4F6NA

Crystal structure of kaiso zinc finger dna binding protein in complex with methylated cpg site dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Transcriptional regulator Kaiso
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA02
2YTEA 2EN2A 1UN6B 1KJKA 2EM4A 4R2QA 2EMHA 3VHTB 2EM9A 2EJ4A 2LT7A 1BBOA 1A1HA 2ADRA 2EP3A 4IS1C 3EPHA 2ENHA 2JP9A 2EM2A 5KL7A 2ELYA 1YSAC 4R2EA 2LO3A 2EMWA 1DGCA 4F2JC 2EM7A 2EMKA 2EOMA 2EOEA 4F6NA 2NABA 2EOFA 2EN3A 2EN8A 2EL4A 1WJPA 2EPAA 2EM5A 2YTNA 5KL2A 2YTFA 1B69A 5KL3A 1P47A 2EQ1A 5KL6A 2WBSA 2JPAA 2EL5A 2EMCA 2DLKA 2EMAA 2GHFA 2YU8A 2EOYA 2YTOA 4WSGA 3EPLA 1MEYC 2EOOA 2EM8A 4GZNC 2ENCA 1X6EA 2EOJA 2YTQA 1UBDC 2J7JA 2EMGA 2EOIA 2M9AA 3EPJA 2EMYA 2BB8A 1X5WA 1A1LA 4F6MA 2CTDA 2MKDA 2LVHA 1X6FA 2YRKA 4R2CA 2CT1A 1A1JA 2DGCA 1ZU1A 2RSIA 2EL6A 4R2RA 2EE8A 2EPUA 2YU5A 2MKNA 2LV2A 3UK3C 2E72A 1TN9A 2YTGA 2EPRA 2EM0A 2I13A 2EORA 1G2DC 4X9JA 2EMXA 1RMDA 2EM6A 2EQ3A 2YTDA 1LLMC 2GLIA 1BB8A 3MHHC 2EOHA 2ENAA 2WBUA 2YRMA 4R2PA 2A25A 2YTIA 2EMFA 2EOSA 2EOQA 1TF3A 2WCC3 2LCEA 1X3CA 1X6HA 2YTPA 2YRHA 2EPXA 1F2IG 2EMZA 1ZAAC 2DLQA 3MHSC 2EN4A 1JK1A 2RPCA 1ZR9A 2EPZA 2EMBA 2EQ0A 2MDGA 4IJDA 2D9HA 2DMIA 2EMLA 5KL5A 2DRPA 3M99B 2VRDA 1G2FC 2WBTA 2YSPA 1YUIA 2R1FA 4FK5C 1A1KA 4M9VC 2YSOA 5KL4A 2EPCA 2EN1A 2EOZA 4R2AA 1NCSA 1A1IA 1YUJA 1A1GA 2EMIA 2EOXA 1AAYA 3EPKA 2CSHA 2ELZA 4R2SA 4R2DA 2YTJA 1JK2A 2PRTA 2EPPA 2EM3A 2EN7A 1Z1BA 2HGHA 2EN6A 1TF6A 1A1FA
chains in the Genus database with same CATH superfamily
1GTKA 2JWOA 4GKKE 1X49A 3AUZA 2EMHA 3VK6A 1BBOA 2EP3A 4MLVA 5KL7A 2LTRA 2LO3A 1DGCA 4F2JC 2EM7A 2EMKA 2G7HA 2EOEA 4F6NA 2NABA 2EOFA 4NHRA 5CFFE 3IWBA 5AASA 4B3ME 2YTNA 5KL2A 4F9BB 4LU9A 4R03A 1B69A 2B7VA 5KL3A 1P47A 2L2MA 2LTSA 4Q28A 2DSYA 2FGGA 4LF9E 3HTXA 2JYAA 4RH8A 1PDAA 4DUZE 2EL5A 2GHFA 1N32E 2EOYA 2EOOA 2UXCE 4WSPA 4AQYE 1UHZA 4F9CB 4LF7E 3HXLA 2UXDE 2EMYA 1GQEA 2BB8A 4F6MA 2CTDA 2YRKA 1X6FA 2EPKX 2CT1A 4O4KA 2DGCA 1ZU1A 3J7Yp 4JI7E 3KWRA 2L2KB 2EPUA 2MKNA 3ADJA 4OOGC 2EPRA 4JV5E 2I13A 1DI2A 2L2NA 2L3CA 1RMDA 2GLIA 2F4VE 4LFBE 1BB8A 2VF1A 2JOBA 4TUIA 4LFCE 2UUCE 2M1SA 1J26A 1TF3A 2WCC3 4BCAA 2JXPA 1X6HA 2YTPA 2HJJA 2YRHA 4B3SE 1YYWA 4BC9A 1FKAE 2DLQA 3K6QA 3ZOQB 1JK1A 2MDGA 2EMBA 2EMLA 1PKPA 3M99B 4BHCA 2VRDA 3DF6A 2V89A 4L8NA 1YUIA 4DKKA 2HHHE 2RSMA 2DMYA 3EQ1A 1A1KA 2YSOA 2EN1A 2KONA 2M4IA 4BMJA 4R2AA 1NCSA 5FLXC 2V87A 2B3TB 2EMIA 3EPKA 2RQLA 1JK2A 2EPPA 3KZYA 1YZ9A 1Z1BA 3HPSA 2GPIA 2EN6A 4B3TE 3F6HA 1A1FA 4J8ZA 1YYKA 1UN6B 1KJKA 4WXCA 4JI2E 4R2QA 2EJ4A 2LT7A 1A1HA 4HTGA 2JY9A 2I9IA 4BC7A 4IS1C 3EPHA 2YPNA 3JAMC 2ELYA 4R2EA 1XNRE 4X64E 1IBME 2L6MA 2L33A 3JTZA 5A6JA 2EN3A 3ADLA 2EL4A 3C4BA 4P78A 1WJPA 2K7IA 2CPNA 3AV0A 2YTFA 4TUGA 2EQ1A 5DNYA 3JU0A 4BS9A 2RTXA 2NUEA 2EMCA 2DLKA 2K4VA 4ZYDA 3EPLA 1T4NA 1RQ0A 2EM8A 2ENCA 1UILA 3HQ1A 2EMGA 4LF8E 1WXRA 4WFTA 1A1LA 2LE2A 2EPNA 2MKDA 2YZTA 5LMUE 2MDRA 5BR8E 3DJWA 5IV8B 2EWLA 1EKZA 4NXME 4YHHE 3IWDA 1YFHA 2LV2A 3UK3C 4JI5E 1IBLE 1STUA 2EORA 1G2DC 4DV5E 2F8BA 4O43A 1XMOE 2LRSA 4LF5E 2EM6A 3MHHC 2WBUA 2NUGA 2DIXA 2A25A 1PJSA 4L5NC 2EMFA 2EOQA 4M2ZA 2LCEA 5AE1A 2FTXB 3T1YE 4M0VA 3J81C 1ZBTA 4X62E 2V83A 3T1HE 2JOXA 1F2IG 2EMZA 3VYYA 1T4LB 4O5GA 2RPCA 1ZR9A 2EPZA 4IJDA 4JYAE 1N3GA 4I8OA 4WPYA 4DR7E 2VQFE 1G2FC 1YPNA 2UU9E 2UUAE 2R1FA 1IMUA 2R76A 4O24A 2EOZA 5A6BA 1XMQE 1A1IA 3TQMA 3OMLA 1YUJA 4R8OA 4DR3E 2ELZA 1N34E 4R2DA 2Q8UA 3C6KA 5A6AA 4WYQB 5AE2A 2HGHA 4OX9E 4WXDA 4DV4E 1PJQA 3FIGA 1QNTA 2EN2A 4F9AB 2EM4A 3H09A 1WRJA 4NZVA 2MC6A 4JI1E 1O0WA 5AE3A 2EM9A 4JI6E 1N33E 2ENHA 2JP9A 1YSAC 3BIDA 1RC7A 2EMWA 3OTOE 2EOMA 4JI8E 2KHXA 4ZYEA 5ADZA 2M7QA 4DR4E 5A6BD 2EN8A 3F6GA 2EPAA 2LMZA 2EM5A 5LLQA 2LJUA 2N3HA 2VE7C 2E1MA 2L3JA 5KL6A 3HPZA 2WBSA 2JPAA 1PJTA 5A2QC 4X66E 1MEYC 2EPMX 1FJGE 4DUYE 4GZNC 2KOUA 1BBGA 4Q35B 2EOJA 2EPOA 4X8WA 2J7JA 2EOIA 4ZYHA 1X5WA 1IQOA 5IXMB 2V86A 2RSIA 2EPLX 4R2RA 1IBKE 4DR2E 4M30A 3LLHA 4DR5E 2ODRD 2E72A 1TN9A 5A69A 4X9JA 4KZSA 2EQ3A 5LMNE 3ADGA 5T6JA 2ENAA 4R2PA 4KHPE 2NA2A 2EOSA 1N36E 4JI4E 1HNWE 4JI3E 1NEIA 4RHBB 2EPXA 2WZOA 1GZ6A 5IWAE 5IT9C 2LBSB 1EH7A 4DR1E 3THOB 1T38A 2E5LE 5KL5A 1SFEA 2BBGA 2DRPA 1HR0E 2H36X 2YSPA 1EH8A 3ECRA 3QG5C 4HEIA 2UXBE 1MGTA 4FK5C 5F3WA 4M9VC 5KL4A 4BHBA 1A1GA 1X48A 4DMIA 4R2SA 4DV7E 2PRTA 2RS6A 1QU6A 2N3GA 2JVAA 1T39A 1WHNA 4LF6E 1IQSA 4DV3E 1J5EE 4GKJE 1DQ3A 1TF6A 2YTEA 1WHQA 2JR1A 4WX9A 3VYXA 1YYOA 1HNXE 3VHTB 2ADRA 2L8TA 4DR6E 2B9DA 2EM2A 5A6KA 1X47A 2V85A 4DV6E 1EH6A 3J80C 3P1XA 2FV4B 2LJHA 2RS7A 4F54A 2V8QB 3IWCA 2ODRC 4DV1E 2EMAA 2YU8A 2YTOA 4WSGA 4LFAE 3J7AG 2ZM6E 1X6EA 2YTQA 1UBDC 4DV0E 2M9AA 3EPJA 4P7DA 3BGHA 1I94E 2LVHA 4R2CA 1A1JA 5AC4A 3L00A 2EL6A 1KYQA 2EE8A 2YU5A 4LF4E 1AH5A 2YTGA 2EM0A 2MC5A 1ZBQA 4ZYGA 2DB2A 2EMXA 5AC5A 1T4OA 2YTDA 1LLMC 4NXNE 1L4SA 2EOHA 3LMLA 2YRMA 2LUQA 2YTIA 4BBYA 2EZ6A 3BBGA 4MLQA 1X3CA 2YWQA 1SR9A 1ZAAC 3MSWA 4JI0E 3MHSC 2EN4A 1HNZE 4KWYA 2NUFA 2EQ0A 2N8XA 1XNQE 2D9HA 2DMIA 3C4TA 3KZZA 2V88A 4DV2E 2UUBE 2WBTA 4GEQB 4K0KE 3C6MA 4X65E 2EPCA 2VQEE 2EOXA 1AAYA 2HC5A 2B7TA 2CSHA 2YTJA 2LUPB 4N4RB 2EM3A 5LL6R 3RMPA 5TSEA 2EN7A 2IHR1 3ADIA 2L92A 4B3RE 4YY3E 2YT4A 3BF2A 4LTYA 3THNA
chains in the Genus database with same CATH topology
2YTEA 2EN2A 1UN6B 1KJKA 2EM4A 4R2QA 2EMHA 3VHTB 2EM9A 2EJ4A 2LT7A 1BBOA 1A1HA 2ADRA 2EP3A 4IS1C 3EPHA 2ENHA 2JP9A 2EM2A 5KL7A 2ELYA 1YSAC 4R2EA 2LO3A 2EMWA 1DGCA 4F2JC 2EM7A 2EMKA 2EOMA 2EOEA 4F6NA 2NABA 2EOFA 2EN3A 2EN8A 2EL4A 1WJPA 2EPAA 2EM5A 2YTNA 5KL2A 2YTFA 1B69A 5KL3A 1P47A 2EQ1A 5KL6A 2WBSA 2JPAA 2EL5A 2EMCA 2DLKA 2EMAA 2GHFA 2YU8A 2EOYA 2YTOA 4WSGA 3EPLA 1MEYC 2EOOA 2EM8A 4GZNC 2ENCA 1X6EA 2EOJA 2YTQA 1UBDC 2J7JA 2EMGA 2EOIA 2M9AA 3EPJA 2EMYA 2BB8A 1X5WA 1A1LA 4F6MA 2CTDA 2MKDA 2LVHA 1X6FA 2YRKA 4R2CA 2CT1A 1A1JA 2DGCA 1ZU1A 2RSIA 2EL6A 4R2RA 2EE8A 2EPUA 2YU5A 2MKNA 2LV2A 3UK3C 2E72A 1TN9A 2YTGA 2EPRA 2EM0A 2I13A 2EORA 1G2DC 4X9JA 2EMXA 1RMDA 2EM6A 2EQ3A 2YTDA 1LLMC 2GLIA 1BB8A 3MHHC 2EOHA 2ENAA 2WBUA 2YRMA 4R2PA 2A25A 2YTIA 2EMFA 2EOSA 2EOQA 1TF3A 2WCC3 2LCEA 1X3CA 1X6HA 2YTPA 2YRHA 2EPXA 1F2IG 2EMZA 1ZAAC 2DLQA 3MHSC 2EN4A 1JK1A 2RPCA 1ZR9A 2EPZA 2EMBA 2EQ0A 2MDGA 4IJDA 2D9HA 2DMIA 2EMLA 5KL5A 2DRPA 3M99B 2VRDA 1G2FC 2WBTA 2YSPA 1YUIA 2R1FA 4FK5C 1A1KA 4M9VC 2YSOA 5KL4A 2EPCA 2EN1A 2EOZA 4R2AA 1NCSA 1A1IA 1YUJA 1A1GA 2EMIA 2EOXA 1AAYA 3EPKA 2CSHA 2ELZA 4R2SA 4R2DA 2YTJA 1JK2A 2PRTA 2EPPA 2EM3A 2EN7A 1Z1BA 2HGHA 2EN6A 1TF6A 1A1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTE A;  2EN2 A;  1UN6 B;  1KJK A;  2EM4 A;  4R2Q A;  2EMH A;  3VHT B;  2EM9 A;  2EJ4 A;  2LT7 A;  1BBO A;  1A1H A;  2ADR A;  2EP3 A;  4IS1 C;  3EPH A;  2ENH A;  2JP9 A;  2EM2 A;  5KL7 A;  2ELY A;  1YSA C;  4R2E A;  2LO3 A;  2EMW A;  1DGC A;  4F2J C;  2EM7 A;  2EMK A;  2EOM A;  2EOE A;  4F6N A;  2NAB A;  2EOF A;  2EN3 A;  2EN8 A;  2EL4 A;  1WJP A;  2EPA A;  2EM5 A;  2YTN A;  5KL2 A;  2YTF A;  1B69 A;  5KL3 A;  1P47 A;  2EQ1 A;  5KL6 A;  2WBS A;  2JPA A;  2EL5 A;  2EMC A;  2DLK A;  2EMA A;  2GHF A;  2YU8 A;  2EOY A;  2YTO A;  4WSG A;  3EPL A;  1MEY C;  2EOO A;  2EM8 A;  4GZN C;  2ENC A;  1X6E A;  2EOJ A;  2YTQ A;  1UBD C;  2J7J A;  2EMG A;  2EOI A;  2M9A A;  3EPJ A;  2EMY A;  2BB8 A;  1X5W A;  1A1L A;  4F6M A;  2CTD A;  2MKD A;  2LVH A;  1X6F A;  2YRK A;  4R2C A;  2CT1 A;  1A1J A;  2DGC A;  1ZU1 A;  2RSI A;  2EL6 A;  4R2R A;  2EE8 A;  2EPU A;  2YU5 A;  2MKN A;  2LV2 A;  3UK3 C;  2E72 A;  1TN9 A;  2YTG A;  2EPR A;  2EM0 A;  2I13 A;  2EOR A;  1G2D C;  4X9J A;  2EMX A;  1RMD A;  2EM6 A;  2EQ3 A;  2YTD A;  1LLM C;  2GLI A;  1BB8 A;  3MHH C;  2EOH A;  2ENA A;  2WBU A;  2YRM A;  4R2P A;  2A25 A;  2YTI A;  2EMF A;  2EOS A;  2EOQ A;  1TF3 A;  2WCC 3;  2LCE A;  1X3C A;  1X6H A;  2YTP A;  2YRH A;  2EPX A;  1F2I G;  2EMZ A;  1ZAA C;  2DLQ A;  3MHS C;  2EN4 A;  1JK1 A;  2RPC A;  1ZR9 A;  2EPZ A;  2EMB A;  2EQ0 A;  2MDG A;  4IJD A;  2D9H A;  2DMI A;  2EML A;  5KL5 A;  2DRP A;  3M99 B;  2VRD A;  1G2F C;  2WBT A;  2YSP A;  1YUI A;  2R1F A;  4FK5 C;  1A1K A;  4M9V C;  2YSO A;  5KL4 A;  2EPC A;  2EN1 A;  2EOZ A;  4R2A A;  1NCS A;  1A1I A;  1YUJ A;  1A1G A;  2EMI A;  2EOX A;  1AAY A;  3EPK A;  2CSH A;  2ELZ A;  4R2S A;  4R2D A;  2YTJ A;  1JK2 A;  2PRT A;  2EPP A;  2EM3 A;  2EN7 A;  1Z1B A;  2HGH A;  2EN6 A;  1TF6 A;  1A1F A; 
#chains in the Genus database with same CATH topology
 1GTK A;  2JWO A;  4GKK E;  1X49 A;  3AUZ A;  2EMH A;  3VK6 A;  1BBO A;  2EP3 A;  4MLV A;  5KL7 A;  2LTR A;  2LO3 A;  1DGC A;  4F2J C;  2EM7 A;  2EMK A;  2G7H A;  2EOE A;  4F6N A;  2NAB A;  2EOF A;  4NHR A;  5CFF E;  3IWB A;  5AAS A;  4B3M E;  2YTN A;  5KL2 A;  4F9B B;  4LU9 A;  4R03 A;  1B69 A;  2B7V A;  5KL3 A;  1P47 A;  2L2M A;  2LTS A;  4Q28 A;  2DSY A;  2FGG A;  4LF9 E;  3HTX A;  2JYA A;  4RH8 A;  1PDA A;  4DUZ E;  2EL5 A;  2GHF A;  1N32 E;  2EOY A;  2EOO A;  2UXC E;  4WSP A;  4AQY E;  1UHZ A;  4F9C B;  4LF7 E;  3HXL A;  2UXD E;  2EMY A;  1GQE A;  2BB8 A;  4F6M A;  2CTD A;  2YRK A;  1X6F A;  2EPK X;  2CT1 A;  4O4K A;  2DGC A;  1ZU1 A;  3J7Y p;  4JI7 E;  3KWR A;  2L2K B;  2EPU A;  2MKN A;  3ADJ A;  4OOG C;  2EPR A;  4JV5 E;  2I13 A;  1DI2 A;  2L2N A;  2L3C A;  1RMD A;  2GLI A;  2F4V E;  4LFB E;  1BB8 A;  2VF1 A;  2JOB A;  4TUI A;  4LFC E;  2UUC E;  2M1S A;  1J26 A;  1TF3 A;  2WCC 3;  4BCA A;  2JXP A;  1X6H A;  2YTP A;  2HJJ A;  2YRH A;  4B3S E;  1YYW A;  4BC9 A;  1FKA E;  2DLQ A;  3K6Q A;  3ZOQ B;  1JK1 A;  2MDG A;  2EMB A;  2EML A;  1PKP A;  3M99 B;  4BHC A;  2VRD A;  3DF6 A;  2V89 A;  4L8N A;  1YUI A;  4DKK A;  2HHH E;  2RSM A;  2DMY A;  3EQ1 A;  1A1K A;  2YSO A;  2EN1 A;  2KON A;  2M4I A;  4BMJ A;  4R2A A;  1NCS A;  5FLX C;  2V87 A;  2B3T B;  2EMI A;  3EPK A;  2RQL A;  1JK2 A;  2EPP A;  3KZY A;  1YZ9 A;  1Z1B A;  3HPS A;  2GPI A;  2EN6 A;  4B3T E;  3F6H A;  1A1F A;  4J8Z A;  1YYK A;  1UN6 B;  1KJK A;  4WXC A;  4JI2 E;  4R2Q A;  2EJ4 A;  2LT7 A;  1A1H A;  4HTG A;  2JY9 A;  2I9I A;  4BC7 A;  4IS1 C;  3EPH A;  2YPN A;  3JAM C;  2ELY A;  4R2E A;  1XNR E;  4X64 E;  1IBM E;  2L6M A;  2L33 A;  3JTZ A;  5A6J A;  2EN3 A;  3ADL A;  2EL4 A;  3C4B A;  4P78 A;  1WJP A;  2K7I A;  2CPN A;  3AV0 A;  2YTF A;  4TUG A;  2EQ1 A;  5DNY A;  3JU0 A;  4BS9 A;  2RTX A;  2NUE A;  2EMC A;  2DLK A;  2K4V A;  4ZYD A;  3EPL A;  1T4N A;  1RQ0 A;  2EM8 A;  2ENC A;  1UIL A;  3HQ1 A;  2EMG A;  4LF8 E;  1WXR A;  4WFT A;  1A1L A;  2LE2 A;  2EPN A;  2MKD A;  2YZT A;  5LMU E;  2MDR A;  5BR8 E;  3DJW A;  5IV8 B;  2EWL A;  1EKZ A;  4NXM E;  4YHH E;  3IWD A;  1YFH A;  2LV2 A;  3UK3 C;  4JI5 E;  1IBL E;  1STU A;  2EOR A;  1G2D C;  4DV5 E;  2F8B A;  4O43 A;  1XMO E;  2LRS A;  4LF5 E;  2EM6 A;  3MHH C;  2WBU A;  2NUG A;  2DIX A;  2A25 A;  1PJS A;  4L5N C;  2EMF A;  2EOQ A;  4M2Z A;  2LCE A;  5AE1 A;  2FTX B;  3T1Y E;  4M0V A;  3J81 C;  1ZBT A;  4X62 E;  2V83 A;  3T1H E;  2JOX A;  1F2I G;  2EMZ A;  3VYY A;  1T4L B;  4O5G A;  2RPC A;  1ZR9 A;  2EPZ A;  4IJD A;  4JYA E;  1N3G A;  4I8O A;  4WPY A;  4DR7 E;  2VQF E;  1G2F C;  1YPN A;  2UU9 E;  2UUA E;  2R1F A;  1IMU A;  2R76 A;  4O24 A;  2EOZ A;  5A6B A;  1XMQ E;  1A1I A;  3TQM A;  3OML A;  1YUJ A;  4R8O A;  4DR3 E;  2ELZ A;  1N34 E;  4R2D A;  2Q8U A;  3C6K A;  5A6A A;  4WYQ B;  5AE2 A;  2HGH A;  4OX9 E;  4WXD A;  4DV4 E;  1PJQ A;  3FIG A;  1QNT A;  2EN2 A;  4F9A B;  2EM4 A;  3H09 A;  1WRJ A;  4NZV A;  2MC6 A;  4JI1 E;  1O0W A;  5AE3 A;  2EM9 A;  4JI6 E;  1N33 E;  2ENH A;  2JP9 A;  1YSA C;  3BID A;  1RC7 A;  2EMW A;  3OTO E;  2EOM A;  4JI8 E;  2KHX A;  4ZYE A;  5ADZ A;  2M7Q A;  4DR4 E;  5A6B D;  2EN8 A;  3F6G A;  2EPA A;  2LMZ A;  2EM5 A;  5LLQ A;  2LJU A;  2N3H A;  2VE7 C;  2E1M A;  2L3J A;  5KL6 A;  3HPZ A;  2WBS A;  2JPA A;  1PJT A;  5A2Q C;  4X66 E;  1MEY C;  2EPM X;  1FJG E;  4DUY E;  4GZN C;  2KOU A;  1BBG A;  4Q35 B;  2EOJ A;  2EPO A;  4X8W A;  2J7J A;  2EOI A;  4ZYH A;  1X5W A;  1IQO A;  5IXM B;  2V86 A;  2RSI A;  2EPL X;  4R2R A;  1IBK E;  4DR2 E;  4M30 A;  3LLH A;  4DR5 E;  2ODR D;  2E72 A;  1TN9 A;  5A69 A;  4X9J A;  4KZS A;  2EQ3 A;  5LMN E;  3ADG A;  5T6J A;  2ENA A;  4R2P A;  4KHP E;  2NA2 A;  2EOS A;  1N36 E;  4JI4 E;  1HNW E;  4JI3 E;  1NEI A;  4RHB B;  2EPX A;  2WZO A;  1GZ6 A;  5IWA E;  5IT9 C;  2LBS B;  1EH7 A;  4DR1 E;  3THO B;  1T38 A;  2E5L E;  5KL5 A;  1SFE A;  2BBG A;  2DRP A;  1HR0 E;  2H36 X;  2YSP A;  1EH8 A;  3ECR A;  3QG5 C;  4HEI A;  2UXB E;  1MGT A;  4FK5 C;  5F3W A;  4M9V C;  5KL4 A;  4BHB A;  1A1G A;  1X48 A;  4DMI A;  4R2S A;  4DV7 E;  2PRT A;  2RS6 A;  1QU6 A;  2N3G A;  2JVA A;  1T39 A;  1WHN A;  4LF6 E;  1IQS A;  4DV3 E;  1J5E E;  4GKJ E;  1DQ3 A;  1TF6 A;  2YTE A;  1WHQ A;  2JR1 A;  4WX9 A;  3VYX A;  1YYO A;  1HNX E;  3VHT B;  2ADR A;  2L8T A;  4DR6 E;  2B9D A;  2EM2 A;  5A6K A;  1X47 A;  2V85 A;  4DV6 E;  1EH6 A;  3J80 C;  3P1X A;  2FV4 B;  2LJH A;  2RS7 A;  4F54 A;  2V8Q B;  3IWC A;  2ODR C;  4DV1 E;  2EMA A;  2YU8 A;  2YTO A;  4WSG A;  4LFA E;  3J7A G;  2ZM6 E;  1X6E A;  2YTQ A;  1UBD C;  4DV0 E;  2M9A A;  3EPJ A;  4P7D A;  3BGH A;  1I94 E;  2LVH A;  4R2C A;  1A1J A;  5AC4 A;  3L00 A;  2EL6 A;  1KYQ A;  2EE8 A;  2YU5 A;  4LF4 E;  1AH5 A;  2YTG A;  2EM0 A;  2MC5 A;  1ZBQ A;  4ZYG A;  2DB2 A;  2EMX A;  5AC5 A;  1T4O A;  2YTD A;  1LLM C;  4NXN E;  1L4S A;  2EOH A;  3LML A;  2YRM A;  2LUQ A;  2YTI A;  4BBY A;  2EZ6 A;  3BBG A;  4MLQ A;  1X3C A;  2YWQ A;  1SR9 A;  1ZAA C;  3MSW A;  4JI0 E;  3MHS C;  2EN4 A;  1HNZ E;  4KWY A;  2NUF A;  2EQ0 A;  2N8X A;  1XNQ E;  2D9H A;  2DMI A;  3C4T A;  3KZZ A;  2V88 A;  4DV2 E;  2UUB E;  2WBT A;  4GEQ B;  4K0K E;  3C6M A;  4X65 E;  2EPC A;  2VQE E;  2EOX A;  1AAY A;  2HC5 A;  2B7T A;  2CSH A;  2YTJ A;  2LUP B;  4N4R B;  2EM3 A;  5LL6 R;  3RMP A;  5TSE A;  2EN7 A;  2IHR 1;  3ADI A;  2L92 A;  4B3R E;  4YY3 E;  2YT4 A;  3BF2 A;  4LTY A;  3THN A; 
#chains in the Genus database with same CATH homology
 2YTE A;  2EN2 A;  1UN6 B;  1KJK A;  2EM4 A;  4R2Q A;  2EMH A;  3VHT B;  2EM9 A;  2EJ4 A;  2LT7 A;  1BBO A;  1A1H A;  2ADR A;  2EP3 A;  4IS1 C;  3EPH A;  2ENH A;  2JP9 A;  2EM2 A;  5KL7 A;  2ELY A;  1YSA C;  4R2E A;  2LO3 A;  2EMW A;  1DGC A;  4F2J C;  2EM7 A;  2EMK A;  2EOM A;  2EOE A;  4F6N A;  2NAB A;  2EOF A;  2EN3 A;  2EN8 A;  2EL4 A;  1WJP A;  2EPA A;  2EM5 A;  2YTN A;  5KL2 A;  2YTF A;  1B69 A;  5KL3 A;  1P47 A;  2EQ1 A;  5KL6 A;  2WBS A;  2JPA A;  2EL5 A;  2EMC A;  2DLK A;  2EMA A;  2GHF A;  2YU8 A;  2EOY A;  2YTO A;  4WSG A;  3EPL A;  1MEY C;  2EOO A;  2EM8 A;  4GZN C;  2ENC A;  1X6E A;  2EOJ A;  2YTQ A;  1UBD C;  2J7J A;  2EMG A;  2EOI A;  2M9A A;  3EPJ A;  2EMY A;  2BB8 A;  1X5W A;  1A1L A;  4F6M A;  2CTD A;  2MKD A;  2LVH A;  1X6F A;  2YRK A;  4R2C A;  2CT1 A;  1A1J A;  2DGC A;  1ZU1 A;  2RSI A;  2EL6 A;  4R2R A;  2EE8 A;  2EPU A;  2YU5 A;  2MKN A;  2LV2 A;  3UK3 C;  2E72 A;  1TN9 A;  2YTG A;  2EPR A;  2EM0 A;  2I13 A;  2EOR A;  1G2D C;  4X9J A;  2EMX A;  1RMD A;  2EM6 A;  2EQ3 A;  2YTD A;  1LLM C;  2GLI A;  1BB8 A;  3MHH C;  2EOH A;  2ENA A;  2WBU A;  2YRM A;  4R2P A;  2A25 A;  2YTI A;  2EMF A;  2EOS A;  2EOQ A;  1TF3 A;  2WCC 3;  2LCE A;  1X3C A;  1X6H A;  2YTP A;  2YRH A;  2EPX A;  1F2I G;  2EMZ A;  1ZAA C;  2DLQ A;  3MHS C;  2EN4 A;  1JK1 A;  2RPC A;  1ZR9 A;  2EPZ A;  2EMB A;  2EQ0 A;  2MDG A;  4IJD A;  2D9H A;  2DMI A;  2EML A;  5KL5 A;  2DRP A;  3M99 B;  2VRD A;  1G2F C;  2WBT A;  2YSP A;  1YUI A;  2R1F A;  4FK5 C;  1A1K A;  4M9V C;  2YSO A;  5KL4 A;  2EPC A;  2EN1 A;  2EOZ A;  4R2A A;  1NCS A;  1A1I A;  1YUJ A;  1A1G A;  2EMI A;  2EOX A;  1AAY A;  3EPK A;  2CSH A;  2ELZ A;  4R2S A;  4R2D A;  2YTJ A;  1JK2 A;  2PRT A;  2EPP A;  2EM3 A;  2EN7 A;  1Z1B A;  2HGH A;  2EN6 A;  1TF6 A;  1A1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...