4F6NA

Crystal structure of kaiso zinc finger dna binding protein in complex with methylated cpg site dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator Kaiso
publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6nA02
2YTNA 1P47A 3MHHC 2RPCA 1DGCA 1TF3A 3EPKA 1AAYA 3M99B 2J7JA 2EMXA 2EMBA 4R2AA 2EMIA 4M9VC 2YRHA 1A1GA 2EP3A 4X9JA 2EPCA 1A1FA 1A1JA 1F2IG 2WCC3 2WBTA 2MKNA 2EM0A 2YTDA 4R2DA 2EN2A 1A1KA 1RMDA 2EPUA 1JK1A 2MDGA 2YTOA 2YTQA 2LT7A 2EM3A 2ENHA 2EPZA 3EPJA 4R2QA 5KL4A 2GHFA 2DLQA 2EM8A 2EOXA 2EOMA 2EL5A 2EOFA 2I13A 2EMGA 1A1LA 2EN6A 1X5WA 2A25A 1ZAAC 2LV2A 2EM9A 1G2FC 2EOSA 2EOHA 2EJ4A 2EOJA 2E72A 4R2SA 4GZNC 2CT1A 4R2CA 2EMFA 1A1HA 2EPPA 2ELYA 2EQ3A 1WJPA 1TF6A 2CTDA 3MHSC 2MKDA 5KL2A 1A1IA 2EPXA 1NCSA 2EM7A 2EOEA 2LCEA 2R1FA 2EE8A 1BB8A 1UBDC 3EPHA 2BB8A 2DRPA 1UN6B 2EORA 2EMHA 2EM4A 2YTEA 2YSPA 1Z1BA 2EMLA 5KL7A 2YU8A 2YRMA 1BBOA 2EMKA 2EN1A 2WBUA 3EPLA 4IS1C 2JP9A 2HGHA 1ZR9A 2EPRA 1X3CA 2ENCA 2YTPA 2EN4A 2EPAA 2LO3A 2ADRA 2YTGA 4F6NA 2M9AA 1MEYC 1X6EA 2VRDA 2EM5A 2EL4A 2EOQA 2EQ0A 4R2PA 1TN9A 4IJDA 1KJKA 1JK2A 2EN3A 2DMIA 1G2DC 1ZU1A 2EOOA 2GLIA 5KL3A 1B69A 2EOZA 2EOYA 1YUIA 3VHTB 2EOIA 2RSIA 2PRTA 3UK3C 1X6HA 2DLKA 5KL6A 2EM6A 2YTIA 1LLMC 2EMZA 2WBSA 2ELZA 1YSAC 1X6FA 2LVHA 2NABA 4F2JC 2YRKA 2DGCA 4FK5C 5KL5A 2JPAA 2EMCA 2EQ1A 2D9HA 2CSHA 2EMYA 4F6MA 2ENAA 4R2RA 2YTJA 2EMWA 2YTFA 2YSOA 2YU5A 1YUJA 4WSGA 4R2EA 2EMAA 2EL6A 2EM2A 2EN7A 2EN8A
chains in the Genus database with same CATH superfamily
3VK6A 1P47A 5IT9C 5A6AA 2V85A 3MHHC 3J80C 1TF3A 1AAYA 4R2AA 2EMIA 5A69A 1A1FA 2VF1A 1YZ9A 1F2IG 2E1MA 4DV2E 2WZOA 4R2DA 4LFAE 1T38A 3THOB 2R76A 3T1HE 3P1XA 2LT7A 2IHR1 4ZYEA 3EPJA 3KZZA 2YZTA 4B3TE 2DLQA 3ADJA 4ZYDA 3HPSA 4BHCA 4J8ZA 5LMUE 4WFTA 3ADLA 2EOSA 4BC9A 4BMJA 2EOJA 4GZNC 3BGHA 2CT1A 2UXBE 2EMFA 2HJJA 1TF6A 2EQ3A 1RQ0A 1DQ3A 2EPMX 4MLVA 2MKDA 5LL6R 3DF6A 2EPXA 2EOEA 2LCEA 2KHXA 4F9AB 3EPHA 2EMHA 4KHPE 5ADZA 4OX9E 1I94E 1YYWA 4DUZE 2LE2A 2EN1A 5CFFE 5DNYA 4RH8A 4M30A 2RSMA 5BR8E 1ZR9A 2EPRA 4O43A 1X3CA 3J7Yp 3TQMA 2EM5A 2BBGA 3VYXA 2EWLA 2YPNA 4LU9A 1X47A 1TN9A 2DB2A 2EN3A 2EOOA 2UXDE 1J26A 2DSYA 4DR4E 1UHZA 2LMZA 2EOYA 3VHTB 2EOIA 1PJTA 1N33E 1PJQA 1X6HA 2DLKA 5LLQA 4DR1E 2EMZA 4JI1E 2WBSA 4F9BB 2UUCE 2NABA 1J5EE 1MGTA 2YRKA 1HR0E 2JPAA 2EMCA 5IWAE 2N3GA 4HEIA 2EPLX 1WHNA 1XMOE 2DIXA 1YUJA 1RC7A 2EMAA 2MC6A 1X6EA 4BC7A 1A1HA 4R8OA 1NEIA 3C4BA 4O4KA 3EPKA 3M99B 2EMXA 4F9CB 3AUZA 2EPKX 4M9VC 1STUA 2MDRA 4TUGA 1A1GA 2RQLA 2L92A 2KONA 2EZ6A 4KWYA 2EN2A 4DV5E 2L2KB 2GPIA 2FGGA 2MDGA 4LF8E 4LF5E 3OMLA 2LBSB 4LFCE 4JI8E 2EM3A 2EPZA 2I9IA 3L00A 3JTZA 4BHBA 4DV3E 3ZOQB 2EOXA 2K4VA 4OOGC 4O5GA 2RTXA 3IWDA 1XMQE 1A1LA 2RS6A 3K6QA 1QU6A 1EKZA 3AV0A 1ZAAC 4LFBE 2EM9A 3BF2A 1T4NA 3RMPA 4R2SA 1SR9A 3C6MA 4KZSA 4R2CA 2JY9A 2ZM6E 4O24A 5KL2A 1NCSA 2EM7A 2R1FA 1AH5A 2EE8A 1XNRE 3H09A 4AQYE 2N8XA 2DRPA 1UN6B 2YTEA 4LF4E 2NUFA 2FV4B 4YHHE 2DMYA 1IMUA 2YU8A 2YRMA 2M1SA 4DV6E 1N3GA 4LF7E 2NUGA 2L33A 4WX9A 2ENCA 4JI0E 2VQEE 2ADRA 2M9AA 2VRDA 2EL4A 2YWQA 1BBGA 5AE3A 1KYQA 3FIGA 3JU0A 1WXRA 3ADIA 1KJKA 2VE7C 1JK2A 1ZBTA 1YFHA 4ZYHA 1G2DC 5KL3A 2HC5A 1B69A 2EOZA 4X65E 1IBME 2PRTA 2JXPA 4BS9A 3J81C 4BBYA 2ELZA 2JOXA 1WRJA 3C4TA 2L8TA 4JI2E 2DGCA 4DR6E 2EQ1A 4I8OA 2LJUA 2UUBE 2YU5A 1N34E 4WSPA 5AE1A 3EPLA 1T39A 4P78A 4ZYGA 2LRSA 2RPCA 2JYAA 1DGCA 2J7JA 4K0KE 2EMBA 4B3RE 3IWCA 4P7DA 2EP3A 4X9JA 3VYYA 5A6BD 2WCC3 2WBTA 2MKNA 2B3TB 3MSWA 1A1KA 1RMDA 4DV1E 4JI4E 2JWOA 1FJGE 2JR1A 1JK1A 4DR7E 4X64E 2FTXB 4B3ME 1HNZE 2H36X 2ENHA 2G7HA 4M0VA 1HNXE 4R2QA 5KL4A 2EM8A 4DR5E 2EOFA 2I13A 4NHRA 5A6JA 5AASA 1X5WA 3BBGA 2RS7A 2A25A 2LUQA 2NUEA 3IWBA 2LV2A 5T6JA 2EJ4A 3F6HA 4GKJE 2EPPA 4WXDA 4DR2E 2CTDA 3MHSC 1SFEA 2Q8UA 3DJWA 3EQ1A 2MC5A 5IXMB 1BB8A 1UBDC 1EH6A 2BB8A 4JI6E 1DI2A 4WXCA 2M7QA 2EORA 1YYKA 2E5LE 4LF9E 4MLQA 2L2MA 4WPYA 1QNTA 1XNQE 2HHHE 1T4LB 4IS1C 4X66E 2UU9E 2L2NA 4X62E 1X49A 2V86A 2V88A 5FLXC 2YTPA 2EN4A 2ODRC 2EPOA 2YTGA 4F6NA 1YYOA 4R03A 2EQ0A 2EOQA 4R2PA 4IJDA 1HNWE 3LMLA 4DKKA 1GTKA 2GLIA 1EH8A 1GQEA 2V83A 1IBLE 5F3WA 3T1YE 2L3CA 4BCAA 2L3JA 5KL6A 4DV7E 2NA2A 2YTIA 1LLMC 5AC4A 4LTYA 2LTRA 4N4RB 2CPNA 5TSEA 4F2JC 1T4OA 5A6KA 1GZ6A 2EMYA 4Q35B 1ZBQA 1PKPA 2YTJA 4L5NC 4DV4E 4NZVA 3ADGA 4WSGA 2B9DA 4R2EA 4TUIA 2EL6A 1YPNA 2EPNA 1L4SA 2YTNA 5A6BA 3THNA 1N36E 2F8BA 4NXME 5IV8B 2VQFE 2B7VA 2YRHA 1EH7A 4JI5E 4DMIA 2EPCA 1UILA 1A1JA 3LLHA 2EM0A 2YTDA 4JYAE 4GKKE 2V8QB 4DV0E 4JI3E 1WHQA 2EPUA 2YTOA 2YTQA 2LUPB 2UXCE 3HQ1A 1N32E 2GHFA 5LMNE 4HTGA 3KZYA 2EOMA 3HPZA 2EL5A 2N3HA 4L8NA 2EMGA 2M4IA 4B3SE 2EN6A 2KOUA 2F4VE 3QG5C 4Q28A 5A2QC 3OTOE 1G2FC 1FKAE 2V89A 2EOHA 3KWRA 3C6KA 3F6GA 2E72A 4GEQB 4DUYE 4M2ZA 2ELYA 1WJPA 4RHBB 2LTSA 1A1IA 2ODRD 4LF6E 3ECRA 1O0WA 4NXNE 1X48A 2B7TA 2EM4A 2YT4A 4DR3E 2YSPA 3HXLA 1Z1BA 2EMLA 5KL7A 4F54A 1BBOA 2EMKA 2WBUA 1PDAA 2UUAE 2JP9A 2HGHA 5AC5A 2EPAA 2JOBA 2LO3A 3JAMC 1IBKE 1MEYC 4WYQB 1PJSA 3HTXA 4JV5E 2DMIA 1ZU1A 2V87A 4X8WA 1YUIA 2RSIA 3UK3C 1IQSA 2JVAA 2EM6A 1YSAC 3BIDA 1X6FA 2LVHA 4FK5C 5KL5A 2D9HA 2LJHA 2K7IA 2CSHA 2L6MA 4JI7E 3J7AG 4F6MA 2ENAA 4R2RA 2EMWA 2YTFA 2YSOA 5AE2A 1IQOA 4YY3E 2EM2A 2EN7A 2EN8A
chains in the Genus database with same CATH topology
2YTNA 1P47A 3MHHC 2RPCA 1DGCA 1TF3A 3EPKA 1AAYA 3M99B 2J7JA 2EMXA 2EMBA 4R2AA 2EMIA 4M9VC 2YRHA 1A1GA 2EP3A 4X9JA 2EPCA 1A1FA 1A1JA 1F2IG 2WCC3 2WBTA 2MKNA 2EM0A 2YTDA 4R2DA 2EN2A 1A1KA 1RMDA 2EPUA 1JK1A 2MDGA 2YTOA 2YTQA 2LT7A 2EM3A 2ENHA 2EPZA 3EPJA 4R2QA 5KL4A 2GHFA 2DLQA 2EM8A 2EOXA 2EOMA 2EL5A 2EOFA 2I13A 2EMGA 1A1LA 2EN6A 1X5WA 2A25A 1ZAAC 2LV2A 2EM9A 1G2FC 2EOSA 2EOHA 2EJ4A 2EOJA 2E72A 4R2SA 4GZNC 2CT1A 4R2CA 2EMFA 1A1HA 2EPPA 2ELYA 2EQ3A 1WJPA 1TF6A 2CTDA 3MHSC 2MKDA 5KL2A 1A1IA 2EPXA 1NCSA 2EM7A 2EOEA 2LCEA 2R1FA 2EE8A 1BB8A 1UBDC 3EPHA 2BB8A 2DRPA 1UN6B 2EORA 2EMHA 2EM4A 2YTEA 2YSPA 1Z1BA 2EMLA 5KL7A 2YU8A 2YRMA 1BBOA 2EMKA 2EN1A 2WBUA 3EPLA 4IS1C 2JP9A 2HGHA 1ZR9A 2EPRA 1X3CA 2ENCA 2YTPA 2EN4A 2EPAA 2LO3A 2ADRA 2YTGA 4F6NA 2M9AA 1MEYC 1X6EA 2VRDA 2EM5A 2EL4A 2EOQA 2EQ0A 4R2PA 1TN9A 4IJDA 1KJKA 1JK2A 2EN3A 2DMIA 1G2DC 1ZU1A 2EOOA 2GLIA 5KL3A 1B69A 2EOZA 2EOYA 1YUIA 3VHTB 2EOIA 2RSIA 2PRTA 3UK3C 1X6HA 2DLKA 5KL6A 2EM6A 2YTIA 1LLMC 2EMZA 2WBSA 2ELZA 1YSAC 1X6FA 2LVHA 2NABA 4F2JC 2YRKA 2DGCA 4FK5C 5KL5A 2JPAA 2EMCA 2EQ1A 2D9HA 2CSHA 2EMYA 4F6MA 2ENAA 4R2RA 2YTJA 2EMWA 2YTFA 2YSOA 2YU5A 1YUJA 4WSGA 4R2EA 2EMAA 2EL6A 2EM2A 2EN7A 2EN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTN A;  1P47 A;  3MHH C;  2RPC A;  1DGC A;  1TF3 A;  3EPK A;  1AAY A;  3M99 B;  2J7J A;  2EMX A;  2EMB A;  4R2A A;  2EMI A;  4M9V C;  2YRH A;  1A1G A;  2EP3 A;  4X9J A;  2EPC A;  1A1F A;  1A1J A;  1F2I G;  2WCC 3;  2WBT A;  2MKN A;  2EM0 A;  2YTD A;  4R2D A;  2EN2 A;  1A1K A;  1RMD A;  2EPU A;  1JK1 A;  2MDG A;  2YTO A;  2YTQ A;  2LT7 A;  2EM3 A;  2ENH A;  2EPZ A;  3EPJ A;  4R2Q A;  5KL4 A;  2GHF A;  2DLQ A;  2EM8 A;  2EOX A;  2EOM A;  2EL5 A;  2EOF A;  2I13 A;  2EMG A;  1A1L A;  2EN6 A;  1X5W A;  2A25 A;  1ZAA C;  2LV2 A;  2EM9 A;  1G2F C;  2EOS A;  2EOH A;  2EJ4 A;  2EOJ A;  2E72 A;  4R2S A;  4GZN C;  2CT1 A;  4R2C A;  2EMF A;  1A1H A;  2EPP A;  2ELY A;  2EQ3 A;  1WJP A;  1TF6 A;  2CTD A;  3MHS C;  2MKD A;  5KL2 A;  1A1I A;  2EPX A;  1NCS A;  2EM7 A;  2EOE A;  2LCE A;  2R1F A;  2EE8 A;  1BB8 A;  1UBD C;  3EPH A;  2BB8 A;  2DRP A;  1UN6 B;  2EOR A;  2EMH A;  2EM4 A;  2YTE A;  2YSP A;  1Z1B A;  2EML A;  5KL7 A;  2YU8 A;  2YRM A;  1BBO A;  2EMK A;  2EN1 A;  2WBU A;  3EPL A;  4IS1 C;  2JP9 A;  2HGH A;  1ZR9 A;  2EPR A;  1X3C A;  2ENC A;  2YTP A;  2EN4 A;  2EPA A;  2LO3 A;  2ADR A;  2YTG A;  4F6N A;  2M9A A;  1MEY C;  1X6E A;  2VRD A;  2EM5 A;  2EL4 A;  2EOQ A;  2EQ0 A;  4R2P A;  1TN9 A;  4IJD A;  1KJK A;  1JK2 A;  2EN3 A;  2DMI A;  1G2D C;  1ZU1 A;  2EOO A;  2GLI A;  5KL3 A;  1B69 A;  2EOZ A;  2EOY A;  1YUI A;  3VHT B;  2EOI A;  2RSI A;  2PRT A;  3UK3 C;  1X6H A;  2DLK A;  5KL6 A;  2EM6 A;  2YTI A;  1LLM C;  2EMZ A;  2WBS A;  2ELZ A;  1YSA C;  1X6F A;  2LVH A;  2NAB A;  4F2J C;  2YRK A;  2DGC A;  4FK5 C;  5KL5 A;  2JPA A;  2EMC A;  2EQ1 A;  2D9H A;  2CSH A;  2EMY A;  4F6M A;  2ENA A;  4R2R A;  2YTJ A;  2EMW A;  2YTF A;  2YSO A;  2YU5 A;  1YUJ A;  4WSG A;  4R2E A;  2EMA A;  2EL6 A;  2EM2 A;  2EN7 A;  2EN8 A; 
#chains in the Genus database with same CATH topology
 3VK6 A;  1P47 A;  5IT9 C;  5A6A A;  2V85 A;  3MHH C;  3J80 C;  1TF3 A;  1AAY A;  4R2A A;  2EMI A;  5A69 A;  1A1F A;  2VF1 A;  1YZ9 A;  1F2I G;  2E1M A;  4DV2 E;  2WZO A;  4R2D A;  4LFA E;  1T38 A;  3THO B;  2R76 A;  3T1H E;  3P1X A;  2LT7 A;  2IHR 1;  4ZYE A;  3EPJ A;  3KZZ A;  2YZT A;  4B3T E;  2DLQ A;  3ADJ A;  4ZYD A;  3HPS A;  4BHC A;  4J8Z A;  5LMU E;  4WFT A;  3ADL A;  2EOS A;  4BC9 A;  4BMJ A;  2EOJ A;  4GZN C;  3BGH A;  2CT1 A;  2UXB E;  2EMF A;  2HJJ A;  1TF6 A;  2EQ3 A;  1RQ0 A;  1DQ3 A;  2EPM X;  4MLV A;  2MKD A;  5LL6 R;  3DF6 A;  2EPX A;  2EOE A;  2LCE A;  2KHX A;  4F9A B;  3EPH A;  2EMH A;  4KHP E;  5ADZ A;  4OX9 E;  1I94 E;  1YYW A;  4DUZ E;  2LE2 A;  2EN1 A;  5CFF E;  5DNY A;  4RH8 A;  4M30 A;  2RSM A;  5BR8 E;  1ZR9 A;  2EPR A;  4O43 A;  1X3C A;  3J7Y p;  3TQM A;  2EM5 A;  2BBG A;  3VYX A;  2EWL A;  2YPN A;  4LU9 A;  1X47 A;  1TN9 A;  2DB2 A;  2EN3 A;  2EOO A;  2UXD E;  1J26 A;  2DSY A;  4DR4 E;  1UHZ A;  2LMZ A;  2EOY A;  3VHT B;  2EOI A;  1PJT A;  1N33 E;  1PJQ A;  1X6H A;  2DLK A;  5LLQ A;  4DR1 E;  2EMZ A;  4JI1 E;  2WBS A;  4F9B B;  2UUC E;  2NAB A;  1J5E E;  1MGT A;  2YRK A;  1HR0 E;  2JPA A;  2EMC A;  5IWA E;  2N3G A;  4HEI A;  2EPL X;  1WHN A;  1XMO E;  2DIX A;  1YUJ A;  1RC7 A;  2EMA A;  2MC6 A;  1X6E A;  4BC7 A;  1A1H A;  4R8O A;  1NEI A;  3C4B A;  4O4K A;  3EPK A;  3M99 B;  2EMX A;  4F9C B;  3AUZ A;  2EPK X;  4M9V C;  1STU A;  2MDR A;  4TUG A;  1A1G A;  2RQL A;  2L92 A;  2KON A;  2EZ6 A;  4KWY A;  2EN2 A;  4DV5 E;  2L2K B;  2GPI A;  2FGG A;  2MDG A;  4LF8 E;  4LF5 E;  3OML A;  2LBS B;  4LFC E;  4JI8 E;  2EM3 A;  2EPZ A;  2I9I A;  3L00 A;  3JTZ A;  4BHB A;  4DV3 E;  3ZOQ B;  2EOX A;  2K4V A;  4OOG C;  4O5G A;  2RTX A;  3IWD A;  1XMQ E;  1A1L A;  2RS6 A;  3K6Q A;  1QU6 A;  1EKZ A;  3AV0 A;  1ZAA C;  4LFB E;  2EM9 A;  3BF2 A;  1T4N A;  3RMP A;  4R2S A;  1SR9 A;  3C6M A;  4KZS A;  4R2C A;  2JY9 A;  2ZM6 E;  4O24 A;  5KL2 A;  1NCS A;  2EM7 A;  2R1F A;  1AH5 A;  2EE8 A;  1XNR E;  3H09 A;  4AQY E;  2N8X A;  2DRP A;  1UN6 B;  2YTE A;  4LF4 E;  2NUF A;  2FV4 B;  4YHH E;  2DMY A;  1IMU A;  2YU8 A;  2YRM A;  2M1S A;  4DV6 E;  1N3G A;  4LF7 E;  2NUG A;  2L33 A;  4WX9 A;  2ENC A;  4JI0 E;  2VQE E;  2ADR A;  2M9A A;  2VRD A;  2EL4 A;  2YWQ A;  1BBG A;  5AE3 A;  1KYQ A;  3FIG A;  3JU0 A;  1WXR A;  3ADI A;  1KJK A;  2VE7 C;  1JK2 A;  1ZBT A;  1YFH A;  4ZYH A;  1G2D C;  5KL3 A;  2HC5 A;  1B69 A;  2EOZ A;  4X65 E;  1IBM E;  2PRT A;  2JXP A;  4BS9 A;  3J81 C;  4BBY A;  2ELZ A;  2JOX A;  1WRJ A;  3C4T A;  2L8T A;  4JI2 E;  2DGC A;  4DR6 E;  2EQ1 A;  4I8O A;  2LJU A;  2UUB E;  2YU5 A;  1N34 E;  4WSP A;  5AE1 A;  3EPL A;  1T39 A;  4P78 A;  4ZYG A;  2LRS A;  2RPC A;  2JYA A;  1DGC A;  2J7J A;  4K0K E;  2EMB A;  4B3R E;  3IWC A;  4P7D A;  2EP3 A;  4X9J A;  3VYY A;  5A6B D;  2WCC 3;  2WBT A;  2MKN A;  2B3T B;  3MSW A;  1A1K A;  1RMD A;  4DV1 E;  4JI4 E;  2JWO A;  1FJG E;  2JR1 A;  1JK1 A;  4DR7 E;  4X64 E;  2FTX B;  4B3M E;  1HNZ E;  2H36 X;  2ENH A;  2G7H A;  4M0V A;  1HNX E;  4R2Q A;  5KL4 A;  2EM8 A;  4DR5 E;  2EOF A;  2I13 A;  4NHR A;  5A6J A;  5AAS A;  1X5W A;  3BBG A;  2RS7 A;  2A25 A;  2LUQ A;  2NUE A;  3IWB A;  2LV2 A;  5T6J A;  2EJ4 A;  3F6H A;  4GKJ E;  2EPP A;  4WXD A;  4DR2 E;  2CTD A;  3MHS C;  1SFE A;  2Q8U A;  3DJW A;  3EQ1 A;  2MC5 A;  5IXM B;  1BB8 A;  1UBD C;  1EH6 A;  2BB8 A;  4JI6 E;  1DI2 A;  4WXC A;  2M7Q A;  2EOR A;  1YYK A;  2E5L E;  4LF9 E;  4MLQ A;  2L2M A;  4WPY A;  1QNT A;  1XNQ E;  2HHH E;  1T4L B;  4IS1 C;  4X66 E;  2UU9 E;  2L2N A;  4X62 E;  1X49 A;  2V86 A;  2V88 A;  5FLX C;  2YTP A;  2EN4 A;  2ODR C;  2EPO A;  2YTG A;  4F6N A;  1YYO A;  4R03 A;  2EQ0 A;  2EOQ A;  4R2P A;  4IJD A;  1HNW E;  3LML A;  4DKK A;  1GTK A;  2GLI A;  1EH8 A;  1GQE A;  2V83 A;  1IBL E;  5F3W A;  3T1Y E;  2L3C A;  4BCA A;  2L3J A;  5KL6 A;  4DV7 E;  2NA2 A;  2YTI A;  1LLM C;  5AC4 A;  4LTY A;  2LTR A;  4N4R B;  2CPN A;  5TSE A;  4F2J C;  1T4O A;  5A6K A;  1GZ6 A;  2EMY A;  4Q35 B;  1ZBQ A;  1PKP A;  2YTJ A;  4L5N C;  4DV4 E;  4NZV A;  3ADG A;  4WSG A;  2B9D A;  4R2E A;  4TUI A;  2EL6 A;  1YPN A;  2EPN A;  1L4S A;  2YTN A;  5A6B A;  3THN A;  1N36 E;  2F8B A;  4NXM E;  5IV8 B;  2VQF E;  2B7V A;  2YRH A;  1EH7 A;  4JI5 E;  4DMI A;  2EPC A;  1UIL A;  1A1J A;  3LLH A;  2EM0 A;  2YTD A;  4JYA E;  4GKK E;  2V8Q B;  4DV0 E;  4JI3 E;  1WHQ A;  2EPU A;  2YTO A;  2YTQ A;  2LUP B;  2UXC E;  3HQ1 A;  1N32 E;  2GHF A;  5LMN E;  4HTG A;  3KZY A;  2EOM A;  3HPZ A;  2EL5 A;  2N3H A;  4L8N A;  2EMG A;  2M4I A;  4B3S E;  2EN6 A;  2KOU A;  2F4V E;  3QG5 C;  4Q28 A;  5A2Q C;  3OTO E;  1G2F C;  1FKA E;  2V89 A;  2EOH A;  3KWR A;  3C6K A;  3F6G A;  2E72 A;  4GEQ B;  4DUY E;  4M2Z A;  2ELY A;  1WJP A;  4RHB B;  2LTS A;  1A1I A;  2ODR D;  4LF6 E;  3ECR A;  1O0W A;  4NXN E;  1X48 A;  2B7T A;  2EM4 A;  2YT4 A;  4DR3 E;  2YSP A;  3HXL A;  1Z1B A;  2EML A;  5KL7 A;  4F54 A;  1BBO A;  2EMK A;  2WBU A;  1PDA A;  2UUA E;  2JP9 A;  2HGH A;  5AC5 A;  2EPA A;  2JOB A;  2LO3 A;  3JAM C;  1IBK E;  1MEY C;  4WYQ B;  1PJS A;  3HTX A;  4JV5 E;  2DMI A;  1ZU1 A;  2V87 A;  4X8W A;  1YUI A;  2RSI A;  3UK3 C;  1IQS A;  2JVA A;  2EM6 A;  1YSA C;  3BID A;  1X6F A;  2LVH A;  4FK5 C;  5KL5 A;  2D9H A;  2LJH A;  2K7I A;  2CSH A;  2L6M A;  4JI7 E;  3J7A G;  4F6M A;  2ENA A;  4R2R A;  2EMW A;  2YTF A;  2YSO A;  5AE2 A;  1IQO A;  4YY3 E;  2EM2 A;  2EN7 A;  2EN8 A; 
#chains in the Genus database with same CATH homology
 2YTN A;  1P47 A;  3MHH C;  2RPC A;  1DGC A;  1TF3 A;  3EPK A;  1AAY A;  3M99 B;  2J7J A;  2EMX A;  2EMB A;  4R2A A;  2EMI A;  4M9V C;  2YRH A;  1A1G A;  2EP3 A;  4X9J A;  2EPC A;  1A1F A;  1A1J A;  1F2I G;  2WCC 3;  2WBT A;  2MKN A;  2EM0 A;  2YTD A;  4R2D A;  2EN2 A;  1A1K A;  1RMD A;  2EPU A;  1JK1 A;  2MDG A;  2YTO A;  2YTQ A;  2LT7 A;  2EM3 A;  2ENH A;  2EPZ A;  3EPJ A;  4R2Q A;  5KL4 A;  2GHF A;  2DLQ A;  2EM8 A;  2EOX A;  2EOM A;  2EL5 A;  2EOF A;  2I13 A;  2EMG A;  1A1L A;  2EN6 A;  1X5W A;  2A25 A;  1ZAA C;  2LV2 A;  2EM9 A;  1G2F C;  2EOS A;  2EOH A;  2EJ4 A;  2EOJ A;  2E72 A;  4R2S A;  4GZN C;  2CT1 A;  4R2C A;  2EMF A;  1A1H A;  2EPP A;  2ELY A;  2EQ3 A;  1WJP A;  1TF6 A;  2CTD A;  3MHS C;  2MKD A;  5KL2 A;  1A1I A;  2EPX A;  1NCS A;  2EM7 A;  2EOE A;  2LCE A;  2R1F A;  2EE8 A;  1BB8 A;  1UBD C;  3EPH A;  2BB8 A;  2DRP A;  1UN6 B;  2EOR A;  2EMH A;  2EM4 A;  2YTE A;  2YSP A;  1Z1B A;  2EML A;  5KL7 A;  2YU8 A;  2YRM A;  1BBO A;  2EMK A;  2EN1 A;  2WBU A;  3EPL A;  4IS1 C;  2JP9 A;  2HGH A;  1ZR9 A;  2EPR A;  1X3C A;  2ENC A;  2YTP A;  2EN4 A;  2EPA A;  2LO3 A;  2ADR A;  2YTG A;  4F6N A;  2M9A A;  1MEY C;  1X6E A;  2VRD A;  2EM5 A;  2EL4 A;  2EOQ A;  2EQ0 A;  4R2P A;  1TN9 A;  4IJD A;  1KJK A;  1JK2 A;  2EN3 A;  2DMI A;  1G2D C;  1ZU1 A;  2EOO A;  2GLI A;  5KL3 A;  1B69 A;  2EOZ A;  2EOY A;  1YUI A;  3VHT B;  2EOI A;  2RSI A;  2PRT A;  3UK3 C;  1X6H A;  2DLK A;  5KL6 A;  2EM6 A;  2YTI A;  1LLM C;  2EMZ A;  2WBS A;  2ELZ A;  1YSA C;  1X6F A;  2LVH A;  2NAB A;  4F2J C;  2YRK A;  2DGC A;  4FK5 C;  5KL5 A;  2JPA A;  2EMC A;  2EQ1 A;  2D9H A;  2CSH A;  2EMY A;  4F6M A;  2ENA A;  4R2R A;  2YTJ A;  2EMW A;  2YTF A;  2YSO A;  2YU5 A;  1YUJ A;  4WSG A;  4R2E A;  2EMA A;  2EL6 A;  2EM2 A;  2EN7 A;  2EN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...