4F6NA

Crystal structure of kaiso zinc finger dna binding protein in complex with methylated cpg site dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
b'DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator Kaiso
publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA02
1LLMC 2EMKA 4FK5C 2EL5A 2EM5A 4GZNC 2YTPA 2EOFA 2LCEA 2EMZA 4M9VC 1X3CA 2CTDA 1X6FA 5KL6A 1A1HA 2WBUA 2EOYA 1KJKA 2EN2A 2LV2A 2YRHA 2BB8A 1A1GA 1ZAAC 1BB8A 2MDGA 4IS1C 2EE8A 2LVHA 2EMBA 2DRPA 2YSPA 2EQ1A 2GLIA 3EPHA 2EOQA 2EMXA 2EOSA 2ENAA 3M99B 2EOMA 4F6MA 2EM8A 2EOEA 1JK1A 1TF3A 1A1LA 2EN3A 5KL2A 1RMDA 3UK3C 4R2EA 1P47A 2EN1A 2DLQA 2EPRA 2MKDA 2EMGA 2EPXA 1B69A 1X6HA 2WBSA 1DGCA 2A25A 2YTIA 2YU5A 4X9JA 2WCC3 1A1IA 2EMAA 1YSAC 2EMHA 2YTJA 2EPUA 4R2DA 2EM3A 2M9AA 1X6EA 1YUIA 1X5WA 1NCSA 2EOZA 4R2QA 2ENCA 1Z1BA 1BBOA 2EPZA 1AAYA 2EN4A 2EQ0A 5KL5A 2EM0A 2LO3A 5KL4A 2EOOA 5KL3A 1TN9A 1UBDC 1G2FC 1WJPA 1F2IG 2DLKA 4WSGA 3MHHC 2DGCA 2EM6A 3EPJA 2R1FA 3VHTB 4F6NA 2EPAA 2EOHA 2EL4A 2J7JA 2YTDA 2EL6A 1YUJA 2DMIA 2EPPA 2E72A 2EMFA 4R2CA 2VRDA 2EOXA 2EM4A 2ENHA 2YSOA 3EPKA 1TF6A 2EPCA 1A1FA 4R2RA 2EN6A 2EOJA 2NABA 2D9HA 1ZR9A 3EPLA 2EN7A 2YTOA 2YRMA 2MKNA 2YU8A 4F2JC 2ELZA 2YRKA 2CSHA 2ELYA 2EM9A 5KL7A 3MHSC 1A1KA 2HGHA 2I13A 1MEYC 2EMYA 2EJ4A 2EMWA 2LT7A 2EMCA 1JK2A 2WBTA 2YTGA 2JPAA 2EMLA 1G2DC 4R2AA 2EM2A 2PRTA 2EQ3A 2YTFA 2EORA 2EMIA 2ADRA 2YTEA 2RSIA 2JP9A 2EN8A 4R2PA 1A1JA 2CT1A 2GHFA 1UN6B 2YTNA 4IJDA 1ZU1A 2EOIA 2YTQA 2EM7A 2RPCA 2EP3A 4R2SA
chains in the Genus database with same CATH superfamily
2EMKA 3HPZA 2EL5A 4BC7A 1YYKA 5A6KA 4L5NC 4LF5E 4DR6E 3EQ1A 1X6FA 5KL6A 3HQ1A 4WX9A 3LMLA 1A1HA 4ZYDA 2JOXA 1KJKA 2B7VA 4DV0E 1L4SA 1KYQA 1RC7A 1ZAAC 2MDGA 2M7QA 1T38A 1PJQA 2EQ1A 2EOQA 4HTGA 3M99B 3JTZA 1SR9A 2UXBE 2EM8A 1JK1A 2JVAA 4X62E 4JI0E 1T4OA 1B69A 1DGCA 2A25A 1T4LB 1HNZE 4OOGC 1YUIA 3L00A 2EOZA 4WSPA 1EH7A 4JI7E 1AAYA 2EN4A 2EQ0A 1IBME 1SFEA 4DV5E 5T6JA 2MC5A 4LF7E 4P7DA 2F8BA 4ZYHA 2YZTA 2EZ6A 1UBDC 1G2FC 3H09A 2DGCA 4WSGA 2JR1A 2DMYA 3EPJA 2KHXA 3T1HE 2NA2A 2EPAA 3DJWA 3ZOQB 2RS6A 4DR1E 4DR7E 2DSYA 2EMFA 4R2CA 1YYWA 4R2RA 4NZVA 2LJUA 1T4NA 2EN7A 2YTOA 2YRMA 1HNWE 4O24A 2YRKA 1YPNA 4YHHE 1T39A 3MHSC 4LTYA 4BS9A 2EMYA 2EJ4A 4BCAA 2KONA 2EMCA 1JK2A 2WBTA 4R2AA 3OMLA 1QNTA 2ZM6E 1N36E 2ADRA 5AC4A 2RSIA 3HXLA 2RS7A 5FLXC 3BIDA 4AQYE 5LL6R 2CT1A 2GHFA 3DF6A 2EPMX 4R8OA 4DV1E 1UN6B 4BC9A 2N3HA 4P78A 2EP3A 1GZ6A 4R2SA 3HTXA 4NHRA 2YTPA 5A2QC 2LCEA 1YFHA 4M9VC 1X3CA 2GPIA 3KWRA 5AE2A 4X64E 3J81C 2JWOA 1PDAA 2EN2A 2LV2A 5AASA 1BB8A 2HJJA 2DIXA 4IS1C 2B9DA 4TUIA 2YSPA 2GLIA 2UXDE 2NUEA 2ODRD 5ADZA 4JI1E 2EMXA 2ENAA 5TSEA 3J80C 2B3TB 3ADJA 3J7Yp 2EN3A 1RQ0A 4DR3E 2EPRA 2DLQA 2MKDA 2L3JA 2EPLX 4DKKA 1X6HA 4DUYE 2YU5A 4X9JA 2VQFE 1A1IA 5AC5A 3ECRA 2M9AA 1X6EA 1X5WA 4GKJE 4F9AB 3F6GA 5IWAE 3IWCA 4R2QA 2ENCA 3K6QA 2EPZA 1IBLE 2LO3A 4JI8E 1WHQA 5KL3A 1EH6A 2EWLA 1WJPA 4WYQB 3HPSA 1ZBTA 4ZYGA 1F2IG 2YPNA 1NEIA 2JY9A 2RSMA 2UUCE 3VHTB 4F6NA 1STUA 2EL4A 2J7JA 2EPPA 2Q8UA 2VRDA 2EOXA 2YSOA 3KZZA 1O0WA 2D9HA 4DR4E 1ZR9A 1EH8A 3JU0A 2ELZA 1XMOE 2HGHA 2I13A 1MEYC 2H36X 4N4RB 4O5GA 2N3GA 4YY3E 4KZSA 5IT9C 2EPOA 4JI5E 1X47A 2UXCE 2M4IA 3J7AG 4NXME 2CPNA 2PRTA 1DQ3A 2E1MA 5AE1A 3ADLA 2EN8A 1UILA 2L3CA 2LMZA 2N8XA 2FGGA 2L92A 4IJDA 3OTOE 2YTQA 3F6HA 2EM7A 4DR5E 2EPNA 4TUGA 4NXNE 2V88A 4K0KE 1YZ9A 1J26A 4JI3E 4OX9E 1LLMC 4FK5C 1FKAE 2EM5A 4WXDA 5A6BA 4RH8A 3C4TA 4GEQB 3BBGA 4WFTA 2BBGA 4F54A 2EOYA 4LFBE 2NUFA 3VK6A 2BB8A 4LFCE 3THOB 1J5EE 2K4VA 1IMUA 2EE8A 2RQLA 2L2KB 1XNRE 3EPHA 4X65E 4F6MA 2L2NA 2EOEA 2FTXB 1UHZA 5IV8B 5LMUE 1P47A 1QU6A 2EMGA 2L8TA 2EPXA 1BBGA 2DB2A 2G7HA 2YTIA 2EMAA 1XNQE 1YSAC 1IQOA 1MGTA 2EMHA 2EPUA 4R2DA 2EM3A 2V83A 4MLVA 2MDRA 1BBOA 5KL5A 4WXCA 2V89A 2EM0A 5A6AA 2R76A 1HR0E 4BMJA 1DI2A 1X49A 4J8ZA 3ADGA 4F9BB 2DLKA 1YYOA 4O4KA 2V8QB 4BHBA 2KOUA 4WPYA 5CFFE 2RTXA 3LLHA 3IWBA 2NUGA 2LUPB 2UUBE 3AV0A 2UU9E 4LF4E 2VQEE 2EL6A 1YUJA 2DMIA 4Q28A 2L2MA 2EM4A 2ENHA 1TF6A 2EPCA 1A1FA 2EN6A 4LF6E 2NABA 4B3RE 3EPLA 2HC5A 2JOBA 4BBYA 5IXMB 2MKNA 2YU8A 4F2JC 2UUAE 2JXPA 2CSHA 2EM9A 5KL7A 1WHNA 3QG5C 4DV2E 2M1SA 2EMWA 3VYYA 5LMNE 2LRSA 2HHHE 4B3ME 4KHPE 2JPAA 2EMLA 1G2DC 5A69A 4M2ZA 2YTFA 2EMIA 5A6BD 4F9CB 2YTEA 5BR8E 4DMIA 1HNXE 4O43A 1A1JA 4HEIA 1FJGE 2YWQA 1ZU1A 4JV5E 4DUZE 3TQMA 2RPCA 3RMPA 2LE2A 4MLQA 2IHR1 3AUZA 3FIGA 4GZNC 1X48A 1WRJA 2EOFA 2EMZA 4DV6E 3KZYA 5A6JA 4X66E 2JYAA 4GKKE 2CTDA 2WBUA 2V85A 2YRHA 4LFAE 1A1GA 4R03A 2LVHA 1PKPA 4I8OA 2EMBA 2DRPA 5AE3A 2V87A 2FV4B 4L8NA 4DV7E 2EOSA 2EOMA 1TF3A 1IBKE 1A1LA 5KL2A 1RMDA 4JI4E 3UK3C 4R2EA 2EN1A 2L6MA 2V86A 2I9IA 4M30A 2LUQA 2WBSA 4X8WA 3P1XA 4RHBB 2WCC3 4JI6E 2YTJA 2K7IA 1PJTA 1NCSA 1N33E 1GQEA 1Z1BA 3C6KA 4B3TE 1PJSA 2B7TA 3BF2A 1N3GA 5KL4A 2EOOA 4M0VA 1TN9A 4LU9A 2LJHA 2WZOA 3MHHC 2EM6A 1ZBQA 1XMQE 4DV3E 2R1FA 4Q35B 2EOHA 1GTKA 2E5LE 3MSWA 2L33A 2YTDA 2VF1A 1EKZA 4ZYEA 2E72A 5DNYA 3C4BA 3EPKA 2EOJA 1AH5A 2MC6A 4JYAE 2ELYA 2YT4A 4LF9E 5F3WA 1A1KA 2EPKX 4KWYA 2LT7A 1N32E 4B3SE 3VYXA 2LTRA 2YTGA 3THNA 2EM2A 2EQ3A 2LTSA 3T1YE 4JI2E 2EORA 1I94E 4BHCA 4DR2E 2JP9A 3C6MA 4LF8E 3IWDA 2F4VE 4R2PA 2LBSB 1IQSA 2ODRC 2YTNA 2EOIA 3JAMC 2VE7C 4DV4E 5LLQA 1N34E 1WXRA 3BGHA 3ADIA
chains in the Genus database with same CATH topology
1LLMC 2EMKA 4FK5C 2EL5A 2EM5A 4GZNC 2YTPA 2EOFA 2LCEA 2EMZA 4M9VC 1X3CA 2CTDA 1X6FA 5KL6A 1A1HA 2WBUA 2EOYA 1KJKA 2EN2A 2LV2A 2YRHA 2BB8A 1A1GA 1ZAAC 1BB8A 2MDGA 4IS1C 2EE8A 2LVHA 2EMBA 2DRPA 2YSPA 2EQ1A 2GLIA 3EPHA 2EOQA 2EMXA 2EOSA 2ENAA 3M99B 2EOMA 4F6MA 2EM8A 2EOEA 1JK1A 1TF3A 1A1LA 2EN3A 5KL2A 1RMDA 3UK3C 4R2EA 1P47A 2EN1A 2DLQA 2EPRA 2MKDA 2EMGA 2EPXA 1B69A 1X6HA 2WBSA 1DGCA 2A25A 2YTIA 2YU5A 4X9JA 2WCC3 1A1IA 2EMAA 1YSAC 2EMHA 2YTJA 2EPUA 4R2DA 2EM3A 2M9AA 1X6EA 1YUIA 1X5WA 1NCSA 2EOZA 4R2QA 2ENCA 1Z1BA 1BBOA 2EPZA 1AAYA 2EN4A 2EQ0A 5KL5A 2EM0A 2LO3A 5KL4A 2EOOA 5KL3A 1TN9A 1UBDC 1G2FC 1WJPA 1F2IG 2DLKA 4WSGA 3MHHC 2DGCA 2EM6A 3EPJA 2R1FA 3VHTB 4F6NA 2EPAA 2EOHA 2EL4A 2J7JA 2YTDA 2EL6A 1YUJA 2DMIA 2EPPA 2E72A 2EMFA 4R2CA 2VRDA 2EOXA 2EM4A 2ENHA 2YSOA 3EPKA 1TF6A 2EPCA 1A1FA 4R2RA 2EN6A 2EOJA 2NABA 2D9HA 1ZR9A 3EPLA 2EN7A 2YTOA 2YRMA 2MKNA 2YU8A 4F2JC 2ELZA 2YRKA 2CSHA 2ELYA 2EM9A 5KL7A 3MHSC 1A1KA 2HGHA 2I13A 1MEYC 2EMYA 2EJ4A 2EMWA 2LT7A 2EMCA 1JK2A 2WBTA 2YTGA 2JPAA 2EMLA 1G2DC 4R2AA 2EM2A 2PRTA 2EQ3A 2YTFA 2EORA 2EMIA 2ADRA 2YTEA 2RSIA 2JP9A 2EN8A 4R2PA 1A1JA 2CT1A 2GHFA 1UN6B 2YTNA 4IJDA 1ZU1A 2EOIA 2YTQA 2EM7A 2RPCA 2EP3A 4R2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LLM C;  2EMK A;  4FK5 C;  2EL5 A;  2EM5 A;  4GZN C;  2YTP A;  2EOF A;  2LCE A;  2EMZ A;  4M9V C;  1X3C A;  2CTD A;  1X6F A;  5KL6 A;  1A1H A;  2WBU A;  2EOY A;  1KJK A;  2EN2 A;  2LV2 A;  2YRH A;  2BB8 A;  1A1G A;  1ZAA C;  1BB8 A;  2MDG A;  4IS1 C;  2EE8 A;  2LVH A;  2EMB A;  2DRP A;  2YSP A;  2EQ1 A;  2GLI A;  3EPH A;  2EOQ A;  2EMX A;  2EOS A;  2ENA A;  3M99 B;  2EOM A;  4F6M A;  2EM8 A;  2EOE A;  1JK1 A;  1TF3 A;  1A1L A;  2EN3 A;  5KL2 A;  1RMD A;  3UK3 C;  4R2E A;  1P47 A;  2EN1 A;  2DLQ A;  2EPR A;  2MKD A;  2EMG A;  2EPX A;  1B69 A;  1X6H A;  2WBS A;  1DGC A;  2A25 A;  2YTI A;  2YU5 A;  4X9J A;  2WCC 3;  1A1I A;  2EMA A;  1YSA C;  2EMH A;  2YTJ A;  2EPU A;  4R2D A;  2EM3 A;  2M9A A;  1X6E A;  1YUI A;  1X5W A;  1NCS A;  2EOZ A;  4R2Q A;  2ENC A;  1Z1B A;  1BBO A;  2EPZ A;  1AAY A;  2EN4 A;  2EQ0 A;  5KL5 A;  2EM0 A;  2LO3 A;  5KL4 A;  2EOO A;  5KL3 A;  1TN9 A;  1UBD C;  1G2F C;  1WJP A;  1F2I G;  2DLK A;  4WSG A;  3MHH C;  2DGC A;  2EM6 A;  3EPJ A;  2R1F A;  3VHT B;  4F6N A;  2EPA A;  2EOH A;  2EL4 A;  2J7J A;  2YTD A;  2EL6 A;  1YUJ A;  2DMI A;  2EPP A;  2E72 A;  2EMF A;  4R2C A;  2VRD A;  2EOX A;  2EM4 A;  2ENH A;  2YSO A;  3EPK A;  1TF6 A;  2EPC A;  1A1F A;  4R2R A;  2EN6 A;  2EOJ A;  2NAB A;  2D9H A;  1ZR9 A;  3EPL A;  2EN7 A;  2YTO A;  2YRM A;  2MKN A;  2YU8 A;  4F2J C;  2ELZ A;  2YRK A;  2CSH A;  2ELY A;  2EM9 A;  5KL7 A;  3MHS C;  1A1K A;  2HGH A;  2I13 A;  1MEY C;  2EMY A;  2EJ4 A;  2EMW A;  2LT7 A;  2EMC A;  1JK2 A;  2WBT A;  2YTG A;  2JPA A;  2EML A;  1G2D C;  4R2A A;  2EM2 A;  2PRT A;  2EQ3 A;  2YTF A;  2EOR A;  2EMI A;  2ADR A;  2YTE A;  2RSI A;  2JP9 A;  2EN8 A;  4R2P A;  1A1J A;  2CT1 A;  2GHF A;  1UN6 B;  2YTN A;  4IJD A;  1ZU1 A;  2EOI A;  2YTQ A;  2EM7 A;  2RPC A;  2EP3 A;  4R2S A; 
#chains in the Genus database with same CATH topology
 2EMK A;  3HPZ A;  2EL5 A;  4BC7 A;  1YYK A;  5A6K A;  4L5N C;  4LF5 E;  4DR6 E;  3EQ1 A;  1X6F A;  5KL6 A;  3HQ1 A;  4WX9 A;  3LML A;  1A1H A;  4ZYD A;  2JOX A;  1KJK A;  2B7V A;  4DV0 E;  1L4S A;  1KYQ A;  1RC7 A;  1ZAA C;  2MDG A;  2M7Q A;  1T38 A;  1PJQ A;  2EQ1 A;  2EOQ A;  4HTG A;  3M99 B;  3JTZ A;  1SR9 A;  2UXB E;  2EM8 A;  1JK1 A;  2JVA A;  4X62 E;  4JI0 E;  1T4O A;  1B69 A;  1DGC A;  2A25 A;  1T4L B;  1HNZ E;  4OOG C;  1YUI A;  3L00 A;  2EOZ A;  4WSP A;  1EH7 A;  4JI7 E;  1AAY A;  2EN4 A;  2EQ0 A;  1IBM E;  1SFE A;  4DV5 E;  5T6J A;  2MC5 A;  4LF7 E;  4P7D A;  2F8B A;  4ZYH A;  2YZT A;  2EZ6 A;  1UBD C;  1G2F C;  3H09 A;  2DGC A;  4WSG A;  2JR1 A;  2DMY A;  3EPJ A;  2KHX A;  3T1H E;  2NA2 A;  2EPA A;  3DJW A;  3ZOQ B;  2RS6 A;  4DR1 E;  4DR7 E;  2DSY A;  2EMF A;  4R2C A;  1YYW A;  4R2R A;  4NZV A;  2LJU A;  1T4N A;  2EN7 A;  2YTO A;  2YRM A;  1HNW E;  4O24 A;  2YRK A;  1YPN A;  4YHH E;  1T39 A;  3MHS C;  4LTY A;  4BS9 A;  2EMY A;  2EJ4 A;  4BCA A;  2KON A;  2EMC A;  1JK2 A;  2WBT A;  4R2A A;  3OML A;  1QNT A;  2ZM6 E;  1N36 E;  2ADR A;  5AC4 A;  2RSI A;  3HXL A;  2RS7 A;  5FLX C;  3BID A;  4AQY E;  5LL6 R;  2CT1 A;  2GHF A;  3DF6 A;  2EPM X;  4R8O A;  4DV1 E;  1UN6 B;  4BC9 A;  2N3H A;  4P78 A;  2EP3 A;  1GZ6 A;  4R2S A;  3HTX A;  4NHR A;  2YTP A;  5A2Q C;  2LCE A;  1YFH A;  4M9V C;  1X3C A;  2GPI A;  3KWR A;  5AE2 A;  4X64 E;  3J81 C;  2JWO A;  1PDA A;  2EN2 A;  2LV2 A;  5AAS A;  1BB8 A;  2HJJ A;  2DIX A;  4IS1 C;  2B9D A;  4TUI A;  2YSP A;  2GLI A;  2UXD E;  2NUE A;  2ODR D;  5ADZ A;  4JI1 E;  2EMX A;  2ENA A;  5TSE A;  3J80 C;  2B3T B;  3ADJ A;  3J7Y p;  2EN3 A;  1RQ0 A;  4DR3 E;  2EPR A;  2DLQ A;  2MKD A;  2L3J A;  2EPL X;  4DKK A;  1X6H A;  4DUY E;  2YU5 A;  4X9J A;  2VQF E;  1A1I A;  5AC5 A;  3ECR A;  2M9A A;  1X6E A;  1X5W A;  4GKJ E;  4F9A B;  3F6G A;  5IWA E;  3IWC A;  4R2Q A;  2ENC A;  3K6Q A;  2EPZ A;  1IBL E;  2LO3 A;  4JI8 E;  1WHQ A;  5KL3 A;  1EH6 A;  2EWL A;  1WJP A;  4WYQ B;  3HPS A;  1ZBT A;  4ZYG A;  1F2I G;  2YPN A;  1NEI A;  2JY9 A;  2RSM A;  2UUC E;  3VHT B;  4F6N A;  1STU A;  2EL4 A;  2J7J A;  2EPP A;  2Q8U A;  2VRD A;  2EOX A;  2YSO A;  3KZZ A;  1O0W A;  2D9H A;  4DR4 E;  1ZR9 A;  1EH8 A;  3JU0 A;  2ELZ A;  1XMO E;  2HGH A;  2I13 A;  1MEY C;  2H36 X;  4N4R B;  4O5G A;  2N3G A;  4YY3 E;  4KZS A;  5IT9 C;  2EPO A;  4JI5 E;  1X47 A;  2UXC E;  2M4I A;  3J7A G;  4NXM E;  2CPN A;  2PRT A;  1DQ3 A;  2E1M A;  5AE1 A;  3ADL A;  2EN8 A;  1UIL A;  2L3C A;  2LMZ A;  2N8X A;  2FGG A;  2L92 A;  4IJD A;  3OTO E;  2YTQ A;  3F6H A;  2EM7 A;  4DR5 E;  2EPN A;  4TUG A;  4NXN E;  2V88 A;  4K0K E;  1YZ9 A;  1J26 A;  4JI3 E;  4OX9 E;  1LLM C;  4FK5 C;  1FKA E;  2EM5 A;  4WXD A;  5A6B A;  4RH8 A;  3C4T A;  4GEQ B;  3BBG A;  4WFT A;  2BBG A;  4F54 A;  2EOY A;  4LFB E;  2NUF A;  3VK6 A;  2BB8 A;  4LFC E;  3THO B;  1J5E E;  2K4V A;  1IMU A;  2EE8 A;  2RQL A;  2L2K B;  1XNR E;  3EPH A;  4X65 E;  4F6M A;  2L2N A;  2EOE A;  2FTX B;  1UHZ A;  5IV8 B;  5LMU E;  1P47 A;  1QU6 A;  2EMG A;  2L8T A;  2EPX A;  1BBG A;  2DB2 A;  2G7H A;  2YTI A;  2EMA A;  1XNQ E;  1YSA C;  1IQO A;  1MGT A;  2EMH A;  2EPU A;  4R2D A;  2EM3 A;  2V83 A;  4MLV A;  2MDR A;  1BBO A;  5KL5 A;  4WXC A;  2V89 A;  2EM0 A;  5A6A A;  2R76 A;  1HR0 E;  4BMJ A;  1DI2 A;  1X49 A;  4J8Z A;  3ADG A;  4F9B B;  2DLK A;  1YYO A;  4O4K A;  2V8Q B;  4BHB A;  2KOU A;  4WPY A;  5CFF E;  2RTX A;  3LLH A;  3IWB A;  2NUG A;  2LUP B;  2UUB E;  3AV0 A;  2UU9 E;  4LF4 E;  2VQE E;  2EL6 A;  1YUJ A;  2DMI A;  4Q28 A;  2L2M A;  2EM4 A;  2ENH A;  1TF6 A;  2EPC A;  1A1F A;  2EN6 A;  4LF6 E;  2NAB A;  4B3R E;  3EPL A;  2HC5 A;  2JOB A;  4BBY A;  5IXM B;  2MKN A;  2YU8 A;  4F2J C;  2UUA E;  2JXP A;  2CSH A;  2EM9 A;  5KL7 A;  1WHN A;  3QG5 C;  4DV2 E;  2M1S A;  2EMW A;  3VYY A;  5LMN E;  2LRS A;  2HHH E;  4B3M E;  4KHP E;  2JPA A;  2EML A;  1G2D C;  5A69 A;  4M2Z A;  2YTF A;  2EMI A;  5A6B D;  4F9C B;  2YTE A;  5BR8 E;  4DMI A;  1HNX E;  4O43 A;  1A1J A;  4HEI A;  1FJG E;  2YWQ A;  1ZU1 A;  4JV5 E;  4DUZ E;  3TQM A;  2RPC A;  3RMP A;  2LE2 A;  4MLQ A;  2IHR 1;  3AUZ A;  3FIG A;  4GZN C;  1X48 A;  1WRJ A;  2EOF A;  2EMZ A;  4DV6 E;  3KZY A;  5A6J A;  4X66 E;  2JYA A;  4GKK E;  2CTD A;  2WBU A;  2V85 A;  2YRH A;  4LFA E;  1A1G A;  4R03 A;  2LVH A;  1PKP A;  4I8O A;  2EMB A;  2DRP A;  5AE3 A;  2V87 A;  2FV4 B;  4L8N A;  4DV7 E;  2EOS A;  2EOM A;  1TF3 A;  1IBK E;  1A1L A;  5KL2 A;  1RMD A;  4JI4 E;  3UK3 C;  4R2E A;  2EN1 A;  2L6M A;  2V86 A;  2I9I A;  4M30 A;  2LUQ A;  2WBS A;  4X8W A;  3P1X A;  4RHB B;  2WCC 3;  4JI6 E;  2YTJ A;  2K7I A;  1PJT A;  1NCS A;  1N33 E;  1GQE A;  1Z1B A;  3C6K A;  4B3T E;  1PJS A;  2B7T A;  3BF2 A;  1N3G A;  5KL4 A;  2EOO A;  4M0V A;  1TN9 A;  4LU9 A;  2LJH A;  2WZO A;  3MHH C;  2EM6 A;  1ZBQ A;  1XMQ E;  4DV3 E;  2R1F A;  4Q35 B;  2EOH A;  1GTK A;  2E5L E;  3MSW A;  2L33 A;  2YTD A;  2VF1 A;  1EKZ A;  4ZYE A;  2E72 A;  5DNY A;  3C4B A;  3EPK A;  2EOJ A;  1AH5 A;  2MC6 A;  4JYA E;  2ELY A;  2YT4 A;  4LF9 E;  5F3W A;  1A1K A;  2EPK X;  4KWY A;  2LT7 A;  1N32 E;  4B3S E;  3VYX A;  2LTR A;  2YTG A;  3THN A;  2EM2 A;  2EQ3 A;  2LTS A;  3T1Y E;  4JI2 E;  2EOR A;  1I94 E;  4BHC A;  4DR2 E;  2JP9 A;  3C6M A;  4LF8 E;  3IWD A;  2F4V E;  4R2P A;  2LBS B;  1IQS A;  2ODR C;  2YTN A;  2EOI A;  3JAM C;  2VE7 C;  4DV4 E;  5LLQ A;  1N34 E;  1WXR A;  3BGH A;  3ADI A; 
#chains in the Genus database with same CATH homology
 1LLM C;  2EMK A;  4FK5 C;  2EL5 A;  2EM5 A;  4GZN C;  2YTP A;  2EOF A;  2LCE A;  2EMZ A;  4M9V C;  1X3C A;  2CTD A;  1X6F A;  5KL6 A;  1A1H A;  2WBU A;  2EOY A;  1KJK A;  2EN2 A;  2LV2 A;  2YRH A;  2BB8 A;  1A1G A;  1ZAA C;  1BB8 A;  2MDG A;  4IS1 C;  2EE8 A;  2LVH A;  2EMB A;  2DRP A;  2YSP A;  2EQ1 A;  2GLI A;  3EPH A;  2EOQ A;  2EMX A;  2EOS A;  2ENA A;  3M99 B;  2EOM A;  4F6M A;  2EM8 A;  2EOE A;  1JK1 A;  1TF3 A;  1A1L A;  2EN3 A;  5KL2 A;  1RMD A;  3UK3 C;  4R2E A;  1P47 A;  2EN1 A;  2DLQ A;  2EPR A;  2MKD A;  2EMG A;  2EPX A;  1B69 A;  1X6H A;  2WBS A;  1DGC A;  2A25 A;  2YTI A;  2YU5 A;  4X9J A;  2WCC 3;  1A1I A;  2EMA A;  1YSA C;  2EMH A;  2YTJ A;  2EPU A;  4R2D A;  2EM3 A;  2M9A A;  1X6E A;  1YUI A;  1X5W A;  1NCS A;  2EOZ A;  4R2Q A;  2ENC A;  1Z1B A;  1BBO A;  2EPZ A;  1AAY A;  2EN4 A;  2EQ0 A;  5KL5 A;  2EM0 A;  2LO3 A;  5KL4 A;  2EOO A;  5KL3 A;  1TN9 A;  1UBD C;  1G2F C;  1WJP A;  1F2I G;  2DLK A;  4WSG A;  3MHH C;  2DGC A;  2EM6 A;  3EPJ A;  2R1F A;  3VHT B;  4F6N A;  2EPA A;  2EOH A;  2EL4 A;  2J7J A;  2YTD A;  2EL6 A;  1YUJ A;  2DMI A;  2EPP A;  2E72 A;  2EMF A;  4R2C A;  2VRD A;  2EOX A;  2EM4 A;  2ENH A;  2YSO A;  3EPK A;  1TF6 A;  2EPC A;  1A1F A;  4R2R A;  2EN6 A;  2EOJ A;  2NAB A;  2D9H A;  1ZR9 A;  3EPL A;  2EN7 A;  2YTO A;  2YRM A;  2MKN A;  2YU8 A;  4F2J C;  2ELZ A;  2YRK A;  2CSH A;  2ELY A;  2EM9 A;  5KL7 A;  3MHS C;  1A1K A;  2HGH A;  2I13 A;  1MEY C;  2EMY A;  2EJ4 A;  2EMW A;  2LT7 A;  2EMC A;  1JK2 A;  2WBT A;  2YTG A;  2JPA A;  2EML A;  1G2D C;  4R2A A;  2EM2 A;  2PRT A;  2EQ3 A;  2YTF A;  2EOR A;  2EMI A;  2ADR A;  2YTE A;  2RSI A;  2JP9 A;  2EN8 A;  4R2P A;  1A1J A;  2CT1 A;  2GHF A;  1UN6 B;  2YTN A;  4IJD A;  1ZU1 A;  2EOI A;  2YTQ A;  2EM7 A;  2RPC A;  2EP3 A;  4R2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...