2EMIA

Solution structure of the c2h2 type zinc finger (region 547-579) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERHYECSECGKAFIQKSTLSMHQRIHRGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 547-579) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emiA01
4R2EA 2EM6A 2EL4A 1X3CA 2A25A 2EOOA 2EN1A 5KL2A 2YU8A 2MKDA 2EM5A 2EM0A 2EN2A 2EPCA 5KL6A 5KL7A 1AAYA 2YTOA 2EORA 1YSAC 2EOXA 2NABA 2LO3A 1X5WA 1A1FA 2EM8A 2EN7A 2LV2A 2YTFA 2DMIA 2EMWA 2YRMA 2CT1A 1DGCA 2YTJA 2MDGA 3MHSC 2EQ3A 2EPZA 2YTQA 1ZAAC 1G2DC 1KJKA 1BBOA 4R2DA 1MEYC 2YTIA 2E72A 1X6EA 5KL5A 4R2AA 4F6MA 1YUIA 2ELZA 1TF6A 2EQ1A 2DRPA 2EMZA 3EPKA 2EMAA 2EM4A 2EE8A 1TN9A 1UBDC 1Z1BA 2WBSA 4M9VC 2EMHA 3EPJA 4GZNC 2GLIA 1A1JA 2EMKA 2EN4A 2RSIA 2EMFA 4X9JA 2YRHA 2EOIA 1A1HA 1A1KA 2EM2A 4F2JC 2EOQA 2EL5A 2EMCA 4R2RA 2ENAA 1NCSA 4IJDA 2EPUA 2LT7A 4WSGA 2EMGA 2D9HA 2EP3A 2EPXA 2PRTA 2EN6A 1B69A 2EL6A 2YSOA 1YUJA 2WCC3 2EOYA 2YTGA 2EOSA 2YTPA 2JPAA 1TF3A 2I13A 1WJPA 1UN6B 2EPRA 2EOJA 1LLMC 4R2PA 1F2IG 2EMYA 4FK5C 2ENCA 2LVHA 2YRKA 2YTDA 2GHFA 5KL3A 1RMDA 2EMLA 3VHTB 2ADRA 2ELYA 2EM3A 2WBUA 2CTDA 2CSHA 2DGCA 2EM9A 5KL4A 1A1LA 2EOZA 2M9AA 2EOHA 2EM7A 1X6FA 2YU5A 1BB8A 4F6NA 2ENHA 2EMXA 2VRDA 2EMBA 2EOMA 1P47A 1JK2A 2EQ0A 2EPPA 2LCEA 2EN3A 2JP9A 4R2QA 4R2CA 2BB8A 2DLQA 2EOEA 2EN8A 2WBTA 1A1IA 2EJ4A 1ZR9A 3MHHC 3EPHA 1X6HA 2J7JA 2EPAA 2EOFA 3EPLA 1JK1A 2YTEA 2YTNA 2R1FA 3M99B 2HGHA 1G2FC 2EMIA 2YSPA 2DLKA 1A1GA 2MKNA 2RPCA 1ZU1A 4R2SA 4IS1C 3UK3C
chains in the Genus database with same CATH superfamily
2WZOA 3LLHA 2LBSB 2EM6A 4R03A 2EL4A 2A25A 4GKJE 2JXPA 3JAMC 2BBGA 2MKDA 2EPCA 2YTOA 5AE1A 1PJTA 2V85A 4DV2E 1IMUA 4LF5E 3L00A 4LTYA 2EPMX 1N32E 2EMWA 4RH8A 2H36X 2LTSA 1DGCA 2MDGA 2VF1A 4ZYHA 4OX9E 4B3SE 1G2DC 2K7IA 4R2DA 3VYXA 1MEYC 4F6MA 2E72A 4JI3E 1J5EE 1TF6A 3BF2A 3P1XA 2DRPA 1GZ6A 2EMZA 2RTXA 4LF8E 4LFAE 4X66E 1YYKA 3ZOQB 1HR0E 2RSIA 1MGTA 2JOBA 4N4RB 2KOUA 1A1HA 2EOQA 4WFTA 5A69A 3C6KA 1NCSA 4O43A 4DR4E 2EPUA 4WSGA 2FGGA 4B3ME 2L8TA 2EP3A 2V86A 5DNYA 2JOXA 4KZSA 1YUJA 2WCC3 1YFHA 1STUA 1QNTA 4DUZE 2E1MA 2EOSA 5FLXC 1EKZA 4O24A 1XMQE 4R2PA 3T1HE 1HNZE 1F2IG 2YWQA 4M0VA 2L2NA 2EMYA 2M7QA 4FK5C 1N33E 3OTOE 2ODRC 4ZYDA 4LF6E 2EPLX 4JI1E 4LU9A 2ELYA 1XMOE 2EM9A 5AE2A 2EOHA 5LMNE 1IBKE 2EM7A 3DJWA 1IBLE 4F6NA 2EMXA 1N36E 1L4SA 2L3JA 1RC7A 2JWOA 2KHXA 2DLQA 2EOEA 2WBTA 2EN8A 2EJ4A 3EPHA 2J7JA 1PKPA 4WX9A 3EPLA 4K0KE 2YTNA 5BR8E 4P78A 1A1GA 3C4BA 5AASA 3ECRA 4O4KA 2JYAA 1ZU1A 4IS1C 1J26A 2LE2A 3FIGA 3HTXA 2NA2A 1X3CA 5A6BA 2EOOA 2KONA 5KL2A 1T4OA 2EM5A 5A6AA 4JYAE 2M4IA 5A6KA 3VYYA 2EOXA 2HJJA 2LO3A 2L2KB 4DV6E 1A1FA 2UUAE 2EN7A 2JY9A 2LV2A 2DMIA 3HPSA 4DKKA 1T4NA 4HEIA 1PJQA 2YTJA 1QU6A 1N34E 2YTQA 2EPZA 5LLQA 1ZAAC 5KL5A 3J7Yp 2L6MA 4WXDA 4LFCE 4OOGC 3EPKA 2EMAA 1IQOA 4DMIA 1UBDC 3F6GA 2EMHA 2Q8UA 1WXRA 3EPJA 2MDRA 1X48A 3HPZA 2HC5A 4DV0E 2EMKA 2N3GA 2EMFA 2YRHA 1A1KA 3J81C 2DB2A 4X8WA 2LT7A 3BGHA 3DF6A 2D9HA 2UU9E 2EN6A 4JI4E 2YSOA 3MSWA 2YTGA 3OMLA 5A2QC 2I13A 3ADGA 4L8NA 1UN6B 1ZBQA 2EPRA 1HNXE 4WPYA 2EPKX 2RS7A 2LJHA 2YRKA 4DV3E 2GHFA 5KL3A 1SR9A 2ODRD 1RMDA 2EMLA 3VHTB 5AC4A 2WBUA 3H09A 2CSHA 2M9AA 1AH5A 2YU5A 5TSEA 1BB8A 2ENHA 1O0WA 2I9IA 2NUEA 4Q28A 4R2CA 1ZR9A 1X6HA 3JU0A 2B7VA 2B3TB 1JK1A 4DV7E 4Q35B 2YT4A 3K6QA 5LL6R 2R1FA 5AE3A 4RHBB 2UUBE 1G2FC 4JI0E 2LTRA 1YPNA 3AUZA 2DLKA 2YPNA 4NHRA 4L5NC 5IV8B 1DQ3A 2DMYA 2ZM6E 4R2SA 3UK3C 4I8OA 3AV0A 1NEIA 3T1YE 5F3WA 4BS9A 2EM0A 2EN2A 5KL7A 2LJUA 4DV1E 1EH6A 1YSAC 2NABA 2V88A 4BHBA 3BBGA 2UUCE 4O5GA 2EM8A 2YTFA 5T6JA 1X49A 2B9DA 2CPNA 4F9AB 2CT1A 3TQMA 1KJKA 4R2AA 2EPOA 5A6BD 3F6HA 1PJSA 3KWRA 4JV5E 4BMJA 2EE8A 4F9CB 1TN9A 1Z1BA 2YZTA 4M2ZA 2WBSA 4LF7E 4M9VC 4GZNC 2GLIA 4B3RE 4DV4E 4JI2E 1GTKA 4X9JA 2EOIA 2EM2A 4F2JC 2F8BA 4JI6E 4M30A 2ENAA 3THNA 1XNQE 4DR7E 2UXCE 3EQ1A 3RMPA 2JVAA 2MC6A 4GKKE 2PRTA 4TUIA 1WHQA 2EPNA 2YTPA 2JPAA 3JTZA 1UILA 2R76A 5ADZA 4LF9E 2ENCA 2LVHA 1T39A 2YTDA 4LFBE 4AQYE 2ADRA 2MC5A 2CTDA 4JI7E 1IQSA 5KL4A 1A1LA 2EOZA 3KZYA 3J80C 4DR6E 1N3GA 4YY3E 2UXBE 4ZYGA 1RQ0A 2L92A 2UXDE 2EOMA 1GQEA 2EQ0A 2EPPA 3ADJA 2JP9A 3IWCA 2G7HA 1IBME 5IXMB 4MLVA 4BHCA 2NUFA 2K4VA 4JI8E 3THOB 2V89A 3IWDA 4DR5E 4WSPA 1KYQA 1BBGA 3KZZA 4R2EA 2FV4B 2FTXB 4YHHE 1YZ9A 2EN1A 2L3CA 2YU8A 4KWYA 4B3TE 1AAYA 5KL6A 1FJGE 2EORA 4DR2E 4WYQB 1X5WA 1DI2A 2HHHE 3C6MA 1HNWE 2DIXA 3VK6A 3ADIA 4DUYE 2V83A 1X47A 4F54A 2EWLA 2YRMA 5AC5A 3MHSC 1I94E 2EQ3A 1BBOA 1YUIA 2YTIA 1X6EA 1ZBTA 4BBYA 2ELZA 3J7AG 1EH8A 2EQ1A 4WXCA 2LUQA 2EM4A 2V87A 4BC9A 1T38A 1WHNA 1A1JA 3IWBA 1EH7A 2LRSA 2EN4A 4J8ZA 4F9BB 4HTGA 3ADLA 1WRJA 4DR3E 4KHPE 2EZ6A 2EL5A 3HXLA 2EMCA 4R2RA 4IJDA 1PDAA 1XNRE 2EMGA 2N8XA 2VE7C 4BCAA 4TUGA 4MLQA 2JR1A 2EPXA 1UHZA 1SFEA 1B69A 2EL6A 2VQEE 2EOYA 4NXME 2M1SA 4LF4E 4R8OA 1TF3A 2NUGA 1WJPA 2LMZA 2V8QB 2RQLA 4GEQB 5IT9C 2EOJA 1YYOA 1LLMC 4JI5E 4DV5E 2L2MA 3LMLA 3HQ1A 3C4TA 2EM3A 5LMUE 5IWAE 2DGCA 4NXNE 4X64E 4BC7A 4P7DA 1X6FA 4NZVA 2VRDA 2EMBA 1P47A 1JK2A 3QG5C 4DR1E 2LCEA 2EN3A 5CFFE 4R2QA 2BB8A 1A1IA 3MHHC 2L33A 2RSMA 2E5LE 2EPAA 1YYWA 2VQFE 2EOFA 2YTEA 4X62E 4ZYEA 5A6JA 2B7TA 2RS6A 2DSYA 3M99B 2LUPB 2HGHA 2GPIA 2EMIA 1FKAE 2YSPA 1T4LB 2MKNA 2F4VE 2RPCA 3BIDA 2IHR1 4X65E 2N3HA
chains in the Genus database with same CATH topology
4R2EA 2EM6A 2EL4A 1X3CA 2A25A 2EOOA 2EN1A 5KL2A 2YU8A 2MKDA 2EM5A 2EM0A 2EN2A 2EPCA 5KL6A 5KL7A 1AAYA 2YTOA 2EORA 1YSAC 2EOXA 2NABA 2LO3A 1X5WA 1A1FA 2EM8A 2EN7A 2LV2A 2YTFA 2DMIA 2EMWA 2YRMA 2CT1A 1DGCA 2YTJA 2MDGA 3MHSC 2EQ3A 2EPZA 2YTQA 1ZAAC 1G2DC 1KJKA 1BBOA 4R2DA 1MEYC 2YTIA 2E72A 1X6EA 5KL5A 4R2AA 4F6MA 1YUIA 2ELZA 1TF6A 2EQ1A 2DRPA 2EMZA 3EPKA 2EMAA 2EM4A 2EE8A 1TN9A 1UBDC 1Z1BA 2WBSA 4M9VC 2EMHA 3EPJA 4GZNC 2GLIA 1A1JA 2EMKA 2EN4A 2RSIA 2EMFA 4X9JA 2YRHA 2EOIA 1A1HA 1A1KA 2EM2A 4F2JC 2EOQA 2EL5A 2EMCA 4R2RA 2ENAA 1NCSA 4IJDA 2EPUA 2LT7A 4WSGA 2EMGA 2D9HA 2EP3A 2EPXA 2PRTA 2EN6A 1B69A 2EL6A 2YSOA 1YUJA 2WCC3 2EOYA 2YTGA 2EOSA 2YTPA 2JPAA 1TF3A 2I13A 1WJPA 1UN6B 2EPRA 2EOJA 1LLMC 4R2PA 1F2IG 2EMYA 4FK5C 2ENCA 2LVHA 2YRKA 2YTDA 2GHFA 5KL3A 1RMDA 2EMLA 3VHTB 2ADRA 2ELYA 2EM3A 2WBUA 2CTDA 2CSHA 2DGCA 2EM9A 5KL4A 1A1LA 2EOZA 2M9AA 2EOHA 2EM7A 1X6FA 2YU5A 1BB8A 4F6NA 2ENHA 2EMXA 2VRDA 2EMBA 2EOMA 1P47A 1JK2A 2EQ0A 2EPPA 2LCEA 2EN3A 2JP9A 4R2QA 4R2CA 2BB8A 2DLQA 2EOEA 2EN8A 2WBTA 1A1IA 2EJ4A 1ZR9A 3MHHC 3EPHA 1X6HA 2J7JA 2EPAA 2EOFA 3EPLA 1JK1A 2YTEA 2YTNA 2R1FA 3M99B 2HGHA 1G2FC 2EMIA 2YSPA 2DLKA 1A1GA 2MKNA 2RPCA 1ZU1A 4R2SA 4IS1C 3UK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2E A;  2EM6 A;  2EL4 A;  1X3C A;  2A25 A;  2EOO A;  2EN1 A;  5KL2 A;  2YU8 A;  2MKD A;  2EM5 A;  2EM0 A;  2EN2 A;  2EPC A;  5KL6 A;  5KL7 A;  1AAY A;  2YTO A;  2EOR A;  1YSA C;  2EOX A;  2NAB A;  2LO3 A;  1X5W A;  1A1F A;  2EM8 A;  2EN7 A;  2LV2 A;  2YTF A;  2DMI A;  2EMW A;  2YRM A;  2CT1 A;  1DGC A;  2YTJ A;  2MDG A;  3MHS C;  2EQ3 A;  2EPZ A;  2YTQ A;  1ZAA C;  1G2D C;  1KJK A;  1BBO A;  4R2D A;  1MEY C;  2YTI A;  2E72 A;  1X6E A;  5KL5 A;  4R2A A;  4F6M A;  1YUI A;  2ELZ A;  1TF6 A;  2EQ1 A;  2DRP A;  2EMZ A;  3EPK A;  2EMA A;  2EM4 A;  2EE8 A;  1TN9 A;  1UBD C;  1Z1B A;  2WBS A;  4M9V C;  2EMH A;  3EPJ A;  4GZN C;  2GLI A;  1A1J A;  2EMK A;  2EN4 A;  2RSI A;  2EMF A;  4X9J A;  2YRH A;  2EOI A;  1A1H A;  1A1K A;  2EM2 A;  4F2J C;  2EOQ A;  2EL5 A;  2EMC A;  4R2R A;  2ENA A;  1NCS A;  4IJD A;  2EPU A;  2LT7 A;  4WSG A;  2EMG A;  2D9H A;  2EP3 A;  2EPX A;  2PRT A;  2EN6 A;  1B69 A;  2EL6 A;  2YSO A;  1YUJ A;  2WCC 3;  2EOY A;  2YTG A;  2EOS A;  2YTP A;  2JPA A;  1TF3 A;  2I13 A;  1WJP A;  1UN6 B;  2EPR A;  2EOJ A;  1LLM C;  4R2P A;  1F2I G;  2EMY A;  4FK5 C;  2ENC A;  2LVH A;  2YRK A;  2YTD A;  2GHF A;  5KL3 A;  1RMD A;  2EML A;  3VHT B;  2ADR A;  2ELY A;  2EM3 A;  2WBU A;  2CTD A;  2CSH A;  2DGC A;  2EM9 A;  5KL4 A;  1A1L A;  2EOZ A;  2M9A A;  2EOH A;  2EM7 A;  1X6F A;  2YU5 A;  1BB8 A;  4F6N A;  2ENH A;  2EMX A;  2VRD A;  2EMB A;  2EOM A;  1P47 A;  1JK2 A;  2EQ0 A;  2EPP A;  2LCE A;  2EN3 A;  2JP9 A;  4R2Q A;  4R2C A;  2BB8 A;  2DLQ A;  2EOE A;  2EN8 A;  2WBT A;  1A1I A;  2EJ4 A;  1ZR9 A;  3MHH C;  3EPH A;  1X6H A;  2J7J A;  2EPA A;  2EOF A;  3EPL A;  1JK1 A;  2YTE A;  2YTN A;  2R1F A;  3M99 B;  2HGH A;  1G2F C;  2EMI A;  2YSP A;  2DLK A;  1A1G A;  2MKN A;  2RPC A;  1ZU1 A;  4R2S A;  4IS1 C;  3UK3 C; 
#chains in the Genus database with same CATH topology
 2WZO A;  3LLH A;  2LBS B;  2EM6 A;  4R03 A;  2EL4 A;  2A25 A;  4GKJ E;  2JXP A;  3JAM C;  2BBG A;  2MKD A;  2EPC A;  2YTO A;  5AE1 A;  1PJT A;  2V85 A;  4DV2 E;  1IMU A;  4LF5 E;  3L00 A;  4LTY A;  2EPM X;  1N32 E;  2EMW A;  4RH8 A;  2H36 X;  2LTS A;  1DGC A;  2MDG A;  2VF1 A;  4ZYH A;  4OX9 E;  4B3S E;  1G2D C;  2K7I A;  4R2D A;  3VYX A;  1MEY C;  4F6M A;  2E72 A;  4JI3 E;  1J5E E;  1TF6 A;  3BF2 A;  3P1X A;  2DRP A;  1GZ6 A;  2EMZ A;  2RTX A;  4LF8 E;  4LFA E;  4X66 E;  1YYK A;  3ZOQ B;  1HR0 E;  2RSI A;  1MGT A;  2JOB A;  4N4R B;  2KOU A;  1A1H A;  2EOQ A;  4WFT A;  5A69 A;  3C6K A;  1NCS A;  4O43 A;  4DR4 E;  2EPU A;  4WSG A;  2FGG A;  4B3M E;  2L8T A;  2EP3 A;  2V86 A;  5DNY A;  2JOX A;  4KZS A;  1YUJ A;  2WCC 3;  1YFH A;  1STU A;  1QNT A;  4DUZ E;  2E1M A;  2EOS A;  5FLX C;  1EKZ A;  4O24 A;  1XMQ E;  4R2P A;  3T1H E;  1HNZ E;  1F2I G;  2YWQ A;  4M0V A;  2L2N A;  2EMY A;  2M7Q A;  4FK5 C;  1N33 E;  3OTO E;  2ODR C;  4ZYD A;  4LF6 E;  2EPL X;  4JI1 E;  4LU9 A;  2ELY A;  1XMO E;  2EM9 A;  5AE2 A;  2EOH A;  5LMN E;  1IBK E;  2EM7 A;  3DJW A;  1IBL E;  4F6N A;  2EMX A;  1N36 E;  1L4S A;  2L3J A;  1RC7 A;  2JWO A;  2KHX A;  2DLQ A;  2EOE A;  2WBT A;  2EN8 A;  2EJ4 A;  3EPH A;  2J7J A;  1PKP A;  4WX9 A;  3EPL A;  4K0K E;  2YTN A;  5BR8 E;  4P78 A;  1A1G A;  3C4B A;  5AAS A;  3ECR A;  4O4K A;  2JYA A;  1ZU1 A;  4IS1 C;  1J26 A;  2LE2 A;  3FIG A;  3HTX A;  2NA2 A;  1X3C A;  5A6B A;  2EOO A;  2KON A;  5KL2 A;  1T4O A;  2EM5 A;  5A6A A;  4JYA E;  2M4I A;  5A6K A;  3VYY A;  2EOX A;  2HJJ A;  2LO3 A;  2L2K B;  4DV6 E;  1A1F A;  2UUA E;  2EN7 A;  2JY9 A;  2LV2 A;  2DMI A;  3HPS A;  4DKK A;  1T4N A;  4HEI A;  1PJQ A;  2YTJ A;  1QU6 A;  1N34 E;  2YTQ A;  2EPZ A;  5LLQ A;  1ZAA C;  5KL5 A;  3J7Y p;  2L6M A;  4WXD A;  4LFC E;  4OOG C;  3EPK A;  2EMA A;  1IQO A;  4DMI A;  1UBD C;  3F6G A;  2EMH A;  2Q8U A;  1WXR A;  3EPJ A;  2MDR A;  1X48 A;  3HPZ A;  2HC5 A;  4DV0 E;  2EMK A;  2N3G A;  2EMF A;  2YRH A;  1A1K A;  3J81 C;  2DB2 A;  4X8W A;  2LT7 A;  3BGH A;  3DF6 A;  2D9H A;  2UU9 E;  2EN6 A;  4JI4 E;  2YSO A;  3MSW A;  2YTG A;  3OML A;  5A2Q C;  2I13 A;  3ADG A;  4L8N A;  1UN6 B;  1ZBQ A;  2EPR A;  1HNX E;  4WPY A;  2EPK X;  2RS7 A;  2LJH A;  2YRK A;  4DV3 E;  2GHF A;  5KL3 A;  1SR9 A;  2ODR D;  1RMD A;  2EML A;  3VHT B;  5AC4 A;  2WBU A;  3H09 A;  2CSH A;  2M9A A;  1AH5 A;  2YU5 A;  5TSE A;  1BB8 A;  2ENH A;  1O0W A;  2I9I A;  2NUE A;  4Q28 A;  4R2C A;  1ZR9 A;  1X6H A;  3JU0 A;  2B7V A;  2B3T B;  1JK1 A;  4DV7 E;  4Q35 B;  2YT4 A;  3K6Q A;  5LL6 R;  2R1F A;  5AE3 A;  4RHB B;  2UUB E;  1G2F C;  4JI0 E;  2LTR A;  1YPN A;  3AUZ A;  2DLK A;  2YPN A;  4NHR A;  4L5N C;  5IV8 B;  1DQ3 A;  2DMY A;  2ZM6 E;  4R2S A;  3UK3 C;  4I8O A;  3AV0 A;  1NEI A;  3T1Y E;  5F3W A;  4BS9 A;  2EM0 A;  2EN2 A;  5KL7 A;  2LJU A;  4DV1 E;  1EH6 A;  1YSA C;  2NAB A;  2V88 A;  4BHB A;  3BBG A;  2UUC E;  4O5G A;  2EM8 A;  2YTF A;  5T6J A;  1X49 A;  2B9D A;  2CPN A;  4F9A B;  2CT1 A;  3TQM A;  1KJK A;  4R2A A;  2EPO A;  5A6B D;  3F6H A;  1PJS A;  3KWR A;  4JV5 E;  4BMJ A;  2EE8 A;  4F9C B;  1TN9 A;  1Z1B A;  2YZT A;  4M2Z A;  2WBS A;  4LF7 E;  4M9V C;  4GZN C;  2GLI A;  4B3R E;  4DV4 E;  4JI2 E;  1GTK A;  4X9J A;  2EOI A;  2EM2 A;  4F2J C;  2F8B A;  4JI6 E;  4M30 A;  2ENA A;  3THN A;  1XNQ E;  4DR7 E;  2UXC E;  3EQ1 A;  3RMP A;  2JVA A;  2MC6 A;  4GKK E;  2PRT A;  4TUI A;  1WHQ A;  2EPN A;  2YTP A;  2JPA A;  3JTZ A;  1UIL A;  2R76 A;  5ADZ A;  4LF9 E;  2ENC A;  2LVH A;  1T39 A;  2YTD A;  4LFB E;  4AQY E;  2ADR A;  2MC5 A;  2CTD A;  4JI7 E;  1IQS A;  5KL4 A;  1A1L A;  2EOZ A;  3KZY A;  3J80 C;  4DR6 E;  1N3G A;  4YY3 E;  2UXB E;  4ZYG A;  1RQ0 A;  2L92 A;  2UXD E;  2EOM A;  1GQE A;  2EQ0 A;  2EPP A;  3ADJ A;  2JP9 A;  3IWC A;  2G7H A;  1IBM E;  5IXM B;  4MLV A;  4BHC A;  2NUF A;  2K4V A;  4JI8 E;  3THO B;  2V89 A;  3IWD A;  4DR5 E;  4WSP A;  1KYQ A;  1BBG A;  3KZZ A;  4R2E A;  2FV4 B;  2FTX B;  4YHH E;  1YZ9 A;  2EN1 A;  2L3C A;  2YU8 A;  4KWY A;  4B3T E;  1AAY A;  5KL6 A;  1FJG E;  2EOR A;  4DR2 E;  4WYQ B;  1X5W A;  1DI2 A;  2HHH E;  3C6M A;  1HNW E;  2DIX A;  3VK6 A;  3ADI A;  4DUY E;  2V83 A;  1X47 A;  4F54 A;  2EWL A;  2YRM A;  5AC5 A;  3MHS C;  1I94 E;  2EQ3 A;  1BBO A;  1YUI A;  2YTI A;  1X6E A;  1ZBT A;  4BBY A;  2ELZ A;  3J7A G;  1EH8 A;  2EQ1 A;  4WXC A;  2LUQ A;  2EM4 A;  2V87 A;  4BC9 A;  1T38 A;  1WHN A;  1A1J A;  3IWB A;  1EH7 A;  2LRS A;  2EN4 A;  4J8Z A;  4F9B B;  4HTG A;  3ADL A;  1WRJ A;  4DR3 E;  4KHP E;  2EZ6 A;  2EL5 A;  3HXL A;  2EMC A;  4R2R A;  4IJD A;  1PDA A;  1XNR E;  2EMG A;  2N8X A;  2VE7 C;  4BCA A;  4TUG A;  4MLQ A;  2JR1 A;  2EPX A;  1UHZ A;  1SFE A;  1B69 A;  2EL6 A;  2VQE E;  2EOY A;  4NXM E;  2M1S A;  4LF4 E;  4R8O A;  1TF3 A;  2NUG A;  1WJP A;  2LMZ A;  2V8Q B;  2RQL A;  4GEQ B;  5IT9 C;  2EOJ A;  1YYO A;  1LLM C;  4JI5 E;  4DV5 E;  2L2M A;  3LML A;  3HQ1 A;  3C4T A;  2EM3 A;  5LMU E;  5IWA E;  2DGC A;  4NXN E;  4X64 E;  4BC7 A;  4P7D A;  1X6F A;  4NZV A;  2VRD A;  2EMB A;  1P47 A;  1JK2 A;  3QG5 C;  4DR1 E;  2LCE A;  2EN3 A;  5CFF E;  4R2Q A;  2BB8 A;  1A1I A;  3MHH C;  2L33 A;  2RSM A;  2E5L E;  2EPA A;  1YYW A;  2VQF E;  2EOF A;  2YTE A;  4X62 E;  4ZYE A;  5A6J A;  2B7T A;  2RS6 A;  2DSY A;  3M99 B;  2LUP B;  2HGH A;  2GPI A;  2EMI A;  1FKA E;  2YSP A;  1T4L B;  2MKN A;  2F4V E;  2RPC A;  3BID A;  2IHR 1;  4X65 E;  2N3H A; 
#chains in the Genus database with same CATH homology
 4R2E A;  2EM6 A;  2EL4 A;  1X3C A;  2A25 A;  2EOO A;  2EN1 A;  5KL2 A;  2YU8 A;  2MKD A;  2EM5 A;  2EM0 A;  2EN2 A;  2EPC A;  5KL6 A;  5KL7 A;  1AAY A;  2YTO A;  2EOR A;  1YSA C;  2EOX A;  2NAB A;  2LO3 A;  1X5W A;  1A1F A;  2EM8 A;  2EN7 A;  2LV2 A;  2YTF A;  2DMI A;  2EMW A;  2YRM A;  2CT1 A;  1DGC A;  2YTJ A;  2MDG A;  3MHS C;  2EQ3 A;  2EPZ A;  2YTQ A;  1ZAA C;  1G2D C;  1KJK A;  1BBO A;  4R2D A;  1MEY C;  2YTI A;  2E72 A;  1X6E A;  5KL5 A;  4R2A A;  4F6M A;  1YUI A;  2ELZ A;  1TF6 A;  2EQ1 A;  2DRP A;  2EMZ A;  3EPK A;  2EMA A;  2EM4 A;  2EE8 A;  1TN9 A;  1UBD C;  1Z1B A;  2WBS A;  4M9V C;  2EMH A;  3EPJ A;  4GZN C;  2GLI A;  1A1J A;  2EMK A;  2EN4 A;  2RSI A;  2EMF A;  4X9J A;  2YRH A;  2EOI A;  1A1H A;  1A1K A;  2EM2 A;  4F2J C;  2EOQ A;  2EL5 A;  2EMC A;  4R2R A;  2ENA A;  1NCS A;  4IJD A;  2EPU A;  2LT7 A;  4WSG A;  2EMG A;  2D9H A;  2EP3 A;  2EPX A;  2PRT A;  2EN6 A;  1B69 A;  2EL6 A;  2YSO A;  1YUJ A;  2WCC 3;  2EOY A;  2YTG A;  2EOS A;  2YTP A;  2JPA A;  1TF3 A;  2I13 A;  1WJP A;  1UN6 B;  2EPR A;  2EOJ A;  1LLM C;  4R2P A;  1F2I G;  2EMY A;  4FK5 C;  2ENC A;  2LVH A;  2YRK A;  2YTD A;  2GHF A;  5KL3 A;  1RMD A;  2EML A;  3VHT B;  2ADR A;  2ELY A;  2EM3 A;  2WBU A;  2CTD A;  2CSH A;  2DGC A;  2EM9 A;  5KL4 A;  1A1L A;  2EOZ A;  2M9A A;  2EOH A;  2EM7 A;  1X6F A;  2YU5 A;  1BB8 A;  4F6N A;  2ENH A;  2EMX A;  2VRD A;  2EMB A;  2EOM A;  1P47 A;  1JK2 A;  2EQ0 A;  2EPP A;  2LCE A;  2EN3 A;  2JP9 A;  4R2Q A;  4R2C A;  2BB8 A;  2DLQ A;  2EOE A;  2EN8 A;  2WBT A;  1A1I A;  2EJ4 A;  1ZR9 A;  3MHH C;  3EPH A;  1X6H A;  2J7J A;  2EPA A;  2EOF A;  3EPL A;  1JK1 A;  2YTE A;  2YTN A;  2R1F A;  3M99 B;  2HGH A;  1G2F C;  2EMI A;  2YSP A;  2DLK A;  1A1G A;  2MKN A;  2RPC A;  1ZU1 A;  4R2S A;  4IS1 C;  3UK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...