4F6NA

Crystal structure of kaiso zinc finger dna binding protein in complex with methylated cpg site dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator Kaiso
publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA02
2LO3A 4R2DA 2EM2A 1YUJA 2EQ3A 2GHFA 2A25A 3MHHC 2MDGA 1UBDC 5KL3A 4R2CA 1G2DC 1DGCA 2EM6A 2HGHA 2EM8A 2WBTA 4IJDA 2EOQA 2EMKA 2YTDA 1ZR9A 2EPRA 2ENAA 2CT1A 2CSHA 2DMIA 2I13A 2EM9A 4R2EA 2BB8A 2EOYA 2YTIA 2YRMA 2YSPA 1UN6B 1Z1BA 2EMAA 4GZNC 2EE8A 4F6NA 2EN1A 2EQ1A 1A1GA 2EMXA 1JK1A 2J7JA 2LVHA 2EM0A 2YRKA 2DGCA 2EM3A 2EPAA 2YRHA 4R2PA 4R2AA 2EM5A 4M9VC 2WBUA 2YTFA 2YU8A 2EL6A 3EPJA 2EMYA 2DLQA 2JP9A 1YSAC 2LCEA 4IS1C 2EMIA 2EMCA 2E72A 2EPPA 2CTDA 2YTEA 4X9JA 1X3CA 2ELZA 1MEYC 1TN9A 2YTNA 1A1JA 1ZU1A 1X6EA 2EP3A 2EPUA 1JK2A 1TF6A 2NABA 3EPLA 2WCC3 1NCSA 1BBOA 1A1IA 1X5WA 2EPXA 1A1LA 1A1KA 2M9AA 2ELYA 2EL5A 2EN6A 2YTGA 1X6HA 3EPHA 2EORA 2DRPA 2MKNA 2EN7A 2EQ0A 3EPKA 2EOOA 2YTPA 2DLKA 2EMBA 5KL6A 2EOIA 2LT7A 1P47A 1TF3A 2EN8A 2ENHA 2EOZA 2LV2A 2ENCA 2WBSA 1LLMC 2EMWA 2EOHA 2R1FA 2RPCA 2EOEA 5KL7A 1A1FA 2EMFA 4F6MA 4R2QA 2PRTA 1KJKA 2YU5A 2YTJA 5KL4A 2EJ4A 2JPAA 2YTQA 2EN3A 2EMZA 1X6FA 2VRDA 2EN2A 2EOSA 3M99B 1F2IG 4R2SA 2EM7A 4R2RA 2EL4A 2EOFA 1WJPA 2EPZA 3VHTB 2GLIA 1RMDA 1B69A 2MKDA 5KL2A 1AAYA 2EOMA 1ZAAC 2RSIA 2EMGA 3UK3C 4FK5C 1YUIA 2EOXA 2EMHA 1A1HA 2D9HA 1BB8A 4WSGA 2EOJA 1G2FC 2EN4A 3MHSC 2ADRA 4F2JC 2EPCA 2EM4A 2YSOA 2EMLA 5KL5A 2YTOA
chains in the Genus database with same CATH superfamily
4JI2E 4WPYA 2HHHE 2EQ3A 3BBGA 2UUCE 4L5NC 4OOGC 1PDAA 4F54A 5AE2A 1DGCA 2FV4B 1RC7A 4BS9A 2EMKA 4LF6E 3L00A 2EPRA 2MC6A 5DNYA 2CSHA 1ZBQA 2DMIA 4R2EA 2YTIA 4DR4E 3EQ1A 3JTZA 5CFFE 1UN6B 2EMAA 1A1GA 3K6QA 1X47A 2EMXA 5ADZA 4TUIA 4R03A 1O0WA 4X62E 2JYAA 2YRHA 2UXCE 4L8NA 4R2PA 2EM5A 1ZBTA 2YU8A 2I9IA 3EPJA 4DV4E 2DLQA 2JP9A 5FLXC 2VF1A 2EPPA 1IQOA 4X9JA 2DB2A 3HPSA 2F4VE 5A6AA 1RQ0A 2YPNA 3C6KA 3ZOQB 1ZU1A 2E1MA 1JK2A 2BBGA 4YHHE 1NCSA 2WCC3 4AQYE 1A1LA 4JI3E 3IWDA 2YWQA 3ADIA 1PJQA 3MSWA 5IXMB 5AC4A 2L2KB 1IBLE 3VYYA 3QG5C 2YTPA 1TF3A 2EOIA 1P47A 1T4OA 1LLMC 2R1FA 3H09A 2JXPA 5A69A 2V88A 4F9BB 1FJGE 2EJ4A 2KOUA 2EN3A 1SR9A 1X6FA 2VRDA 4DV2E 2F8BA 4DR1E 4JI1E 4JI6E 4LF7E 3M99B 1F2IG 2EM7A 2JOXA 2EOFA 2MC5A 4LFAE 1EH7A 1QU6A 4DV1E 3OMLA 2LJHA 4J8ZA 3UK3C 4BCAA 4GKJE 2EMHA 1PJSA 4F9CB 5AE1A 4ZYEA 2EOJA 1G2FC 2UUBE 2EN4A 4WXCA 2L3CA 3J80C 5AE3A 1XNRE 2LO3A 4R2DA 3ECRA 5AC5A 3VYXA 3KWRA 3HTXA 3DF6A 2EM6A 2HGHA 2UU9E 4DMIA 2WBTA 3OTOE 4IJDA 2V86A 4MLVA 4BC7A 2YTDA 4LF8E 1ZR9A 2LTRA 1DI2A 4Q35B 2I13A 2EM9A 2EOYA 2KHXA 1GQEA 2YSPA 4DUYE 1Z1BA 4GZNC 4F6NA 2EN1A 2VQFE 4DR5E 4YY3E 1EKZA 2UUAE 4LFCE 2M1SA 1T39A 4M9VC 2YTFA 4BHBA 4DR3E 1T38A 4DV6E 3BF2A 1YPNA 2EMCA 2CTDA 2YTEA 4JI8E 1X3CA 2ELZA 2NA2A 2JY9A 2ODRC 3HQ1A 4RHBB 4WFTA 4JI4E 1TN9A 1NEIA 2EP3A 2LTSA 4OX9E 3EPLA 3BIDA 1X5WA 3FIGA 3THNA 2EPXA 4HEIA 4LU9A 2EZ6A 1A1KA 2EL5A 2EN6A 4O4KA 2EQ0A 3EPKA 4GKKE 3AUZA 5KL6A 2EN8A 2LV2A 4HTGA 2WBSA 2ENCA 3J81C 1A1FA 2EMWA 2EOHA 1EH8A 5KL7A 2EMFA 4M30A 1UHZA 2PRTA 4DV0E 2JWOA 2YU5A 1YFHA 4WSPA 4DKKA 2YZTA 2JPAA 1J5EE 1KYQA 1WHNA 2UXBE 2L3JA 5IV8B 3KZZA 1AH5A 3VHTB 5IT9C 2N3GA 1B69A 2MKDA 1AAYA 5A2QC 2LE2A 2EMGA 2EPLX 4KWYA 2EPKX 3IWCA 1SFEA 1XNQE 1A1HA 2EPNA 3C4BA 2D9HA 1T4NA 1BB8A 1HNXE 4JI0E 1N32E 2B7TA 4K0KE 4KHPE 3MHSC 2EPCA 2EM4A 1WRJA 1N3GA 2EMLA 4I8OA 5KL5A 3RMPA 3JAMC 2NUGA 2WZOA 1YUJA 3AV0A 2RS6A 2GHFA 2A25A 2VQEE 2K4VA 3MHHC 5KL3A 4R2CA 1G2DC 1GTKA 3T1YE 2EOQA 5LLQA 4WX9A 2DSYA 1EH6A 2V87A 2CT1A 3ADGA 1YYKA 2B9DA 4RH8A 2YRMA 1YYOA 5TSEA 4JV5E 2EE8A 2H36X 2JR1A 2EQ1A 4M2ZA 2YRKA 4WYQB 2DGCA 4B3SE 2EM3A 4DR2E 2NUFA 3HXLA 4ZYHA 3IWBA 1IBKE 2FGGA 2L33A 4BMJA 5A6BA 2WBUA 4JYAE 3T1HE 2EL6A 2EMYA 4TUGA 1WHQA 1YSAC 4IS1C 2EMIA 2E72A 2L92A 2YT4A 4GEQB 3ADLA 4P78A 1MEYC 5A6KA 4DV3E 2UXDE 2YTNA 1X6EA 4LF5E 1STUA 2EPMX 2NABA 1TF6A 1A1IA 2N3HA 1HNZE 2JOBA 4R8OA 2EWLA 1QNTA 4WXDA 4DR6E 2EORA 3C6MA 3ADJA 4X65E 2DRPA 2DIXA 2EN7A 4N4RB 1GZ6A 2EMBA 4Q28A 2GLIA 2E5LE 1BBOA 2RPCA 4NZVA 4JI5E 1IQSA 4P7DA 4ZYGA 1KJKA 2N8XA 2YTJA 3THOB 1MGTA 2YTQA 2NUEA 4BBYA 3J7Yp 1UILA 2LUPB 3J7AG 4R2RA 2MDRA 2B3TB 2EL4A 2M7QA 3JU0A 4KZSA 2EOMA 1ZAAC 2RTXA 2IHR1 4FK5C 1YUIA 4LF4E 2M4IA 4WSGA 3LMLA 1PKPA 2HJJA 1YZ9A 4O24A 2CPNA 2ADRA 2L6MA 4F2JC 2YSOA 1N36E 2YTOA 5KL2A 4B3RE 2EM2A 5BR8E 4DV5E 1UBDC 2MDGA 3DJWA 4BC9A 2EM8A 2LRSA 2B7VA 2V83A 2RSMA 5LMNE 4DUZE 3P1XA 4X8WA 1YYWA 2ENAA 4X64E 4MLQA 1J26A 2LBSB 1L4SA 5IWAE 5AASA 2BB8A 5A6BD 2GPIA 4JI7E 1JK1A 2J7JA 2LVHA 2EM0A 2EPOA 4NXME 4NHRA 4NXNE 2EPAA 2JVAA 4LTYA 1N33E 2L8TA 4R2AA 2R76A 2RS7A 2LCEA 2ZM6E 1HNWE 4DR7E 1IMUA 1N34E 5LMUE 1A1JA 1HR0E 2EPUA 4LFBE 2KONA 2ODRD 2K7IA 4O43A 4B3ME 3BGHA 2V8QB 1XMQE 1FKAE 5F3WA 2M9AA 2ELYA 3VK6A 2YTGA 1X6HA 5A6JA 3F6HA 4B3TE 2L2MA 3EPHA 3F6GA 2G7HA 5LL6R 2FTXB 2MKNA 2EOOA 2DLKA 4M0VA 5T6JA 4O5GA 2LT7A 1XMOE 2EOZA 2ENHA 2DMYA 4X66E 2EOEA 4F6MA 4R2QA 1I94E 2L2NA 2V85A 1WXRA 2HC5A 3TQMA 5KL4A 1BBGA 4F9AB 1PJTA 4ZYDA 2EMZA 1X49A 3HPZA 2EN2A 1IBME 2EOSA 4R2SA 4LF9E 2Q8UA 1DQ3A 1WJPA 2EPZA 1RMDA 4DV7E 2V89A 2RSIA 3LLHA 2LMZA 2LUQA 1T4LB 2EOXA 2VE7C 2RQLA 3KZYA 3C4TA 2LJUA 4BHCA 1X48A
chains in the Genus database with same CATH topology
2LO3A 4R2DA 2EM2A 1YUJA 2EQ3A 2GHFA 2A25A 3MHHC 2MDGA 1UBDC 5KL3A 4R2CA 1G2DC 1DGCA 2EM6A 2HGHA 2EM8A 2WBTA 4IJDA 2EOQA 2EMKA 2YTDA 1ZR9A 2EPRA 2ENAA 2CT1A 2CSHA 2DMIA 2I13A 2EM9A 4R2EA 2BB8A 2EOYA 2YTIA 2YRMA 2YSPA 1UN6B 1Z1BA 2EMAA 4GZNC 2EE8A 4F6NA 2EN1A 2EQ1A 1A1GA 2EMXA 1JK1A 2J7JA 2LVHA 2EM0A 2YRKA 2DGCA 2EM3A 2EPAA 2YRHA 4R2PA 4R2AA 2EM5A 4M9VC 2WBUA 2YTFA 2YU8A 2EL6A 3EPJA 2EMYA 2DLQA 2JP9A 1YSAC 2LCEA 4IS1C 2EMIA 2EMCA 2E72A 2EPPA 2CTDA 2YTEA 4X9JA 1X3CA 2ELZA 1MEYC 1TN9A 2YTNA 1A1JA 1ZU1A 1X6EA 2EP3A 2EPUA 1JK2A 1TF6A 2NABA 3EPLA 2WCC3 1NCSA 1BBOA 1A1IA 1X5WA 2EPXA 1A1LA 1A1KA 2M9AA 2ELYA 2EL5A 2EN6A 2YTGA 1X6HA 3EPHA 2EORA 2DRPA 2MKNA 2EN7A 2EQ0A 3EPKA 2EOOA 2YTPA 2DLKA 2EMBA 5KL6A 2EOIA 2LT7A 1P47A 1TF3A 2EN8A 2ENHA 2EOZA 2LV2A 2ENCA 2WBSA 1LLMC 2EMWA 2EOHA 2R1FA 2RPCA 2EOEA 5KL7A 1A1FA 2EMFA 4F6MA 4R2QA 2PRTA 1KJKA 2YU5A 2YTJA 5KL4A 2EJ4A 2JPAA 2YTQA 2EN3A 2EMZA 1X6FA 2VRDA 2EN2A 2EOSA 3M99B 1F2IG 4R2SA 2EM7A 4R2RA 2EL4A 2EOFA 1WJPA 2EPZA 3VHTB 2GLIA 1RMDA 1B69A 2MKDA 5KL2A 1AAYA 2EOMA 1ZAAC 2RSIA 2EMGA 3UK3C 4FK5C 1YUIA 2EOXA 2EMHA 1A1HA 2D9HA 1BB8A 4WSGA 2EOJA 1G2FC 2EN4A 3MHSC 2ADRA 4F2JC 2EPCA 2EM4A 2YSOA 2EMLA 5KL5A 2YTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LO3 A;  4R2D A;  2EM2 A;  1YUJ A;  2EQ3 A;  2GHF A;  2A25 A;  3MHH C;  2MDG A;  1UBD C;  5KL3 A;  4R2C A;  1G2D C;  1DGC A;  2EM6 A;  2HGH A;  2EM8 A;  2WBT A;  4IJD A;  2EOQ A;  2EMK A;  2YTD A;  1ZR9 A;  2EPR A;  2ENA A;  2CT1 A;  2CSH A;  2DMI A;  2I13 A;  2EM9 A;  4R2E A;  2BB8 A;  2EOY A;  2YTI A;  2YRM A;  2YSP A;  1UN6 B;  1Z1B A;  2EMA A;  4GZN C;  2EE8 A;  4F6N A;  2EN1 A;  2EQ1 A;  1A1G A;  2EMX A;  1JK1 A;  2J7J A;  2LVH A;  2EM0 A;  2YRK A;  2DGC A;  2EM3 A;  2EPA A;  2YRH A;  4R2P A;  4R2A A;  2EM5 A;  4M9V C;  2WBU A;  2YTF A;  2YU8 A;  2EL6 A;  3EPJ A;  2EMY A;  2DLQ A;  2JP9 A;  1YSA C;  2LCE A;  4IS1 C;  2EMI A;  2EMC A;  2E72 A;  2EPP A;  2CTD A;  2YTE A;  4X9J A;  1X3C A;  2ELZ A;  1MEY C;  1TN9 A;  2YTN A;  1A1J A;  1ZU1 A;  1X6E A;  2EP3 A;  2EPU A;  1JK2 A;  1TF6 A;  2NAB A;  3EPL A;  2WCC 3;  1NCS A;  1BBO A;  1A1I A;  1X5W A;  2EPX A;  1A1L A;  1A1K A;  2M9A A;  2ELY A;  2EL5 A;  2EN6 A;  2YTG A;  1X6H A;  3EPH A;  2EOR A;  2DRP A;  2MKN A;  2EN7 A;  2EQ0 A;  3EPK A;  2EOO A;  2YTP A;  2DLK A;  2EMB A;  5KL6 A;  2EOI A;  2LT7 A;  1P47 A;  1TF3 A;  2EN8 A;  2ENH A;  2EOZ A;  2LV2 A;  2ENC A;  2WBS A;  1LLM C;  2EMW A;  2EOH A;  2R1F A;  2RPC A;  2EOE A;  5KL7 A;  1A1F A;  2EMF A;  4F6M A;  4R2Q A;  2PRT A;  1KJK A;  2YU5 A;  2YTJ A;  5KL4 A;  2EJ4 A;  2JPA A;  2YTQ A;  2EN3 A;  2EMZ A;  1X6F A;  2VRD A;  2EN2 A;  2EOS A;  3M99 B;  1F2I G;  4R2S A;  2EM7 A;  4R2R A;  2EL4 A;  2EOF A;  1WJP A;  2EPZ A;  3VHT B;  2GLI A;  1RMD A;  1B69 A;  2MKD A;  5KL2 A;  1AAY A;  2EOM A;  1ZAA C;  2RSI A;  2EMG A;  3UK3 C;  4FK5 C;  1YUI A;  2EOX A;  2EMH A;  1A1H A;  2D9H A;  1BB8 A;  4WSG A;  2EOJ A;  1G2F C;  2EN4 A;  3MHS C;  2ADR A;  4F2J C;  2EPC A;  2EM4 A;  2YSO A;  2EML A;  5KL5 A;  2YTO A; 
#chains in the Genus database with same CATH topology
 4JI2 E;  4WPY A;  2HHH E;  2EQ3 A;  3BBG A;  2UUC E;  4L5N C;  4OOG C;  1PDA A;  4F54 A;  5AE2 A;  1DGC A;  2FV4 B;  1RC7 A;  4BS9 A;  2EMK A;  4LF6 E;  3L00 A;  2EPR A;  2MC6 A;  5DNY A;  2CSH A;  1ZBQ A;  2DMI A;  4R2E A;  2YTI A;  4DR4 E;  3EQ1 A;  3JTZ A;  5CFF E;  1UN6 B;  2EMA A;  1A1G A;  3K6Q A;  1X47 A;  2EMX A;  5ADZ A;  4TUI A;  4R03 A;  1O0W A;  4X62 E;  2JYA A;  2YRH A;  2UXC E;  4L8N A;  4R2P A;  2EM5 A;  1ZBT A;  2YU8 A;  2I9I A;  3EPJ A;  4DV4 E;  2DLQ A;  2JP9 A;  5FLX C;  2VF1 A;  2EPP A;  1IQO A;  4X9J A;  2DB2 A;  3HPS A;  2F4V E;  5A6A A;  1RQ0 A;  2YPN A;  3C6K A;  3ZOQ B;  1ZU1 A;  2E1M A;  1JK2 A;  2BBG A;  4YHH E;  1NCS A;  2WCC 3;  4AQY E;  1A1L A;  4JI3 E;  3IWD A;  2YWQ A;  3ADI A;  1PJQ A;  3MSW A;  5IXM B;  5AC4 A;  2L2K B;  1IBL E;  3VYY A;  3QG5 C;  2YTP A;  1TF3 A;  2EOI A;  1P47 A;  1T4O A;  1LLM C;  2R1F A;  3H09 A;  2JXP A;  5A69 A;  2V88 A;  4F9B B;  1FJG E;  2EJ4 A;  2KOU A;  2EN3 A;  1SR9 A;  1X6F A;  2VRD A;  4DV2 E;  2F8B A;  4DR1 E;  4JI1 E;  4JI6 E;  4LF7 E;  3M99 B;  1F2I G;  2EM7 A;  2JOX A;  2EOF A;  2MC5 A;  4LFA E;  1EH7 A;  1QU6 A;  4DV1 E;  3OML A;  2LJH A;  4J8Z A;  3UK3 C;  4BCA A;  4GKJ E;  2EMH A;  1PJS A;  4F9C B;  5AE1 A;  4ZYE A;  2EOJ A;  1G2F C;  2UUB E;  2EN4 A;  4WXC A;  2L3C A;  3J80 C;  5AE3 A;  1XNR E;  2LO3 A;  4R2D A;  3ECR A;  5AC5 A;  3VYX A;  3KWR A;  3HTX A;  3DF6 A;  2EM6 A;  2HGH A;  2UU9 E;  4DMI A;  2WBT A;  3OTO E;  4IJD A;  2V86 A;  4MLV A;  4BC7 A;  2YTD A;  4LF8 E;  1ZR9 A;  2LTR A;  1DI2 A;  4Q35 B;  2I13 A;  2EM9 A;  2EOY A;  2KHX A;  1GQE A;  2YSP A;  4DUY E;  1Z1B A;  4GZN C;  4F6N A;  2EN1 A;  2VQF E;  4DR5 E;  4YY3 E;  1EKZ A;  2UUA E;  4LFC E;  2M1S A;  1T39 A;  4M9V C;  2YTF A;  4BHB A;  4DR3 E;  1T38 A;  4DV6 E;  3BF2 A;  1YPN A;  2EMC A;  2CTD A;  2YTE A;  4JI8 E;  1X3C A;  2ELZ A;  2NA2 A;  2JY9 A;  2ODR C;  3HQ1 A;  4RHB B;  4WFT A;  4JI4 E;  1TN9 A;  1NEI A;  2EP3 A;  2LTS A;  4OX9 E;  3EPL A;  3BID A;  1X5W A;  3FIG A;  3THN A;  2EPX A;  4HEI A;  4LU9 A;  2EZ6 A;  1A1K A;  2EL5 A;  2EN6 A;  4O4K A;  2EQ0 A;  3EPK A;  4GKK E;  3AUZ A;  5KL6 A;  2EN8 A;  2LV2 A;  4HTG A;  2WBS A;  2ENC A;  3J81 C;  1A1F A;  2EMW A;  2EOH A;  1EH8 A;  5KL7 A;  2EMF A;  4M30 A;  1UHZ A;  2PRT A;  4DV0 E;  2JWO A;  2YU5 A;  1YFH A;  4WSP A;  4DKK A;  2YZT A;  2JPA A;  1J5E E;  1KYQ A;  1WHN A;  2UXB E;  2L3J A;  5IV8 B;  3KZZ A;  1AH5 A;  3VHT B;  5IT9 C;  2N3G A;  1B69 A;  2MKD A;  1AAY A;  5A2Q C;  2LE2 A;  2EMG A;  2EPL X;  4KWY A;  2EPK X;  3IWC A;  1SFE A;  1XNQ E;  1A1H A;  2EPN A;  3C4B A;  2D9H A;  1T4N A;  1BB8 A;  1HNX E;  4JI0 E;  1N32 E;  2B7T A;  4K0K E;  4KHP E;  3MHS C;  2EPC A;  2EM4 A;  1WRJ A;  1N3G A;  2EML A;  4I8O A;  5KL5 A;  3RMP A;  3JAM C;  2NUG A;  2WZO A;  1YUJ A;  3AV0 A;  2RS6 A;  2GHF A;  2A25 A;  2VQE E;  2K4V A;  3MHH C;  5KL3 A;  4R2C A;  1G2D C;  1GTK A;  3T1Y E;  2EOQ A;  5LLQ A;  4WX9 A;  2DSY A;  1EH6 A;  2V87 A;  2CT1 A;  3ADG A;  1YYK A;  2B9D A;  4RH8 A;  2YRM A;  1YYO A;  5TSE A;  4JV5 E;  2EE8 A;  2H36 X;  2JR1 A;  2EQ1 A;  4M2Z A;  2YRK A;  4WYQ B;  2DGC A;  4B3S E;  2EM3 A;  4DR2 E;  2NUF A;  3HXL A;  4ZYH A;  3IWB A;  1IBK E;  2FGG A;  2L33 A;  4BMJ A;  5A6B A;  2WBU A;  4JYA E;  3T1H E;  2EL6 A;  2EMY A;  4TUG A;  1WHQ A;  1YSA C;  4IS1 C;  2EMI A;  2E72 A;  2L92 A;  2YT4 A;  4GEQ B;  3ADL A;  4P78 A;  1MEY C;  5A6K A;  4DV3 E;  2UXD E;  2YTN A;  1X6E A;  4LF5 E;  1STU A;  2EPM X;  2NAB A;  1TF6 A;  1A1I A;  2N3H A;  1HNZ E;  2JOB A;  4R8O A;  2EWL A;  1QNT A;  4WXD A;  4DR6 E;  2EOR A;  3C6M A;  3ADJ A;  4X65 E;  2DRP A;  2DIX A;  2EN7 A;  4N4R B;  1GZ6 A;  2EMB A;  4Q28 A;  2GLI A;  2E5L E;  1BBO A;  2RPC A;  4NZV A;  4JI5 E;  1IQS A;  4P7D A;  4ZYG A;  1KJK A;  2N8X A;  2YTJ A;  3THO B;  1MGT A;  2YTQ A;  2NUE A;  4BBY A;  3J7Y p;  1UIL A;  2LUP B;  3J7A G;  4R2R A;  2MDR A;  2B3T B;  2EL4 A;  2M7Q A;  3JU0 A;  4KZS A;  2EOM A;  1ZAA C;  2RTX A;  2IHR 1;  4FK5 C;  1YUI A;  4LF4 E;  2M4I A;  4WSG A;  3LML A;  1PKP A;  2HJJ A;  1YZ9 A;  4O24 A;  2CPN A;  2ADR A;  2L6M A;  4F2J C;  2YSO A;  1N36 E;  2YTO A;  5KL2 A;  4B3R E;  2EM2 A;  5BR8 E;  4DV5 E;  1UBD C;  2MDG A;  3DJW A;  4BC9 A;  2EM8 A;  2LRS A;  2B7V A;  2V83 A;  2RSM A;  5LMN E;  4DUZ E;  3P1X A;  4X8W A;  1YYW A;  2ENA A;  4X64 E;  4MLQ A;  1J26 A;  2LBS B;  1L4S A;  5IWA E;  5AAS A;  2BB8 A;  5A6B D;  2GPI A;  4JI7 E;  1JK1 A;  2J7J A;  2LVH A;  2EM0 A;  2EPO A;  4NXM E;  4NHR A;  4NXN E;  2EPA A;  2JVA A;  4LTY A;  1N33 E;  2L8T A;  4R2A A;  2R76 A;  2RS7 A;  2LCE A;  2ZM6 E;  1HNW E;  4DR7 E;  1IMU A;  1N34 E;  5LMU E;  1A1J A;  1HR0 E;  2EPU A;  4LFB E;  2KON A;  2ODR D;  2K7I A;  4O43 A;  4B3M E;  3BGH A;  2V8Q B;  1XMQ E;  1FKA E;  5F3W A;  2M9A A;  2ELY A;  3VK6 A;  2YTG A;  1X6H A;  5A6J A;  3F6H A;  4B3T E;  2L2M A;  3EPH A;  3F6G A;  2G7H A;  5LL6 R;  2FTX B;  2MKN A;  2EOO A;  2DLK A;  4M0V A;  5T6J A;  4O5G A;  2LT7 A;  1XMO E;  2EOZ A;  2ENH A;  2DMY A;  4X66 E;  2EOE A;  4F6M A;  4R2Q A;  1I94 E;  2L2N A;  2V85 A;  1WXR A;  2HC5 A;  3TQM A;  5KL4 A;  1BBG A;  4F9A B;  1PJT A;  4ZYD A;  2EMZ A;  1X49 A;  3HPZ A;  2EN2 A;  1IBM E;  2EOS A;  4R2S A;  4LF9 E;  2Q8U A;  1DQ3 A;  1WJP A;  2EPZ A;  1RMD A;  4DV7 E;  2V89 A;  2RSI A;  3LLH A;  2LMZ A;  2LUQ A;  1T4L B;  2EOX A;  2VE7 C;  2RQL A;  3KZY A;  3C4T A;  2LJU A;  4BHC A;  1X48 A; 
#chains in the Genus database with same CATH homology
 2LO3 A;  4R2D A;  2EM2 A;  1YUJ A;  2EQ3 A;  2GHF A;  2A25 A;  3MHH C;  2MDG A;  1UBD C;  5KL3 A;  4R2C A;  1G2D C;  1DGC A;  2EM6 A;  2HGH A;  2EM8 A;  2WBT A;  4IJD A;  2EOQ A;  2EMK A;  2YTD A;  1ZR9 A;  2EPR A;  2ENA A;  2CT1 A;  2CSH A;  2DMI A;  2I13 A;  2EM9 A;  4R2E A;  2BB8 A;  2EOY A;  2YTI A;  2YRM A;  2YSP A;  1UN6 B;  1Z1B A;  2EMA A;  4GZN C;  2EE8 A;  4F6N A;  2EN1 A;  2EQ1 A;  1A1G A;  2EMX A;  1JK1 A;  2J7J A;  2LVH A;  2EM0 A;  2YRK A;  2DGC A;  2EM3 A;  2EPA A;  2YRH A;  4R2P A;  4R2A A;  2EM5 A;  4M9V C;  2WBU A;  2YTF A;  2YU8 A;  2EL6 A;  3EPJ A;  2EMY A;  2DLQ A;  2JP9 A;  1YSA C;  2LCE A;  4IS1 C;  2EMI A;  2EMC A;  2E72 A;  2EPP A;  2CTD A;  2YTE A;  4X9J A;  1X3C A;  2ELZ A;  1MEY C;  1TN9 A;  2YTN A;  1A1J A;  1ZU1 A;  1X6E A;  2EP3 A;  2EPU A;  1JK2 A;  1TF6 A;  2NAB A;  3EPL A;  2WCC 3;  1NCS A;  1BBO A;  1A1I A;  1X5W A;  2EPX A;  1A1L A;  1A1K A;  2M9A A;  2ELY A;  2EL5 A;  2EN6 A;  2YTG A;  1X6H A;  3EPH A;  2EOR A;  2DRP A;  2MKN A;  2EN7 A;  2EQ0 A;  3EPK A;  2EOO A;  2YTP A;  2DLK A;  2EMB A;  5KL6 A;  2EOI A;  2LT7 A;  1P47 A;  1TF3 A;  2EN8 A;  2ENH A;  2EOZ A;  2LV2 A;  2ENC A;  2WBS A;  1LLM C;  2EMW A;  2EOH A;  2R1F A;  2RPC A;  2EOE A;  5KL7 A;  1A1F A;  2EMF A;  4F6M A;  4R2Q A;  2PRT A;  1KJK A;  2YU5 A;  2YTJ A;  5KL4 A;  2EJ4 A;  2JPA A;  2YTQ A;  2EN3 A;  2EMZ A;  1X6F A;  2VRD A;  2EN2 A;  2EOS A;  3M99 B;  1F2I G;  4R2S A;  2EM7 A;  4R2R A;  2EL4 A;  2EOF A;  1WJP A;  2EPZ A;  3VHT B;  2GLI A;  1RMD A;  1B69 A;  2MKD A;  5KL2 A;  1AAY A;  2EOM A;  1ZAA C;  2RSI A;  2EMG A;  3UK3 C;  4FK5 C;  1YUI A;  2EOX A;  2EMH A;  1A1H A;  2D9H A;  1BB8 A;  4WSG A;  2EOJ A;  1G2F C;  2EN4 A;  3MHS C;  2ADR A;  4F2J C;  2EPC A;  2EM4 A;  2YSO A;  2EML A;  5KL5 A;  2YTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...