4F6NA

Crystal structure of kaiso zinc finger dna binding protein in complex with methylated cpg site dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Transcriptional regulator Kaiso
publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA02
1YSAC 5KL7A 1X5WA 2YTNA 2ENCA 1A1GA 2YRMA 1TF6A 2YTIA 2EMFA 1BBOA 4M9VC 2EM5A 2EMHA 2LO3A 1YUIA 2EE8A 5KL5A 2EPZA 2EMYA 5KL4A 2BB8A 2WBTA 2CT1A 2EN7A 2YSOA 2VRDA 4R2EA 4R2RA 2EM7A 1A1LA 2EM2A 2EM0A 2EPRA 2JPAA 2EOJA 3MHHC 4FK5C 2GHFA 5KL3A 1X6HA 2EL6A 2EOZA 4IS1C 1RMDA 4R2PA 2EMZA 1UBDC 2YTDA 2EMGA 1YUJA 4R2AA 2MKNA 1X6EA 2GLIA 1A1IA 2ENAA 2ENHA 2R1FA 2EPAA 1A1HA 2EL5A 3MHSC 1ZR9A 2EMWA 2A25A 2EP3A 2CTDA 2J7JA 2EOFA 2YSPA 2EPCA 2DGCA 2HGHA 2E72A 4F2JC 2EMXA 2NABA 4F6NA 3UK3C 2DMIA 1F2IG 2DRPA 1A1KA 2YTGA 2ADRA 1JK2A 3EPKA 2EM8A 2M9AA 2EOEA 2YTEA 2EM3A 2EMBA 1P47A 1UN6B 2EM9A 3M99B 5KL6A 2CSHA 2EMIA 4R2DA 2EMKA 1NCSA 2YRKA 4X9JA 1A1JA 2MDGA 2EOYA 2EQ1A 1X3CA 2EOOA 2EPXA 2EPPA 2WBUA 2EQ0A 1G2DC 2DLQA 1LLMC 2YTOA 4WSGA 2ELYA 4R2QA 3EPLA 2YTPA 2LT7A 2D9HA 2EOHA 2EOMA 2RPCA 1A1FA 2EN4A 2RSIA 1DGCA 1G2FC 2I13A 2EMLA 4R2SA 2EQ3A 4F6MA 2YU8A 4R2CA 1BB8A 2EOSA 2EMCA 4IJDA 2LVHA 2LCEA 1TN9A 2JP9A 3VHTB 2YTFA 1WJPA 2EMAA 2YTJA 2WBSA 2EOXA 1MEYC 2LV2A 1Z1BA 1AAYA 1ZAAC 2EPUA 2EN8A 2EN2A 2ELZA 2EM6A 2EN6A 2EN1A 2MKDA 5KL2A 1JK1A 2EOIA 1X6FA 3EPHA 1ZU1A 2WCC3 2EORA 4GZNC 2DLKA 1TF3A 2YTQA 3EPJA 2PRTA 2EJ4A 2YRHA 2EN3A 2EOQA 1KJKA 2EM4A 1B69A 2EL4A 2YU5A
chains in the Genus database with same CATH superfamily
3FIGA 1O0WA 1X5WA 3ADJA 4O5GA 4M2ZA 4M9VC 2EM5A 1WHNA 3IWDA 3F6GA 5KL5A 3J7AG 1J26A 2EPZA 3HXLA 3ADGA 2EMYA 4L8NA 1YZ9A 2YSOA 4DV1E 2JR1A 4DV3E 2LJUA 3HPSA 5LLQA 3MHHC 4FK5C 4DV2E 2EOZA 4IS1C 5DNYA 4HTGA 1IQOA 1X6EA 2CPNA 1I94E 1N34E 2ENHA 2R1FA 4N4RB 1PJQA 5LMNE 2EL5A 4DR2E 4WXDA 4DV4E 4LF9E 1STUA 2B9DA 2EMWA 2A25A 4JI4E 1AH5A 2EOFA 4TUIA 2JXPA 2DGCA 2NUEA 4JI8E 2UUAE 2LUPB 3UK3C 2ADRA 3BF2A 1P47A 4B3RE 4R03A 5IXMB 2KOUA 1UN6B 4OX9E 2EMIA 1EH8A 4NXME 2MDGA 2V87A 1X3CA 5ADZA 3BGHA 1ZBQA 2DLQA 5TSEA 1LLMC 4R2QA 1X48A 4X62E 2BBGA 2LT7A 2D9HA 1QU6A 2EOHA 2HJJA 2EOMA 3P1XA 2RPCA 4B3ME 4DV6E 2RSIA 2V88A 2RQLA 1DGCA 3HPZA 4ZYDA 2ODRD 5LMUE 5AE3A 2NUFA 3MSWA 3H09A 1XMQE 2UXCE 4LF8E 1YYWA 4JI1E 3EQ1A 3ZOQB 2YTFA 5IWAE 4LF7E 1WJPA 2YTJA 4BHBA 2EOXA 1WXRA 4WX9A 1AAYA 2MC6A 2EN8A 2ELZA 2EM6A 4B3TE 2MKDA 1XNRE 2EOIA 4ZYHA 2WCC3 2L33A 4GZNC 2UUBE 2YTQA 2EJ4A 2K4VA 2L3CA 1B69A 1IBLE 2I9IA 4ZYEA 2YU5A 1DQ3A 1UILA 1X47A 2YRMA 1TF6A 3J7Yp 4F9CB 1YUIA 1BBGA 3JU0A 2EE8A 4HEIA 2BB8A 4X66E 2WBTA 4KZSA 4DV5E 2EN7A 2EPLX 4R2RA 1A1LA 1N32E 2YWQA 2EM2A 3HQ1A 4O4KA 1RC7A 1YPNA 4F54A 1ZBTA 2EOJA 1NEIA 5CFFE 4JI6E 5KL3A 1X6HA 2EL6A 4GEQB 4DR4E 2HC5A 1YUJA 2MKNA 2F4VE 4DUZE 2V85A 4BS9A 4JV5E 2DMYA 4L5NC 1IBME 4LTYA 3K6QA 2EP3A 5AE1A 1T39A 2EPCA 2LMZA 4GKJE 2NABA 1F2IG 4BC9A 1EH6A 2YTGA 2RTXA 1JK2A 2F8BA 2UU9E 1N3GA 2VQEE 2EMBA 5BR8E 5KL6A 2DSYA 2CSHA 4X9JA 1NCSA 1YYKA 3KWRA 2EOYA 4F9AB 2LE2A 2HHHE 3ECRA 4P7DA 3TQMA 2L2MA 3EPLA 1L4SA 4O43A 2KONA 2RS7A 2DB2A 4BC7A 1HR0E 4JI7E 4R2SA 3BIDA 4KHPE 2M1SA 1BB8A 3KZYA 1EH7A 3F6HA 4IJDA 1N33E 5A2QC 1TN9A 4DV7E 2EMAA 3VYYA 1MEYC 5T6JA 3DJWA 5F3WA 2Q8UA 1Z1BA 2LTRA 1ZAAC 1MGTA 1SFEA 2EN2A 2EN6A 2EN1A 2LBSB 5A6AA 5KL2A 5A6BA 4B3SE 4JYAE 1TF3A 2N3GA 3EPJA 1HNWE 2EWLA 1KJKA 3J81C 2B7VA 2EL4A 1N36E 2H36X 3IWCA 2EPOA 3ADLA 3ADIA 2JYAA 2YTNA 1EKZA 2IHR1 2MDRA 2EMFA 1BBOA 1T4NA 2LO3A 5KL4A 4WSPA 1IMUA 4R2EA 2E1MA 4DUYE 4JI3E 2EM0A 3OMLA 2RS6A 2FV4B 2GHFA 2YPNA 1UHZA 3DF6A 4Q28A 4R2PA 1WHQA 2YT4A 1UBDC 4F9BB 2EMGA 1XNQE 2MC5A 4NXNE 3QG5C 2L2NA 2UXBE 2UXDE 3IWBA 3C4TA 4WFTA 2EPAA 3MHSC 2L2KB 1FJGE 2CTDA 2YZTA 2J7JA 4KWYA 5FLXC 4DKKA 1XMOE 2E72A 1DI2A 3J80C 1A1KA 2KHXA 2EM8A 2M9AA 2EOEA 3JAMC 2EM3A 4I8OA 4O24A 3M99B 3VYXA 2YRKA 1A1JA 2ZM6E 3C6KA 1GTKA 2EQ1A 1T38A 4RH8A 2EOOA 4LF5E 1G2DC 2EPPA 2WBUA 2EQ0A 2ELYA 2V89A 2LRSA 3LLHA 3C6MA 3OTOE 5A6JA 1PJSA 2EN4A 4J8ZA 1T4OA 4BHCA 4DMIA 2I13A 2EMLA 4K0KE 1T4LB 4F6MA 4YHHE 3T1HE 2V8QB 2EOSA 2ODRC 2M7QA 2LVHA 2LCEA 2GPIA 3RMPA 4DR1E 2LV2A 4WPYA 2LUQA 4JI0E 5IT9C 4GKKE 1JK1A 1X6FA 1ZU1A 2JVAA 1HNXE 2PRTA 2WZOA 2EN3A 2EOQA 2JY9A 5LL6R 2EZ6A 1YYOA 5IV8B 4F2JC 4R8OA 1YSAC 2LJHA 5KL7A 4NHRA 2ENCA 1A1GA 2B3TB 2YTIA 2EPMX 2L92A 3KZZA 4LFBE 2VF1A 1IQSA 2EMHA 2CT1A 4X65E 2VRDA 2EM7A 1X49A 2N3HA 2NA2A 1FKAE 3JTZA 2EPRA 4DR7E 2JPAA 5AASA 4TUGA 4JI2E 4X8WA 3THOB 1RMDA 2JWOA 2EMZA 2RSMA 2VQFE 3AUZA 1QNTA 2YTDA 4R2AA 3T1YE 2G7HA 1PKPA 2GLIA 1IBKE 1A1IA 1PJTA 2ENAA 2JOBA 5A69A 4LFCE 2UUCE 2EPNA 1A1HA 1YFHA 1ZR9A 1GQEA 1KYQA 2V86A 4M30A 5A6BD 5AC5A 4M0VA 1RQ0A 2YSPA 3BBGA 4Q35B 2LTSA 2DIXA 2N8XA 4NZVA 2HGHA 4LFAE 2EMXA 4OOGC 4F6NA 2DRPA 2DMIA 2V83A 4MLVA 4BMJA 4BBYA 3EPKA 2YTEA 2R76A 4ZYGA 2FGGA 4RHBB 2EM9A 2B7TA 2E5LE 2L6MA 4MLQA 4R2DA 2EMKA 2L8TA 4WXCA 3VK6A 1PDAA 4BCAA 4YY3E 2EPXA 5A6KA 4LF6E 1J5EE 4WYQB 2YTOA 4WSGA 2NUGA 4DR6E 2M4IA 2YTPA 1GZ6A 4DR3E 1HNZE 5AC4A 1A1FA 4X64E 4LU9A 1G2FC 3AV0A 2EQ3A 2VE7C 2YU8A 4R2CA 4DR5E 4AQYE 2EMCA 3THNA 2JOXA 2JP9A 3VHTB 2WBSA 3LMLA 2FTXB 2L3JA 2EPUA 1WRJA 4P78A 3HTXA 3EPHA 1SR9A 2EORA 3C4BA 2DLKA 2EPKX 4LF4E 4JI5E 2YRHA 5AE2A 4DV0E 2EM4A 3L00A 2K7IA
chains in the Genus database with same CATH topology
1YSAC 5KL7A 1X5WA 2YTNA 2ENCA 1A1GA 2YRMA 1TF6A 2YTIA 2EMFA 1BBOA 4M9VC 2EM5A 2EMHA 2LO3A 1YUIA 2EE8A 5KL5A 2EPZA 2EMYA 5KL4A 2BB8A 2WBTA 2CT1A 2EN7A 2YSOA 2VRDA 4R2EA 4R2RA 2EM7A 1A1LA 2EM2A 2EM0A 2EPRA 2JPAA 2EOJA 3MHHC 4FK5C 2GHFA 5KL3A 1X6HA 2EL6A 2EOZA 4IS1C 1RMDA 4R2PA 2EMZA 1UBDC 2YTDA 2EMGA 1YUJA 4R2AA 2MKNA 1X6EA 2GLIA 1A1IA 2ENAA 2ENHA 2R1FA 2EPAA 1A1HA 2EL5A 3MHSC 1ZR9A 2EMWA 2A25A 2EP3A 2CTDA 2J7JA 2EOFA 2YSPA 2EPCA 2DGCA 2HGHA 2E72A 4F2JC 2EMXA 2NABA 4F6NA 3UK3C 2DMIA 1F2IG 2DRPA 1A1KA 2YTGA 2ADRA 1JK2A 3EPKA 2EM8A 2M9AA 2EOEA 2YTEA 2EM3A 2EMBA 1P47A 1UN6B 2EM9A 3M99B 5KL6A 2CSHA 2EMIA 4R2DA 2EMKA 1NCSA 2YRKA 4X9JA 1A1JA 2MDGA 2EOYA 2EQ1A 1X3CA 2EOOA 2EPXA 2EPPA 2WBUA 2EQ0A 1G2DC 2DLQA 1LLMC 2YTOA 4WSGA 2ELYA 4R2QA 3EPLA 2YTPA 2LT7A 2D9HA 2EOHA 2EOMA 2RPCA 1A1FA 2EN4A 2RSIA 1DGCA 1G2FC 2I13A 2EMLA 4R2SA 2EQ3A 4F6MA 2YU8A 4R2CA 1BB8A 2EOSA 2EMCA 4IJDA 2LVHA 2LCEA 1TN9A 2JP9A 3VHTB 2YTFA 1WJPA 2EMAA 2YTJA 2WBSA 2EOXA 1MEYC 2LV2A 1Z1BA 1AAYA 1ZAAC 2EPUA 2EN8A 2EN2A 2ELZA 2EM6A 2EN6A 2EN1A 2MKDA 5KL2A 1JK1A 2EOIA 1X6FA 3EPHA 1ZU1A 2WCC3 2EORA 4GZNC 2DLKA 1TF3A 2YTQA 3EPJA 2PRTA 2EJ4A 2YRHA 2EN3A 2EOQA 1KJKA 2EM4A 1B69A 2EL4A 2YU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSA C;  5KL7 A;  1X5W A;  2YTN A;  2ENC A;  1A1G A;  2YRM A;  1TF6 A;  2YTI A;  2EMF A;  1BBO A;  4M9V C;  2EM5 A;  2EMH A;  2LO3 A;  1YUI A;  2EE8 A;  5KL5 A;  2EPZ A;  2EMY A;  5KL4 A;  2BB8 A;  2WBT A;  2CT1 A;  2EN7 A;  2YSO A;  2VRD A;  4R2E A;  4R2R A;  2EM7 A;  1A1L A;  2EM2 A;  2EM0 A;  2EPR A;  2JPA A;  2EOJ A;  3MHH C;  4FK5 C;  2GHF A;  5KL3 A;  1X6H A;  2EL6 A;  2EOZ A;  4IS1 C;  1RMD A;  4R2P A;  2EMZ A;  1UBD C;  2YTD A;  2EMG A;  1YUJ A;  4R2A A;  2MKN A;  1X6E A;  2GLI A;  1A1I A;  2ENA A;  2ENH A;  2R1F A;  2EPA A;  1A1H A;  2EL5 A;  3MHS C;  1ZR9 A;  2EMW A;  2A25 A;  2EP3 A;  2CTD A;  2J7J A;  2EOF A;  2YSP A;  2EPC A;  2DGC A;  2HGH A;  2E72 A;  4F2J C;  2EMX A;  2NAB A;  4F6N A;  3UK3 C;  2DMI A;  1F2I G;  2DRP A;  1A1K A;  2YTG A;  2ADR A;  1JK2 A;  3EPK A;  2EM8 A;  2M9A A;  2EOE A;  2YTE A;  2EM3 A;  2EMB A;  1P47 A;  1UN6 B;  2EM9 A;  3M99 B;  5KL6 A;  2CSH A;  2EMI A;  4R2D A;  2EMK A;  1NCS A;  2YRK A;  4X9J A;  1A1J A;  2MDG A;  2EOY A;  2EQ1 A;  1X3C A;  2EOO A;  2EPX A;  2EPP A;  2WBU A;  2EQ0 A;  1G2D C;  2DLQ A;  1LLM C;  2YTO A;  4WSG A;  2ELY A;  4R2Q A;  3EPL A;  2YTP A;  2LT7 A;  2D9H A;  2EOH A;  2EOM A;  2RPC A;  1A1F A;  2EN4 A;  2RSI A;  1DGC A;  1G2F C;  2I13 A;  2EML A;  4R2S A;  2EQ3 A;  4F6M A;  2YU8 A;  4R2C A;  1BB8 A;  2EOS A;  2EMC A;  4IJD A;  2LVH A;  2LCE A;  1TN9 A;  2JP9 A;  3VHT B;  2YTF A;  1WJP A;  2EMA A;  2YTJ A;  2WBS A;  2EOX A;  1MEY C;  2LV2 A;  1Z1B A;  1AAY A;  1ZAA C;  2EPU A;  2EN8 A;  2EN2 A;  2ELZ A;  2EM6 A;  2EN6 A;  2EN1 A;  2MKD A;  5KL2 A;  1JK1 A;  2EOI A;  1X6F A;  3EPH A;  1ZU1 A;  2WCC 3;  2EOR A;  4GZN C;  2DLK A;  1TF3 A;  2YTQ A;  3EPJ A;  2PRT A;  2EJ4 A;  2YRH A;  2EN3 A;  2EOQ A;  1KJK A;  2EM4 A;  1B69 A;  2EL4 A;  2YU5 A; 
#chains in the Genus database with same CATH topology
 3FIG A;  1O0W A;  1X5W A;  3ADJ A;  4O5G A;  4M2Z A;  4M9V C;  2EM5 A;  1WHN A;  3IWD A;  3F6G A;  5KL5 A;  3J7A G;  1J26 A;  2EPZ A;  3HXL A;  3ADG A;  2EMY A;  4L8N A;  1YZ9 A;  2YSO A;  4DV1 E;  2JR1 A;  4DV3 E;  2LJU A;  3HPS A;  5LLQ A;  3MHH C;  4FK5 C;  4DV2 E;  2EOZ A;  4IS1 C;  5DNY A;  4HTG A;  1IQO A;  1X6E A;  2CPN A;  1I94 E;  1N34 E;  2ENH A;  2R1F A;  4N4R B;  1PJQ A;  5LMN E;  2EL5 A;  4DR2 E;  4WXD A;  4DV4 E;  4LF9 E;  1STU A;  2B9D A;  2EMW A;  2A25 A;  4JI4 E;  1AH5 A;  2EOF A;  4TUI A;  2JXP A;  2DGC A;  2NUE A;  4JI8 E;  2UUA E;  2LUP B;  3UK3 C;  2ADR A;  3BF2 A;  1P47 A;  4B3R E;  4R03 A;  5IXM B;  2KOU A;  1UN6 B;  4OX9 E;  2EMI A;  1EH8 A;  4NXM E;  2MDG A;  2V87 A;  1X3C A;  5ADZ A;  3BGH A;  1ZBQ A;  2DLQ A;  5TSE A;  1LLM C;  4R2Q A;  1X48 A;  4X62 E;  2BBG A;  2LT7 A;  2D9H A;  1QU6 A;  2EOH A;  2HJJ A;  2EOM A;  3P1X A;  2RPC A;  4B3M E;  4DV6 E;  2RSI A;  2V88 A;  2RQL A;  1DGC A;  3HPZ A;  4ZYD A;  2ODR D;  5LMU E;  5AE3 A;  2NUF A;  3MSW A;  3H09 A;  1XMQ E;  2UXC E;  4LF8 E;  1YYW A;  4JI1 E;  3EQ1 A;  3ZOQ B;  2YTF A;  5IWA E;  4LF7 E;  1WJP A;  2YTJ A;  4BHB A;  2EOX A;  1WXR A;  4WX9 A;  1AAY A;  2MC6 A;  2EN8 A;  2ELZ A;  2EM6 A;  4B3T E;  2MKD A;  1XNR E;  2EOI A;  4ZYH A;  2WCC 3;  2L33 A;  4GZN C;  2UUB E;  2YTQ A;  2EJ4 A;  2K4V A;  2L3C A;  1B69 A;  1IBL E;  2I9I A;  4ZYE A;  2YU5 A;  1DQ3 A;  1UIL A;  1X47 A;  2YRM A;  1TF6 A;  3J7Y p;  4F9C B;  1YUI A;  1BBG A;  3JU0 A;  2EE8 A;  4HEI A;  2BB8 A;  4X66 E;  2WBT A;  4KZS A;  4DV5 E;  2EN7 A;  2EPL X;  4R2R A;  1A1L A;  1N32 E;  2YWQ A;  2EM2 A;  3HQ1 A;  4O4K A;  1RC7 A;  1YPN A;  4F54 A;  1ZBT A;  2EOJ A;  1NEI A;  5CFF E;  4JI6 E;  5KL3 A;  1X6H A;  2EL6 A;  4GEQ B;  4DR4 E;  2HC5 A;  1YUJ A;  2MKN A;  2F4V E;  4DUZ E;  2V85 A;  4BS9 A;  4JV5 E;  2DMY A;  4L5N C;  1IBM E;  4LTY A;  3K6Q A;  2EP3 A;  5AE1 A;  1T39 A;  2EPC A;  2LMZ A;  4GKJ E;  2NAB A;  1F2I G;  4BC9 A;  1EH6 A;  2YTG A;  2RTX A;  1JK2 A;  2F8B A;  2UU9 E;  1N3G A;  2VQE E;  2EMB A;  5BR8 E;  5KL6 A;  2DSY A;  2CSH A;  4X9J A;  1NCS A;  1YYK A;  3KWR A;  2EOY A;  4F9A B;  2LE2 A;  2HHH E;  3ECR A;  4P7D A;  3TQM A;  2L2M A;  3EPL A;  1L4S A;  4O43 A;  2KON A;  2RS7 A;  2DB2 A;  4BC7 A;  1HR0 E;  4JI7 E;  4R2S A;  3BID A;  4KHP E;  2M1S A;  1BB8 A;  3KZY A;  1EH7 A;  3F6H A;  4IJD A;  1N33 E;  5A2Q C;  1TN9 A;  4DV7 E;  2EMA A;  3VYY A;  1MEY C;  5T6J A;  3DJW A;  5F3W A;  2Q8U A;  1Z1B A;  2LTR A;  1ZAA C;  1MGT A;  1SFE A;  2EN2 A;  2EN6 A;  2EN1 A;  2LBS B;  5A6A A;  5KL2 A;  5A6B A;  4B3S E;  4JYA E;  1TF3 A;  2N3G A;  3EPJ A;  1HNW E;  2EWL A;  1KJK A;  3J81 C;  2B7V A;  2EL4 A;  1N36 E;  2H36 X;  3IWC A;  2EPO A;  3ADL A;  3ADI A;  2JYA A;  2YTN A;  1EKZ A;  2IHR 1;  2MDR A;  2EMF A;  1BBO A;  1T4N A;  2LO3 A;  5KL4 A;  4WSP A;  1IMU A;  4R2E A;  2E1M A;  4DUY E;  4JI3 E;  2EM0 A;  3OML A;  2RS6 A;  2FV4 B;  2GHF A;  2YPN A;  1UHZ A;  3DF6 A;  4Q28 A;  4R2P A;  1WHQ A;  2YT4 A;  1UBD C;  4F9B B;  2EMG A;  1XNQ E;  2MC5 A;  4NXN E;  3QG5 C;  2L2N A;  2UXB E;  2UXD E;  3IWB A;  3C4T A;  4WFT A;  2EPA A;  3MHS C;  2L2K B;  1FJG E;  2CTD A;  2YZT A;  2J7J A;  4KWY A;  5FLX C;  4DKK A;  1XMO E;  2E72 A;  1DI2 A;  3J80 C;  1A1K A;  2KHX A;  2EM8 A;  2M9A A;  2EOE A;  3JAM C;  2EM3 A;  4I8O A;  4O24 A;  3M99 B;  3VYX A;  2YRK A;  1A1J A;  2ZM6 E;  3C6K A;  1GTK A;  2EQ1 A;  1T38 A;  4RH8 A;  2EOO A;  4LF5 E;  1G2D C;  2EPP A;  2WBU A;  2EQ0 A;  2ELY A;  2V89 A;  2LRS A;  3LLH A;  3C6M A;  3OTO E;  5A6J A;  1PJS A;  2EN4 A;  4J8Z A;  1T4O A;  4BHC A;  4DMI A;  2I13 A;  2EML A;  4K0K E;  1T4L B;  4F6M A;  4YHH E;  3T1H E;  2V8Q B;  2EOS A;  2ODR C;  2M7Q A;  2LVH A;  2LCE A;  2GPI A;  3RMP A;  4DR1 E;  2LV2 A;  4WPY A;  2LUQ A;  4JI0 E;  5IT9 C;  4GKK E;  1JK1 A;  1X6F A;  1ZU1 A;  2JVA A;  1HNX E;  2PRT A;  2WZO A;  2EN3 A;  2EOQ A;  2JY9 A;  5LL6 R;  2EZ6 A;  1YYO A;  5IV8 B;  4F2J C;  4R8O A;  1YSA C;  2LJH A;  5KL7 A;  4NHR A;  2ENC A;  1A1G A;  2B3T B;  2YTI A;  2EPM X;  2L92 A;  3KZZ A;  4LFB E;  2VF1 A;  1IQS A;  2EMH A;  2CT1 A;  4X65 E;  2VRD A;  2EM7 A;  1X49 A;  2N3H A;  2NA2 A;  1FKA E;  3JTZ A;  2EPR A;  4DR7 E;  2JPA A;  5AAS A;  4TUG A;  4JI2 E;  4X8W A;  3THO B;  1RMD A;  2JWO A;  2EMZ A;  2RSM A;  2VQF E;  3AUZ A;  1QNT A;  2YTD A;  4R2A A;  3T1Y E;  2G7H A;  1PKP A;  2GLI A;  1IBK E;  1A1I A;  1PJT A;  2ENA A;  2JOB A;  5A69 A;  4LFC E;  2UUC E;  2EPN A;  1A1H A;  1YFH A;  1ZR9 A;  1GQE A;  1KYQ A;  2V86 A;  4M30 A;  5A6B D;  5AC5 A;  4M0V A;  1RQ0 A;  2YSP A;  3BBG A;  4Q35 B;  2LTS A;  2DIX A;  2N8X A;  4NZV A;  2HGH A;  4LFA E;  2EMX A;  4OOG C;  4F6N A;  2DRP A;  2DMI A;  2V83 A;  4MLV A;  4BMJ A;  4BBY A;  3EPK A;  2YTE A;  2R76 A;  4ZYG A;  2FGG A;  4RHB B;  2EM9 A;  2B7T A;  2E5L E;  2L6M A;  4MLQ A;  4R2D A;  2EMK A;  2L8T A;  4WXC A;  3VK6 A;  1PDA A;  4BCA A;  4YY3 E;  2EPX A;  5A6K A;  4LF6 E;  1J5E E;  4WYQ B;  2YTO A;  4WSG A;  2NUG A;  4DR6 E;  2M4I A;  2YTP A;  1GZ6 A;  4DR3 E;  1HNZ E;  5AC4 A;  1A1F A;  4X64 E;  4LU9 A;  1G2F C;  3AV0 A;  2EQ3 A;  2VE7 C;  2YU8 A;  4R2C A;  4DR5 E;  4AQY E;  2EMC A;  3THN A;  2JOX A;  2JP9 A;  3VHT B;  2WBS A;  3LML A;  2FTX B;  2L3J A;  2EPU A;  1WRJ A;  4P78 A;  3HTX A;  3EPH A;  1SR9 A;  2EOR A;  3C4B A;  2DLK A;  2EPK X;  4LF4 E;  4JI5 E;  2YRH A;  5AE2 A;  4DV0 E;  2EM4 A;  3L00 A;  2K7I A; 
#chains in the Genus database with same CATH homology
 1YSA C;  5KL7 A;  1X5W A;  2YTN A;  2ENC A;  1A1G A;  2YRM A;  1TF6 A;  2YTI A;  2EMF A;  1BBO A;  4M9V C;  2EM5 A;  2EMH A;  2LO3 A;  1YUI A;  2EE8 A;  5KL5 A;  2EPZ A;  2EMY A;  5KL4 A;  2BB8 A;  2WBT A;  2CT1 A;  2EN7 A;  2YSO A;  2VRD A;  4R2E A;  4R2R A;  2EM7 A;  1A1L A;  2EM2 A;  2EM0 A;  2EPR A;  2JPA A;  2EOJ A;  3MHH C;  4FK5 C;  2GHF A;  5KL3 A;  1X6H A;  2EL6 A;  2EOZ A;  4IS1 C;  1RMD A;  4R2P A;  2EMZ A;  1UBD C;  2YTD A;  2EMG A;  1YUJ A;  4R2A A;  2MKN A;  1X6E A;  2GLI A;  1A1I A;  2ENA A;  2ENH A;  2R1F A;  2EPA A;  1A1H A;  2EL5 A;  3MHS C;  1ZR9 A;  2EMW A;  2A25 A;  2EP3 A;  2CTD A;  2J7J A;  2EOF A;  2YSP A;  2EPC A;  2DGC A;  2HGH A;  2E72 A;  4F2J C;  2EMX A;  2NAB A;  4F6N A;  3UK3 C;  2DMI A;  1F2I G;  2DRP A;  1A1K A;  2YTG A;  2ADR A;  1JK2 A;  3EPK A;  2EM8 A;  2M9A A;  2EOE A;  2YTE A;  2EM3 A;  2EMB A;  1P47 A;  1UN6 B;  2EM9 A;  3M99 B;  5KL6 A;  2CSH A;  2EMI A;  4R2D A;  2EMK A;  1NCS A;  2YRK A;  4X9J A;  1A1J A;  2MDG A;  2EOY A;  2EQ1 A;  1X3C A;  2EOO A;  2EPX A;  2EPP A;  2WBU A;  2EQ0 A;  1G2D C;  2DLQ A;  1LLM C;  2YTO A;  4WSG A;  2ELY A;  4R2Q A;  3EPL A;  2YTP A;  2LT7 A;  2D9H A;  2EOH A;  2EOM A;  2RPC A;  1A1F A;  2EN4 A;  2RSI A;  1DGC A;  1G2F C;  2I13 A;  2EML A;  4R2S A;  2EQ3 A;  4F6M A;  2YU8 A;  4R2C A;  1BB8 A;  2EOS A;  2EMC A;  4IJD A;  2LVH A;  2LCE A;  1TN9 A;  2JP9 A;  3VHT B;  2YTF A;  1WJP A;  2EMA A;  2YTJ A;  2WBS A;  2EOX A;  1MEY C;  2LV2 A;  1Z1B A;  1AAY A;  1ZAA C;  2EPU A;  2EN8 A;  2EN2 A;  2ELZ A;  2EM6 A;  2EN6 A;  2EN1 A;  2MKD A;  5KL2 A;  1JK1 A;  2EOI A;  1X6F A;  3EPH A;  1ZU1 A;  2WCC 3;  2EOR A;  4GZN C;  2DLK A;  1TF3 A;  2YTQ A;  3EPJ A;  2PRT A;  2EJ4 A;  2YRH A;  2EN3 A;  2EOQ A;  1KJK A;  2EM4 A;  1B69 A;  2EL4 A;  2YU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...