1AAYA 2EN1A 1BB8A 2EMFA 2EN4A 2EMGA 2EOOA 2EQ1A 1X6EA 2EPPA 5KL3A 2LO3A 1X6HA 2EL6A 2EOIA 2YRHA 1Z1BA 2EMZA 1G2DC 2LCEA 2EPRA 2J7JA 1X6FA 2EL5A 2WBUA 2BB8A 3EPLA 1TF6A 2EMCA 2RPCA 4FK5C 4R2CA 4R2SA 2EN6A 2WCC3 2ADRA 2YU8A 2LT7A 3MHSC 1X5WA 1A1HA 2EM3A 2WBSA 1ZAAC 4R2EA 2DRPA 4M9VC 1ZR9A 2EM7A 2YTJA 1P47A 2GHFA 2R1FA 3UK3C 2LVHA 2YSOA 2YRMA 3M99B 5KL6A 2EMHA 3EPJA 1TF3A 2JPAA 2D9HA 1TN9A 1BBOA 2YTDA 2DGCA 1G2FC 1JK2A 2YTGA 2MDGA 2EPAA 2JP9A 2YTPA 2YU5A 2EOMA 2EN8A 2A25A 2EOJA 2EM4A 2E72A 1F2IG 1ZU1A 2EM8A 5KL2A 2EL4A 1A1GA 2M9AA 2ELZA 2EMWA 2EM9A 4F6MA 1WJPA 1KJKA 2EJ4A 2MKNA 2EPXA 2MKDA 2YTFA 1MEYC 2EN2A 1JK1A 3VHTB 2YTIA 4R2AA 2EE8A 4IS1C 1A1KA 2HGHA 5KL4A 2WBTA 1YSAC 2YTNA 2ENCA 2EOZA 1A1IA 2GLIA 2EMYA 2EQ3A 1A1JA 2EORA 4R2DA 1B69A 2YRKA 2EPCA 2YTOA 2LV2A 2CTDA 5KL5A 1NCSA 3EPHA 4WSGA 4R2PA 2ENHA 2EMBA 2YSPA 2DLKA 2EOSA 4X9JA 2DLQA 4IJDA 2EP3A 2YTEA 2NABA 2CT1A 2EMIA 2EOYA 5KL7A 2EM0A 2EOXA 1UN6B 2EOQA 2EM2A 2ELYA 2EMAA 2EOEA 1A1LA 2EMKA 2EPZA 2EQ0A 2EPUA 4R2QA 2PRTA 1YUJA 2VRDA 2EMXA 3MHHC 4R2RA 3EPKA 4F2JC 2ENAA 1YUIA 1LLMC
chains in the Genus database with same CATH superfamily
4HTGA 2CSHA 2F8BA 1N36E 2EOHA 4DR7E 2I13A 2MDRA 4GEQB 2M4IA 2EM5A 1XNQE 2EOFA 2EM6A 2LJUA 4WXCA 1X47A 2DMIA 1AAYA 2EN1A 2EMFA 2EPPA 4Q28A 2L6MA 1Z1BA 4P78A 1G2DC 4NXME 2EL5A 1PDAA 2EMCA 3VYXA 4FK5C 1A1HA 2EM3A 3J80C 2WBSA 5A69A 4DKKA 1J26A 3BBGA 4R2EA 4MLVA 2YTJA 2GHFA 4JI4E 4DV5E 2K7IA 1ZBTA 2LVHA 3KZYA 3M99B 5AE3A 2EMHA 3LLHA 5A2QC 3F6GA 2YPNA 2YTDA 4WXDA 1HNZE 2YTGA 2MDGA 2EPAA 4JI8E 1HNXE 2VE7C 2EOMA 2A25A 2E72A 1A1GA 2M7QA 2N3GA 5FLXC 3T1YE 3C6MA 1KJKA 2MKNA 3JTZA 4DUYE 4BHBA 4BBYA 3C6KA 2EPNA 1HR0E 4L5NC 4LF4E 1NEIA 2M1SA 4K0KE 3ECRA 1MEYC 1IMUA 3VHTB 4R2AA 1SFEA 4DV7E 2UUAE 3ADJA 2YTNA 1N34E 2EOZA 1WXRA 5AC5A 4WX9A 2L92A 1A1JA 4R2DA 2EPKX 3K6QA 5IXMB 2HHHE 1B69A 1EH6A 1N3GA 2YTOA 3F6HA 5KL5A 2DSYA 4DR6E 5DNYA 1IQOA 4DV0E 2L3JA 4R2PA 2EMBA 1AH5A 2EOSA 2DLQA 2CT1A 2LJHA 5KL7A 2EOQA 4TUGA 4F54A 1A1LA 2L8TA 2NUGA 2I9IA 4KZSA 4BC7A 3IWDA 2JR1A 4F9AB 2VRDA 2EMXA 5IV8B 3MHHC 4N4RB 1PJQA 4F2JC 2NUEA 1YUIA 2R76A 1KYQA 4Q35B 4R03A 2E1MA 2EN7A 1O0WA 2ZM6E 2RSIA 3ADGA 1EKZA 4GZNC 4DV2E 1A1FA 2EN3A 1X49A 1UBDC 1RMDA 4JYAE 2EMLA 4F6NA 4I8OA 4WPYA 5KL3A 2EMGA 2HJJA 4JI5E 1X6EA 2LO3A 1X6HA 2EL6A 4NZVA 4ZYHA 3ADIA 2LCEA 2EPRA 4F9BB 2BB8A 1TF6A 1X48A 3AUZA 2RPCA 4R2SA 2WCC3 3VYYA 3MHSC 5T6JA 3OTOE 3THOB 2GPIA 1ZAAC 2G7HA 1SR9A 1WHNA 2DRPA 4M9VC 1ZR9A 2EM7A 4O24A 2MC6A 1DQ3A 2JXPA 2YRMA 3EPJA 5KL6A 4B3RE 4P7DA 1TN9A 1G2FC 4DR4E 3QG5C 5A6BA 4LFBE 2YU5A 2EOJA 2YT4A 2RS6A 5LL6R 5KL2A 2EL4A 2YWQA 3ZOQB 2ELZA 2B7TA 4OX9E 4F6MA 1GZ6A 5A6BD 1T4OA 4JI7E 4JI1E 2EN2A 1JK1A 2EE8A 2F4VE 1FJGE 4AQYE 4O4KA 5KL4A 1QNTA 2WBTA 4GKKE 2ENCA 3JU0A 2EMYA 4M2ZA 4KHPE 2MC5A 4JI2E 4JI0E 2DMYA 1RQ0A 1IBME 2E5LE 2JY9A 2LRSA 4JV5E 2CTDA 4BS9A 3BIDA 2V85A 1I94E 2ENHA 1T39A 3DF6A 2UU9E 4X9JA 2V8QB 1GTKA 2EP3A 3HQ1A 4JI6E 2B9DA 4LF9E 3FIGA 4YHHE 2EM2A 2ELYA 2H36X 4LF6E 4LF7E 3ADLA 2EPZA 2EPUA 4R2QA 2FV4B 2PRTA 2N3HA 2KHXA 2V87A 2ENAA 4X62E 2YTQA 4BMJA 4DUZE 2EWLA 4M0VA 2IHR1 2RS7A 2RTXA 3AV0A 1XNRE 2UXBE 3HTXA 2N8XA 4BHCA 1L4SA 1DGCA 1YYWA 5TSEA 5BR8E 4LF8E 2EN4A 1BB8A 2V88A 3T1HE 2EOIA 2YRHA 3RMPA 4O5GA 1FKAE 2J7JA 1X6FA 1YFHA 3BF2A 2UUCE 4R2CA 5LMNE 2ADRA 2WZOA 2LT7A 5IT9C 2LTSA 4YY3E 3DJWA 2VF1A 1P47A 2YSOA 2JPAA 1TF3A 4ZYGA 2D9HA 3TQMA 4ZYEA 2DGCA 1N33E 4LFCE 1WHQA 1JK2A 2DIXA 2JP9A 2YTPA 3HPZA 2EM4A 1YYOA 2EMWA 5F3WA 4OOGC 1IQSA 5AASA 2EZ6A 2BBGA 4NHRA 2V86A 4DV3E 2EPXA 4BCAA 2YTFA 4RH8A 2LMZA 4IS1C 2HGHA 1YSAC 2UUBE 2KONA 1GQEA 5IWAE 2L3CA 1RC7A 4LFAE 2EQ3A 4DR2E 1IBKE 4TUIA 2EORA 5AE1A 2ODRD 2LTRA 4RHBB 3EQ1A 2LV2A 1NCSA 3KZZA 3EPHA 4WYQB 2L2NA 4WSPA 4J8ZA 4IJDA 1J5EE 5AE2A 3KWRA 2DB2A 1N32E 2EM0A 4DR5E 4KWYA 3JAMC 5LMUE 5A6JA 1STUA 4B3TE 1MGTA 2EOEA 1PKPA 1DI2A 2EMKA 4DV4E 2RQLA 1YUJA 4B3SE 3J7AG 3EPKA 4DV1E 3L00A 2CPNA 2RSMA 1X3CA 1T4NA 1YYKA 4M30A 2UXCE 4JI3E 2NA2A 3MSWA 4GKJE 1BBGA 2V83A 1XMQE 3IWCA 3BGHA 4LF5E 2EOOA 2EQ1A 5LLQA 4DR1E 3OMLA 2EMZA 2WBUA 3EPLA 4X64E 1EH8A 2EN6A 2YU8A 3C4TA 2UXDE 1X5WA 4DMIA 1HNWE 2NUFA 1T4LB 2LBSB 2JVAA 2LUQA 2EPLX 2R1FA 4R8OA 5AC4A 3UK3C 1WRJA 3IWBA 4DR3E 1BBOA 2JOBA 3J7Yp 1UHZA 2FGGA 4MLQA 5A6KA 2HC5A 4X66E 2EN8A 3H09A 5CFFE 2JYAA 1F2IG 1ZU1A 2B7VA 2EM8A 4B3ME 2M9AA 2EM9A 2FTXB 1UILA 4L8NA 2Q8UA 1WJPA 2EJ4A 2EPMX 2K4VA 3HXLA 3VK6A 1PJSA 4HEIA 4F9CB 5ADZA 4LTYA 1T38A 2YTIA 1IBLE 4X65E 1A1KA 1A1IA 2ODRC 2GLIA 4WFTA 2B3TB 2LE2A 2VQFE 1YZ9A 2YRKA 1PJTA 1QU6A 2EPCA 2VQEE 3THNA 4WSGA 2L2MA 2JWOA 2YSPA 4X8WA 2DLKA 2LUPB 3P1XA 2V89A 2L33A 2YTEA 3J81C 2NABA 2EMIA 4BC9A 2EOYA 1UN6B 2EOXA 4LU9A 4O43A 2EMAA 3HPSA 2KOUA 1ZBQA 3LMLA 2EQ0A 1XMOE 5A6AA 4ZYDA 2L2KB 2JOXA 4DV6E 2EPOA 1YPNA 3C4BA 4NXNE 4R2RA 1EH7A 2MKDA 2YZTA 1LLMC
chains in the Genus database with same CATH topology
1X3CA 2CSHA 2YTQA 2EN7A 2EOHA 2RSIA 4GZNC 2I13A 1A1FA 2EN3A 2EM5A 1UBDC 2EOFA 2EM6A 1DGCA 1RMDA 2EMLA 4F6NA 2DMIA 1AAYA 2EN1A 1BB8A 2EMFA 2EN4A 2EMGA 2EOOA 2EQ1A 1X6EA 2EPPA 5KL3A 2LO3A 1X6HA 2EL6A 2EOIA 2YRHA 1Z1BA 2EMZA 1G2DC 2LCEA 2EPRA 2J7JA 1X6FA 2EL5A 2WBUA 2BB8A 3EPLA 1TF6A 2EMCA 2RPCA 4FK5C 4R2CA 4R2SA 2EN6A 2WCC3 2ADRA 2YU8A 2LT7A 3MHSC 1X5WA 1A1HA 2EM3A 2WBSA 1ZAAC 4R2EA 2DRPA 4M9VC 1ZR9A 2EM7A 2YTJA 1P47A 2GHFA 2R1FA 3UK3C 2LVHA 2YSOA 2YRMA 3M99B 5KL6A 2EMHA 3EPJA 1TF3A 2JPAA 2D9HA 1TN9A 1BBOA 2YTDA 2DGCA 1G2FC 1JK2A 2YTGA 2MDGA 2EPAA 2JP9A 2YTPA 2YU5A 2EOMA 2EN8A 2A25A 2EOJA 2EM4A 2E72A 1F2IG 1ZU1A 2EM8A 5KL2A 2EL4A 1A1GA 2M9AA 2ELZA 2EMWA 2EM9A 4F6MA 1WJPA 1KJKA 2EJ4A 2MKNA 2EPXA 2MKDA 2YTFA 1MEYC 2EN2A 1JK1A 3VHTB 2YTIA 4R2AA 2EE8A 4IS1C 1A1KA 2HGHA 5KL4A 2WBTA 1YSAC 2YTNA 2ENCA 2EOZA 1A1IA 2GLIA 2EMYA 2EQ3A 1A1JA 2EORA 4R2DA 1B69A 2YRKA 2EPCA 2YTOA 2LV2A 2CTDA 5KL5A 1NCSA 3EPHA 4WSGA 4R2PA 2ENHA 2EMBA 2YSPA 2DLKA 2EOSA 4X9JA 2DLQA 4IJDA 2EP3A 2YTEA 2NABA 2CT1A 2EMIA 2EOYA 5KL7A 2EM0A 2EOXA 1UN6B 2EOQA 2EM2A 2ELYA 2EMAA 2EOEA 1A1LA 2EMKA 2EPZA 2EQ0A 2EPUA 4R2QA 2PRTA 1YUJA 2VRDA 2EMXA 3MHHC 4R2RA 3EPKA 4F2JC 2ENAA 1YUIA 1LLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3C A;  2CSH A;  2YTQ A;  2EN7 A;  2EOH A;  2RSI A;  4GZN C;  2I13 A;  1A1F A;  2EN3 A;  2EM5 A;  1UBD C;  2EOF A;  2EM6 A;  1DGC A;  1RMD A;  2EML A;  4F6N A;  2DMI A;  1AAY A;  2EN1 A;  1BB8 A;  2EMF A;  2EN4 A;  2EMG A;  2EOO A;  2EQ1 A;  1X6E A;  2EPP A;  5KL3 A;  2LO3 A;  1X6H A;  2EL6 A;  2EOI A;  2YRH A;  1Z1B A;  2EMZ A;  1G2D C;  2LCE A;  2EPR A;  2J7J A;  1X6F A;  2EL5 A;  2WBU A;  2BB8 A;  3EPL A;  1TF6 A;  2EMC A;  2RPC A;  4FK5 C;  4R2C A;  4R2S A;  2EN6 A;  2WCC 3;  2ADR A;  2YU8 A;  2LT7 A;  3MHS C;  1X5W A;  1A1H A;  2EM3 A;  2WBS A;  1ZAA C;  4R2E A;  2DRP A;  4M9V C;  1ZR9 A;  2EM7 A;  2YTJ A;  1P47 A;  2GHF A;  2R1F A;  3UK3 C;  2LVH A;  2YSO A;  2YRM A;  3M99 B;  5KL6 A;  2EMH A;  3EPJ A;  1TF3 A;  2JPA A;  2D9H A;  1TN9 A;  1BBO A;  2YTD A;  2DGC A;  1G2F C;  1JK2 A;  2YTG A;  2MDG A;  2EPA A;  2JP9 A;  2YTP A;  2YU5 A;  2EOM A;  2EN8 A;  2A25 A;  2EOJ A;  2EM4 A;  2E72 A;  1F2I G;  1ZU1 A;  2EM8 A;  5KL2 A;  2EL4 A;  1A1G A;  2M9A A;  2ELZ A;  2EMW A;  2EM9 A;  4F6M A;  1WJP A;  1KJK A;  2EJ4 A;  2MKN A;  2EPX A;  2MKD A;  2YTF A;  1MEY C;  2EN2 A;  1JK1 A;  3VHT B;  2YTI A;  4R2A A;  2EE8 A;  4IS1 C;  1A1K A;  2HGH A;  5KL4 A;  2WBT A;  1YSA C;  2YTN A;  2ENC A;  2EOZ A;  1A1I A;  2GLI A;  2EMY A;  2EQ3 A;  1A1J A;  2EOR A;  4R2D A;  1B69 A;  2YRK A;  2EPC A;  2YTO A;  2LV2 A;  2CTD A;  5KL5 A;  1NCS A;  3EPH A;  4WSG A;  4R2P A;  2ENH A;  2EMB A;  2YSP A;  2DLK A;  2EOS A;  4X9J A;  2DLQ A;  4IJD A;  2EP3 A;  2YTE A;  2NAB A;  2CT1 A;  2EMI A;  2EOY A;  5KL7 A;  2EM0 A;  2EOX A;  1UN6 B;  2EOQ A;  2EM2 A;  2ELY A;  2EMA A;  2EOE A;  1A1L A;  2EMK A;  2EPZ A;  2EQ0 A;  2EPU A;  4R2Q A;  2PRT A;  1YUJ A;  2VRD A;  2EMX A;  3MHH C;  4R2R A;  3EPK A;  4F2J C;  2ENA A;  1YUI A;  1LLM C; 
#chains in the Genus database with same CATH topology
 4HTG A;  2CSH A;  2F8B A;  1N36 E;  2EOH A;  4DR7 E;  2I13 A;  2MDR A;  4GEQ B;  2M4I A;  2EM5 A;  1XNQ E;  2EOF A;  2EM6 A;  2LJU A;  4WXC A;  1X47 A;  2DMI A;  1AAY A;  2EN1 A;  2EMF A;  2EPP A;  4Q28 A;  2L6M A;  1Z1B A;  4P78 A;  1G2D C;  4NXM E;  2EL5 A;  1PDA A;  2EMC A;  3VYX A;  4FK5 C;  1A1H A;  2EM3 A;  3J80 C;  2WBS A;  5A69 A;  4DKK A;  1J26 A;  3BBG A;  4R2E A;  4MLV A;  2YTJ A;  2GHF A;  4JI4 E;  4DV5 E;  2K7I A;  1ZBT A;  2LVH A;  3KZY A;  3M99 B;  5AE3 A;  2EMH A;  3LLH A;  5A2Q C;  3F6G A;  2YPN A;  2YTD A;  4WXD A;  1HNZ E;  2YTG A;  2MDG A;  2EPA A;  4JI8 E;  1HNX E;  2VE7 C;  2EOM A;  2A25 A;  2E72 A;  1A1G A;  2M7Q A;  2N3G A;  5FLX C;  3T1Y E;  3C6M A;  1KJK A;  2MKN A;  3JTZ A;  4DUY E;  4BHB A;  4BBY A;  3C6K A;  2EPN A;  1HR0 E;  4L5N C;  4LF4 E;  1NEI A;  2M1S A;  4K0K E;  3ECR A;  1MEY C;  1IMU A;  3VHT B;  4R2A A;  1SFE A;  4DV7 E;  2UUA E;  3ADJ A;  2YTN A;  1N34 E;  2EOZ A;  1WXR A;  5AC5 A;  4WX9 A;  2L92 A;  1A1J A;  4R2D A;  2EPK X;  3K6Q A;  5IXM B;  2HHH E;  1B69 A;  1EH6 A;  1N3G A;  2YTO A;  3F6H A;  5KL5 A;  2DSY A;  4DR6 E;  5DNY A;  1IQO A;  4DV0 E;  2L3J A;  4R2P A;  2EMB A;  1AH5 A;  2EOS A;  2DLQ A;  2CT1 A;  2LJH A;  5KL7 A;  2EOQ A;  4TUG A;  4F54 A;  1A1L A;  2L8T A;  2NUG A;  2I9I A;  4KZS A;  4BC7 A;  3IWD A;  2JR1 A;  4F9A B;  2VRD A;  2EMX A;  5IV8 B;  3MHH C;  4N4R B;  1PJQ A;  4F2J C;  2NUE A;  1YUI A;  2R76 A;  1KYQ A;  4Q35 B;  4R03 A;  2E1M A;  2EN7 A;  1O0W A;  2ZM6 E;  2RSI A;  3ADG A;  1EKZ A;  4GZN C;  4DV2 E;  1A1F A;  2EN3 A;  1X49 A;  1UBD C;  1RMD A;  4JYA E;  2EML A;  4F6N A;  4I8O A;  4WPY A;  5KL3 A;  2EMG A;  2HJJ A;  4JI5 E;  1X6E A;  2LO3 A;  1X6H A;  2EL6 A;  4NZV A;  4ZYH A;  3ADI A;  2LCE A;  2EPR A;  4F9B B;  2BB8 A;  1TF6 A;  1X48 A;  3AUZ A;  2RPC A;  4R2S A;  2WCC 3;  3VYY A;  3MHS C;  5T6J A;  3OTO E;  3THO B;  2GPI A;  1ZAA C;  2G7H A;  1SR9 A;  1WHN A;  2DRP A;  4M9V C;  1ZR9 A;  2EM7 A;  4O24 A;  2MC6 A;  1DQ3 A;  2JXP A;  2YRM A;  3EPJ A;  5KL6 A;  4B3R E;  4P7D A;  1TN9 A;  1G2F C;  4DR4 E;  3QG5 C;  5A6B A;  4LFB E;  2YU5 A;  2EOJ A;  2YT4 A;  2RS6 A;  5LL6 R;  5KL2 A;  2EL4 A;  2YWQ A;  3ZOQ B;  2ELZ A;  2B7T A;  4OX9 E;  4F6M A;  1GZ6 A;  5A6B D;  1T4O A;  4JI7 E;  4JI1 E;  2EN2 A;  1JK1 A;  2EE8 A;  2F4V E;  1FJG E;  4AQY E;  4O4K A;  5KL4 A;  1QNT A;  2WBT A;  4GKK E;  2ENC A;  3JU0 A;  2EMY A;  4M2Z A;  4KHP E;  2MC5 A;  4JI2 E;  4JI0 E;  2DMY A;  1RQ0 A;  1IBM E;  2E5L E;  2JY9 A;  2LRS A;  4JV5 E;  2CTD A;  4BS9 A;  3BID A;  2V85 A;  1I94 E;  2ENH A;  1T39 A;  3DF6 A;  2UU9 E;  4X9J A;  2V8Q B;  1GTK A;  2EP3 A;  3HQ1 A;  4JI6 E;  2B9D A;  4LF9 E;  3FIG A;  4YHH E;  2EM2 A;  2ELY A;  2H36 X;  4LF6 E;  4LF7 E;  3ADL A;  2EPZ A;  2EPU A;  4R2Q A;  2FV4 B;  2PRT A;  2N3H A;  2KHX A;  2V87 A;  2ENA A;  4X62 E;  2YTQ A;  4BMJ A;  4DUZ E;  2EWL A;  4M0V A;  2IHR 1;  2RS7 A;  2RTX A;  3AV0 A;  1XNR E;  2UXB E;  3HTX A;  2N8X A;  4BHC A;  1L4S A;  1DGC A;  1YYW A;  5TSE A;  5BR8 E;  4LF8 E;  2EN4 A;  1BB8 A;  2V88 A;  3T1H E;  2EOI A;  2YRH A;  3RMP A;  4O5G A;  1FKA E;  2J7J A;  1X6F A;  1YFH A;  3BF2 A;  2UUC E;  4R2C A;  5LMN E;  2ADR A;  2WZO A;  2LT7 A;  5IT9 C;  2LTS A;  4YY3 E;  3DJW A;  2VF1 A;  1P47 A;  2YSO A;  2JPA A;  1TF3 A;  4ZYG A;  2D9H A;  3TQM A;  4ZYE A;  2DGC A;  1N33 E;  4LFC E;  1WHQ A;  1JK2 A;  2DIX A;  2JP9 A;  2YTP A;  3HPZ A;  2EM4 A;  1YYO A;  2EMW A;  5F3W A;  4OOG C;  1IQS A;  5AAS A;  2EZ6 A;  2BBG A;  4NHR A;  2V86 A;  4DV3 E;  2EPX A;  4BCA A;  2YTF A;  4RH8 A;  2LMZ A;  4IS1 C;  2HGH A;  1YSA C;  2UUB E;  2KON A;  1GQE A;  5IWA E;  2L3C A;  1RC7 A;  4LFA E;  2EQ3 A;  4DR2 E;  1IBK E;  4TUI A;  2EOR A;  5AE1 A;  2ODR D;  2LTR A;  4RHB B;  3EQ1 A;  2LV2 A;  1NCS A;  3KZZ A;  3EPH A;  4WYQ B;  2L2N A;  4WSP A;  4J8Z A;  4IJD A;  1J5E E;  5AE2 A;  3KWR A;  2DB2 A;  1N32 E;  2EM0 A;  4DR5 E;  4KWY A;  3JAM C;  5LMU E;  5A6J A;  1STU A;  4B3T E;  1MGT A;  2EOE A;  1PKP A;  1DI2 A;  2EMK A;  4DV4 E;  2RQL A;  1YUJ A;  4B3S E;  3J7A G;  3EPK A;  4DV1 E;  3L00 A;  2CPN A;  2RSM A;  1X3C A;  1T4N A;  1YYK A;  4M30 A;  2UXC E;  4JI3 E;  2NA2 A;  3MSW A;  4GKJ E;  1BBG A;  2V83 A;  1XMQ E;  3IWC A;  3BGH A;  4LF5 E;  2EOO A;  2EQ1 A;  5LLQ A;  4DR1 E;  3OML A;  2EMZ A;  2WBU A;  3EPL A;  4X64 E;  1EH8 A;  2EN6 A;  2YU8 A;  3C4T A;  2UXD E;  1X5W A;  4DMI A;  1HNW E;  2NUF A;  1T4L B;  2LBS B;  2JVA A;  2LUQ A;  2EPL X;  2R1F A;  4R8O A;  5AC4 A;  3UK3 C;  1WRJ A;  3IWB A;  4DR3 E;  1BBO A;  2JOB A;  3J7Y p;  1UHZ A;  2FGG A;  4MLQ A;  5A6K A;  2HC5 A;  4X66 E;  2EN8 A;  3H09 A;  5CFF E;  2JYA A;  1F2I G;  1ZU1 A;  2B7V A;  2EM8 A;  4B3M E;  2M9A A;  2EM9 A;  2FTX B;  1UIL A;  4L8N A;  2Q8U A;  1WJP A;  2EJ4 A;  2EPM X;  2K4V A;  3HXL A;  3VK6 A;  1PJS A;  4HEI A;  4F9C B;  5ADZ A;  4LTY A;  1T38 A;  2YTI A;  1IBL E;  4X65 E;  1A1K A;  1A1I A;  2ODR C;  2GLI A;  4WFT A;  2B3T B;  2LE2 A;  2VQF E;  1YZ9 A;  2YRK A;  1PJT A;  1QU6 A;  2EPC A;  2VQE E;  3THN A;  4WSG A;  2L2M A;  2JWO A;  2YSP A;  4X8W A;  2DLK A;  2LUP B;  3P1X A;  2V89 A;  2L33 A;  2YTE A;  3J81 C;  2NAB A;  2EMI A;  4BC9 A;  2EOY A;  1UN6 B;  2EOX A;  4LU9 A;  4O43 A;  2EMA A;  3HPS A;  2KOU A;  1ZBQ A;  3LML A;  2EQ0 A;  1XMO E;  5A6A A;  4ZYD A;  2L2K B;  2JOX A;  4DV6 E;  2EPO A;  1YPN A;  3C4B A;  4NXN E;  4R2R A;  1EH7 A;  2MKD A;  2YZT A;  1LLM C; 
#chains in the Genus database with same CATH homology
 1X3C A;  2CSH A;  2YTQ A;  2EN7 A;  2EOH A;  2RSI A;  4GZN C;  2I13 A;  1A1F A;  2EN3 A;  2EM5 A;  1UBD C;  2EOF A;  2EM6 A;  1DGC A;  1RMD A;  2EML A;  4F6N A;  2DMI A;  1AAY A;  2EN1 A;  1BB8 A;  2EMF A;  2EN4 A;  2EMG A;  2EOO A;  2EQ1 A;  1X6E A;  2EPP A;  5KL3 A;  2LO3 A;  1X6H A;  2EL6 A;  2EOI A;  2YRH A;  1Z1B A;  2EMZ A;  1G2D C;  2LCE A;  2EPR A;  2J7J A;  1X6F A;  2EL5 A;  2WBU A;  2BB8 A;  3EPL A;  1TF6 A;  2EMC A;  2RPC A;  4FK5 C;  4R2C A;  4R2S A;  2EN6 A;  2WCC 3;  2ADR A;  2YU8 A;  2LT7 A;  3MHS C;  1X5W A;  1A1H A;  2EM3 A;  2WBS A;  1ZAA C;  4R2E A;  2DRP A;  4M9V C;  1ZR9 A;  2EM7 A;  2YTJ A;  1P47 A;  2GHF A;  2R1F A;  3UK3 C;  2LVH A;  2YSO A;  2YRM A;  3M99 B;  5KL6 A;  2EMH A;  3EPJ A;  1TF3 A;  2JPA A;  2D9H A;  1TN9 A;  1BBO A;  2YTD A;  2DGC A;  1G2F C;  1JK2 A;  2YTG A;  2MDG A;  2EPA A;  2JP9 A;  2YTP A;  2YU5 A;  2EOM A;  2EN8 A;  2A25 A;  2EOJ A;  2EM4 A;  2E72 A;  1F2I G;  1ZU1 A;  2EM8 A;  5KL2 A;  2EL4 A;  1A1G A;  2M9A A;  2ELZ A;  2EMW A;  2EM9 A;  4F6M A;  1WJP A;  1KJK A;  2EJ4 A;  2MKN A;  2EPX A;  2MKD A;  2YTF A;  1MEY C;  2EN2 A;  1JK1 A;  3VHT B;  2YTI A;  4R2A A;  2EE8 A;  4IS1 C;  1A1K A;  2HGH A;  5KL4 A;  2WBT A;  1YSA C;  2YTN A;  2ENC A;  2EOZ A;  1A1I A;  2GLI A;  2EMY A;  2EQ3 A;  1A1J A;  2EOR A;  4R2D A;  1B69 A;  2YRK A;  2EPC A;  2YTO A;  2LV2 A;  2CTD A;  5KL5 A;  1NCS A;  3EPH A;  4WSG A;  4R2P A;  2ENH A;  2EMB A;  2YSP A;  2DLK A;  2EOS A;  4X9J A;  2DLQ A;  4IJD A;  2EP3 A;  2YTE A;  2NAB A;  2CT1 A;  2EMI A;  2EOY A;  5KL7 A;  2EM0 A;  2EOX A;  1UN6 B;  2EOQ A;  2EM2 A;  2ELY A;  2EMA A;  2EOE A;  1A1L A;  2EMK A;  2EPZ A;  2EQ0 A;  2EPU A;  4R2Q A;  2PRT A;  1YUJ A;  2VRD A;  2EMX A;  3MHH C;  4R2R A;  3EPK A;  4F2J C;  2ENA A;  1YUI A;  1LLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...