2EMIA

Solution structure of the c2h2 type zinc finger (region 547-579) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERHYECSECGKAFIQKSTLSMHQRIHRGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 547-579) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emiA01
2JP9A 5KL6A 2YTFA 3MHSC 2EJ4A 2YRHA 2YU5A 4M9VC 2J7JA 4R2RA 2WBUA 1A1IA 2EMWA 2EP3A 2YU8A 2EPAA 2YSPA 1UN6B 1RMDA 2EM8A 1F2IG 2EMGA 2YTDA 1TF3A 2RSIA 4X9JA 4F2JC 2EN4A 4R2EA 2BB8A 2EMYA 3VHTB 4IJDA 2YTNA 1P47A 1ZU1A 1A1LA 2D9HA 1AAYA 4R2AA 1NCSA 1G2FC 2EM0A 5KL5A 2EL4A 2EMLA 2YTEA 1BBOA 2EOOA 2EOSA 2A25A 2ELZA 2EOYA 2EN8A 4F6NA 2EQ0A 2EPCA 1JK2A 1A1FA 2EM4A 2LO3A 2DRPA 5KL3A 2EMZA 2EPPA 2EM3A 4R2SA 2EOZA 2EM7A 2EOEA 2EMXA 2EMCA 2VRDA 1KJKA 1ZR9A 2ENCA 2RPCA 2EN1A 1A1HA 2LT7A 2YTQA 1WJPA 2EN7A 1LLMC 1MEYC 2EM6A 3EPHA 2EM5A 2EMHA 4WSGA 2ADRA 1JK1A 3EPKA 1G2DC 2HGHA 2MKDA 4R2QA 2EMIA 2YTPA 4FK5C 1A1JA 1X6EA 1BB8A 1YSAC 2EE8A 2EQ1A 2YTIA 1X5WA 4R2DA 2NABA 2R1FA 2LCEA 2CTDA 2EOQA 1DGCA 2YTOA 1YUIA 2PRTA 1Z1BA 2EOFA 2ENAA 2LVHA 2EPXA 1B69A 2EPRA 4IS1C 2YTJA 2YRMA 1TF6A 2DLQA 2EM2A 2EMAA 4GZNC 2EL6A 2EN6A 2EMBA 3UK3C 1X3CA 2I13A 2YRKA 2EOMA 2EOHA 3EPLA 2ELYA 2EN2A 3EPJA 2GLIA 1X6HA 2DMIA 2EL5A 2LV2A 2JPAA 2GHFA 1YUJA 1A1KA 5KL4A 2EM9A 2EOIA 2DGCA 2CSHA 2DLKA 2MKNA 2CT1A 1A1GA 2EQ3A 2WBTA 2MDGA 1TN9A 2YSOA 4F6MA 2WBSA 3M99B 2EMKA 2EOJA 5KL2A 4R2PA 1UBDC 1X6FA 4R2CA 2EOXA 2EPZA 2EN3A 2M9AA 3MHHC 2EPUA 5KL7A 2ENHA 2EORA 2WCC3 1ZAAC 2YTGA 2E72A 2EMFA
chains in the Genus database with same CATH superfamily
3MHSC 4LF9E 2G7HA 3OMLA 5LLQA 4M9VC 2J7JA 1RC7A 2R76A 1A1IA 5A6BD 2L6MA 5T6JA 2MC5A 2EP3A 2YU8A 4X64E 4NXNE 2YSPA 4JI7E 3VYYA 2HJJA 4RHBB 4DV1E 1HR0E 2YTDA 2RSIA 4F2JC 4X62E 4X8WA 4IJDA 5IXMB 4LF5E 2EWLA 2N3GA 2NUGA 1ZU1A 1A1LA 4DR2E 4NHRA 2M1SA 2JOXA 4KWYA 2EM0A 5KL5A 4BHBA 2UXBE 3FIGA 2EOSA 4F9AB 1EH7A 2EOYA 4F6NA 2EQ0A 1A1FA 1JK2A 1EKZA 3J81C 4TUIA 2LTSA 3KZZA 5LMUE 4R2SA 5A2QC 2EOEA 2VQFE 4Q35B 2E5LE 3DJWA 2ENCA 2EN1A 1LLMC 4JI4E 4LU9A 4WSGA 3THNA 2ADRA 2HGHA 2I9IA 2FV4B 2MKDA 2EMIA 2YTPA 4FK5C 4BC9A 2EE8A 2L92A 2YTIA 1IBME 4R2DA 3ADGA 1HNXE 2CTDA 2EPNA 1DGCA 4M0VA 1YUIA 4GEQB 2EPKX 1Z1BA 2L8TA 1XMQE 2DSYA 4YY3E 2EPRA 2JYAA 4WFTA 5A6AA 2DLQA 1EH8A 3IWBA 2EL6A 4DV6E 2EN6A 2EMBA 4K0KE 2HHHE 2JR1A 4DUYE 4JV5E 1X3CA 2EOMA 1WRJA 1SFEA 3ADIA 2GLIA 1MGTA 2DMIA 4B3TE 4WX9A 4LF7E 2GHFA 1HNZE 1YUJA 1A1KA 2DGCA 4JYAE 2V8QB 2ODRD 4ZYHA 4JI3E 4F9BB 1A1GA 2MDGA 4DV7E 2GPIA 1PJQA 2WBSA 1QNTA 1T4OA 2EOJA 3LLHA 4DR1E 2L2KB 4AQYE 2VF1A 1UBDC 4B3ME 2EOXA 2EPZA 2LRSA 3MHHC 5KL7A 4BHCA 1O0WA 2WCC3 4P78A 2LMZA 4YHHE 2YTGA 2E72A 4DV2E 4DR7E 2EJ4A 2YRHA 4O43A 2YU5A 4R2RA 2WBUA 2EMWA 1WHNA 2N3HA 3K6QA 3VK6A 4GKJE 4BCAA 2EPAA 5CFFE 3C4BA 2HC5A 1UN6B 5IT9C 3C4TA 2UXDE 1UHZA 4Q28A 2V83A 3BGHA 2ZM6E 1WHQA 4BBYA 2BB8A 4LFBE 1HNWE 1EH6A 2E1MA 3VHTB 2YTNA 2K4VA 1P47A 2V86A 3ADJA 1ZBTA 1ZBQA 2JOBA 1AAYA 1G2FC 3L00A 3TQMA 2FTXB 3RMPA 1BBOA 3F6GA 2IHR1 2LBSB 2Q8UA 4LFCE 2UU9E 5BR8E 2DRPA 2DB2A 2JY9A 2EMZA 3IWCA 2L3JA 4JI1E 2YZTA 2M7QA 2EPOA 3LMLA 4NXME 2EOZA 2N8XA 2RS7A 1PJTA 2YWQA 2NA2A 1KJKA 1SR9A 1FJGE 1MEYC 2LE2A 5A69A 4KHPE 2EM6A 3EPHA 1GZ6A 1JK1A 2ODRC 3MSWA 1BBGA 4X66E 1X6EA 1YSAC 2EQ1A 2B7TA 1KYQA 2V88A 4O5GA 2LCEA 2LVHA 4MLVA 2YTJA 2YRMA 1TF6A 2UXCE 1PKPA 2EM2A 4GZNC 2L2NA 2JXPA 2UUBE 5IWAE 4KZSA 4DR3E 1X49A 4DUZE 2I13A 4B3SE 4JI5E 2EOHA 1N32E 1AH5A 3EPJA 3VYXA 2LUPB 4LFAE 2LV2A 2RTXA 2EM9A 2CSHA 2CT1A 2EQ3A 2WBTA 3T1HE 1TN9A 2MC6A 4LF4E 2L33A 3M99B 3ADLA 2FGGA 4N4RB 4R2PA 1GQEA 2EN3A 2M9AA 3J7Yp 2B3TB 3OTOE 1N33E 2EMFA 2BBGA 5KL6A 2YTFA 2L2MA 3ZOQB 5DNYA 2M4IA 1IQSA 4R03A 1N36E 2B7VA 4O4KA 4ZYDA 2K7IA 5A6BA 2YPNA 2EM8A 1I94E 2EMGA 5AE1A 4R2EA 2LJHA 3F6HA 2KONA 4ZYGA 4DV3E 4R2AA 1XNRE 1IQOA 1YFHA 2EL4A 2VE7C 2EMLA 4LF6E 1GTKA 2F8BA 2ELZA 2EN8A 2EPCA 2LO3A 4WXDA 4JI2E 5KL3A 5AE2A 2EM3A 2DIXA 2EM7A 1YZ9A 2EMXA 2EMCA 1ZR9A 3HTXA 3T1YE 1T39A 2LT7A 2YTQA 2EN7A 1WXRA 4BC7A 3EPKA 1RQ0A 4WSPA 1A1JA 1BB8A 2RQLA 1X5WA 4NZVA 2LUQA 2R1FA 2YTOA 3HQ1A 5TSEA 1XMOE 1IBKE 4WXCA 2EOFA 2ENAA 2EPXA 1PDAA 2B9DA 4IS1C 2EMAA 1J26A 4LTYA 4TUGA 4F9CB 3UK3C 2EPLX 2NUFA 1T4NA 2YRKA 2EZ6A 2H36X 5IV8B 2UUCE 4MLQA 2JPAA 4WYQB 5KL4A 2EOIA 2DLKA 2DMYA 2MKNA 3JAMC 3JU0A 1UILA 2YSOA 3J7AG 2RS6A 2YT4A 2EMKA 3BF2A 4DMIA 5AE3A 3DF6A 1X6FA 4R2CA 2JWOA 4ZYEA 4OOGC 2ENHA 2EORA 2MDRA 1ZAAC 2NUEA 2JP9A 3BBGA 1YYOA 1N34E 3EQ1A 4I8OA 5AC5A 3HPZA 2L3CA 5A6JA 1YYKA 1RMDA 1F2IG 1TF3A 4X9JA 3QG5C 2EN4A 1IMUA 4M2ZA 2UUAE 2EMYA 3JTZA 4B3RE 3THOB 3HXLA 2V85A 3C6MA 2D9HA 4BS9A 4DR4E 1NCSA 2V87A 2JVAA 2WZOA 3J80C 4WPYA 4F54A 4DV5E 4OX9E 2RSMA 1X47A 2YTEA 3AV0A 1T4LB 2KHXA 2EOOA 2A25A 4HTGA 4BMJA 4HEIA 2EM4A 4JI8E 2EPPA 4P7DA 5AASA 4DR6E 2VRDA 4JI6E 4DR5E 2RPCA 4M30A 1A1HA 1WJPA 3BIDA 2EM5A 2EMHA 1G2DC 3IWDA 5A6KA 5F3WA 4R2QA 4L8NA 4DV0E 5FLXC 2LTRA 2NABA 1YYWA 1T38A 2EOQA 2PRTA 1L4SA 3ECRA 3C6KA 1B69A 1XNQE 1X48A 4DKKA 4GKKE 1YPNA 2LJUA 4DV4E 4L5NC 2EPMX 3P1XA 2F4VE 1QU6A 1J5EE 3EPLA 2ELYA 2EN2A 1IBLE 2VQEE 1X6HA 2V89A 2EL5A 1NEIA 5AC4A 3HPSA 1PJSA 2CPNA 5LMNE 1STUA 4F6MA 4R8OA 1FKAE 3KZYA 2KOUA 4J8ZA 3AUZA 5KL2A 1N3GA 4X65E 4LF8E 4O24A 2EPUA 5LL6R 3H09A 4RH8A 5ADZA 3KWRA 1DQ3A 1DI2A 4JI0E
chains in the Genus database with same CATH topology
2JP9A 5KL6A 2YTFA 3MHSC 2EJ4A 2YRHA 2YU5A 4M9VC 2J7JA 4R2RA 2WBUA 1A1IA 2EMWA 2EP3A 2YU8A 2EPAA 2YSPA 1UN6B 1RMDA 2EM8A 1F2IG 2EMGA 2YTDA 1TF3A 2RSIA 4X9JA 4F2JC 2EN4A 4R2EA 2BB8A 2EMYA 3VHTB 4IJDA 2YTNA 1P47A 1ZU1A 1A1LA 2D9HA 1AAYA 4R2AA 1NCSA 1G2FC 2EM0A 5KL5A 2EL4A 2EMLA 2YTEA 1BBOA 2EOOA 2EOSA 2A25A 2ELZA 2EOYA 2EN8A 4F6NA 2EQ0A 2EPCA 1JK2A 1A1FA 2EM4A 2LO3A 2DRPA 5KL3A 2EMZA 2EPPA 2EM3A 4R2SA 2EOZA 2EM7A 2EOEA 2EMXA 2EMCA 2VRDA 1KJKA 1ZR9A 2ENCA 2RPCA 2EN1A 1A1HA 2LT7A 2YTQA 1WJPA 2EN7A 1LLMC 1MEYC 2EM6A 3EPHA 2EM5A 2EMHA 4WSGA 2ADRA 1JK1A 3EPKA 1G2DC 2HGHA 2MKDA 4R2QA 2EMIA 2YTPA 4FK5C 1A1JA 1X6EA 1BB8A 1YSAC 2EE8A 2EQ1A 2YTIA 1X5WA 4R2DA 2NABA 2R1FA 2LCEA 2CTDA 2EOQA 1DGCA 2YTOA 1YUIA 2PRTA 1Z1BA 2EOFA 2ENAA 2LVHA 2EPXA 1B69A 2EPRA 4IS1C 2YTJA 2YRMA 1TF6A 2DLQA 2EM2A 2EMAA 4GZNC 2EL6A 2EN6A 2EMBA 3UK3C 1X3CA 2I13A 2YRKA 2EOMA 2EOHA 3EPLA 2ELYA 2EN2A 3EPJA 2GLIA 1X6HA 2DMIA 2EL5A 2LV2A 2JPAA 2GHFA 1YUJA 1A1KA 5KL4A 2EM9A 2EOIA 2DGCA 2CSHA 2DLKA 2MKNA 2CT1A 1A1GA 2EQ3A 2WBTA 2MDGA 1TN9A 2YSOA 4F6MA 2WBSA 3M99B 2EMKA 2EOJA 5KL2A 4R2PA 1UBDC 1X6FA 4R2CA 2EOXA 2EPZA 2EN3A 2M9AA 3MHHC 2EPUA 5KL7A 2ENHA 2EORA 2WCC3 1ZAAC 2YTGA 2E72A 2EMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP9 A;  5KL6 A;  2YTF A;  3MHS C;  2EJ4 A;  2YRH A;  2YU5 A;  4M9V C;  2J7J A;  4R2R A;  2WBU A;  1A1I A;  2EMW A;  2EP3 A;  2YU8 A;  2EPA A;  2YSP A;  1UN6 B;  1RMD A;  2EM8 A;  1F2I G;  2EMG A;  2YTD A;  1TF3 A;  2RSI A;  4X9J A;  4F2J C;  2EN4 A;  4R2E A;  2BB8 A;  2EMY A;  3VHT B;  4IJD A;  2YTN A;  1P47 A;  1ZU1 A;  1A1L A;  2D9H A;  1AAY A;  4R2A A;  1NCS A;  1G2F C;  2EM0 A;  5KL5 A;  2EL4 A;  2EML A;  2YTE A;  1BBO A;  2EOO A;  2EOS A;  2A25 A;  2ELZ A;  2EOY A;  2EN8 A;  4F6N A;  2EQ0 A;  2EPC A;  1JK2 A;  1A1F A;  2EM4 A;  2LO3 A;  2DRP A;  5KL3 A;  2EMZ A;  2EPP A;  2EM3 A;  4R2S A;  2EOZ A;  2EM7 A;  2EOE A;  2EMX A;  2EMC A;  2VRD A;  1KJK A;  1ZR9 A;  2ENC A;  2RPC A;  2EN1 A;  1A1H A;  2LT7 A;  2YTQ A;  1WJP A;  2EN7 A;  1LLM C;  1MEY C;  2EM6 A;  3EPH A;  2EM5 A;  2EMH A;  4WSG A;  2ADR A;  1JK1 A;  3EPK A;  1G2D C;  2HGH A;  2MKD A;  4R2Q A;  2EMI A;  2YTP A;  4FK5 C;  1A1J A;  1X6E A;  1BB8 A;  1YSA C;  2EE8 A;  2EQ1 A;  2YTI A;  1X5W A;  4R2D A;  2NAB A;  2R1F A;  2LCE A;  2CTD A;  2EOQ A;  1DGC A;  2YTO A;  1YUI A;  2PRT A;  1Z1B A;  2EOF A;  2ENA A;  2LVH A;  2EPX A;  1B69 A;  2EPR A;  4IS1 C;  2YTJ A;  2YRM A;  1TF6 A;  2DLQ A;  2EM2 A;  2EMA A;  4GZN C;  2EL6 A;  2EN6 A;  2EMB A;  3UK3 C;  1X3C A;  2I13 A;  2YRK A;  2EOM A;  2EOH A;  3EPL A;  2ELY A;  2EN2 A;  3EPJ A;  2GLI A;  1X6H A;  2DMI A;  2EL5 A;  2LV2 A;  2JPA A;  2GHF A;  1YUJ A;  1A1K A;  5KL4 A;  2EM9 A;  2EOI A;  2DGC A;  2CSH A;  2DLK A;  2MKN A;  2CT1 A;  1A1G A;  2EQ3 A;  2WBT A;  2MDG A;  1TN9 A;  2YSO A;  4F6M A;  2WBS A;  3M99 B;  2EMK A;  2EOJ A;  5KL2 A;  4R2P A;  1UBD C;  1X6F A;  4R2C A;  2EOX A;  2EPZ A;  2EN3 A;  2M9A A;  3MHH C;  2EPU A;  5KL7 A;  2ENH A;  2EOR A;  2WCC 3;  1ZAA C;  2YTG A;  2E72 A;  2EMF A; 
#chains in the Genus database with same CATH topology
 3MHS C;  4LF9 E;  2G7H A;  3OML A;  5LLQ A;  4M9V C;  2J7J A;  1RC7 A;  2R76 A;  1A1I A;  5A6B D;  2L6M A;  5T6J A;  2MC5 A;  2EP3 A;  2YU8 A;  4X64 E;  4NXN E;  2YSP A;  4JI7 E;  3VYY A;  2HJJ A;  4RHB B;  4DV1 E;  1HR0 E;  2YTD A;  2RSI A;  4F2J C;  4X62 E;  4X8W A;  4IJD A;  5IXM B;  4LF5 E;  2EWL A;  2N3G A;  2NUG A;  1ZU1 A;  1A1L A;  4DR2 E;  4NHR A;  2M1S A;  2JOX A;  4KWY A;  2EM0 A;  5KL5 A;  4BHB A;  2UXB E;  3FIG A;  2EOS A;  4F9A B;  1EH7 A;  2EOY A;  4F6N A;  2EQ0 A;  1A1F A;  1JK2 A;  1EKZ A;  3J81 C;  4TUI A;  2LTS A;  3KZZ A;  5LMU E;  4R2S A;  5A2Q C;  2EOE A;  2VQF E;  4Q35 B;  2E5L E;  3DJW A;  2ENC A;  2EN1 A;  1LLM C;  4JI4 E;  4LU9 A;  4WSG A;  3THN A;  2ADR A;  2HGH A;  2I9I A;  2FV4 B;  2MKD A;  2EMI A;  2YTP A;  4FK5 C;  4BC9 A;  2EE8 A;  2L92 A;  2YTI A;  1IBM E;  4R2D A;  3ADG A;  1HNX E;  2CTD A;  2EPN A;  1DGC A;  4M0V A;  1YUI A;  4GEQ B;  2EPK X;  1Z1B A;  2L8T A;  1XMQ E;  2DSY A;  4YY3 E;  2EPR A;  2JYA A;  4WFT A;  5A6A A;  2DLQ A;  1EH8 A;  3IWB A;  2EL6 A;  4DV6 E;  2EN6 A;  2EMB A;  4K0K E;  2HHH E;  2JR1 A;  4DUY E;  4JV5 E;  1X3C A;  2EOM A;  1WRJ A;  1SFE A;  3ADI A;  2GLI A;  1MGT A;  2DMI A;  4B3T E;  4WX9 A;  4LF7 E;  2GHF A;  1HNZ E;  1YUJ A;  1A1K A;  2DGC A;  4JYA E;  2V8Q B;  2ODR D;  4ZYH A;  4JI3 E;  4F9B B;  1A1G A;  2MDG A;  4DV7 E;  2GPI A;  1PJQ A;  2WBS A;  1QNT A;  1T4O A;  2EOJ A;  3LLH A;  4DR1 E;  2L2K B;  4AQY E;  2VF1 A;  1UBD C;  4B3M E;  2EOX A;  2EPZ A;  2LRS A;  3MHH C;  5KL7 A;  4BHC A;  1O0W A;  2WCC 3;  4P78 A;  2LMZ A;  4YHH E;  2YTG A;  2E72 A;  4DV2 E;  4DR7 E;  2EJ4 A;  2YRH A;  4O43 A;  2YU5 A;  4R2R A;  2WBU A;  2EMW A;  1WHN A;  2N3H A;  3K6Q A;  3VK6 A;  4GKJ E;  4BCA A;  2EPA A;  5CFF E;  3C4B A;  2HC5 A;  1UN6 B;  5IT9 C;  3C4T A;  2UXD E;  1UHZ A;  4Q28 A;  2V83 A;  3BGH A;  2ZM6 E;  1WHQ A;  4BBY A;  2BB8 A;  4LFB E;  1HNW E;  1EH6 A;  2E1M A;  3VHT B;  2YTN A;  2K4V A;  1P47 A;  2V86 A;  3ADJ A;  1ZBT A;  1ZBQ A;  2JOB A;  1AAY A;  1G2F C;  3L00 A;  3TQM A;  2FTX B;  3RMP A;  1BBO A;  3F6G A;  2IHR 1;  2LBS B;  2Q8U A;  4LFC E;  2UU9 E;  5BR8 E;  2DRP A;  2DB2 A;  2JY9 A;  2EMZ A;  3IWC A;  2L3J A;  4JI1 E;  2YZT A;  2M7Q A;  2EPO A;  3LML A;  4NXM E;  2EOZ A;  2N8X A;  2RS7 A;  1PJT A;  2YWQ A;  2NA2 A;  1KJK A;  1SR9 A;  1FJG E;  1MEY C;  2LE2 A;  5A69 A;  4KHP E;  2EM6 A;  3EPH A;  1GZ6 A;  1JK1 A;  2ODR C;  3MSW A;  1BBG A;  4X66 E;  1X6E A;  1YSA C;  2EQ1 A;  2B7T A;  1KYQ A;  2V88 A;  4O5G A;  2LCE A;  2LVH A;  4MLV A;  2YTJ A;  2YRM A;  1TF6 A;  2UXC E;  1PKP A;  2EM2 A;  4GZN C;  2L2N A;  2JXP A;  2UUB E;  5IWA E;  4KZS A;  4DR3 E;  1X49 A;  4DUZ E;  2I13 A;  4B3S E;  4JI5 E;  2EOH A;  1N32 E;  1AH5 A;  3EPJ A;  3VYX A;  2LUP B;  4LFA E;  2LV2 A;  2RTX A;  2EM9 A;  2CSH A;  2CT1 A;  2EQ3 A;  2WBT A;  3T1H E;  1TN9 A;  2MC6 A;  4LF4 E;  2L33 A;  3M99 B;  3ADL A;  2FGG A;  4N4R B;  4R2P A;  1GQE A;  2EN3 A;  2M9A A;  3J7Y p;  2B3T B;  3OTO E;  1N33 E;  2EMF A;  2BBG A;  5KL6 A;  2YTF A;  2L2M A;  3ZOQ B;  5DNY A;  2M4I A;  1IQS A;  4R03 A;  1N36 E;  2B7V A;  4O4K A;  4ZYD A;  2K7I A;  5A6B A;  2YPN A;  2EM8 A;  1I94 E;  2EMG A;  5AE1 A;  4R2E A;  2LJH A;  3F6H A;  2KON A;  4ZYG A;  4DV3 E;  4R2A A;  1XNR E;  1IQO A;  1YFH A;  2EL4 A;  2VE7 C;  2EML A;  4LF6 E;  1GTK A;  2F8B A;  2ELZ A;  2EN8 A;  2EPC A;  2LO3 A;  4WXD A;  4JI2 E;  5KL3 A;  5AE2 A;  2EM3 A;  2DIX A;  2EM7 A;  1YZ9 A;  2EMX A;  2EMC A;  1ZR9 A;  3HTX A;  3T1Y E;  1T39 A;  2LT7 A;  2YTQ A;  2EN7 A;  1WXR A;  4BC7 A;  3EPK A;  1RQ0 A;  4WSP A;  1A1J A;  1BB8 A;  2RQL A;  1X5W A;  4NZV A;  2LUQ A;  2R1F A;  2YTO A;  3HQ1 A;  5TSE A;  1XMO E;  1IBK E;  4WXC A;  2EOF A;  2ENA A;  2EPX A;  1PDA A;  2B9D A;  4IS1 C;  2EMA A;  1J26 A;  4LTY A;  4TUG A;  4F9C B;  3UK3 C;  2EPL X;  2NUF A;  1T4N A;  2YRK A;  2EZ6 A;  2H36 X;  5IV8 B;  2UUC E;  4MLQ A;  2JPA A;  4WYQ B;  5KL4 A;  2EOI A;  2DLK A;  2DMY A;  2MKN A;  3JAM C;  3JU0 A;  1UIL A;  2YSO A;  3J7A G;  2RS6 A;  2YT4 A;  2EMK A;  3BF2 A;  4DMI A;  5AE3 A;  3DF6 A;  1X6F A;  4R2C A;  2JWO A;  4ZYE A;  4OOG C;  2ENH A;  2EOR A;  2MDR A;  1ZAA C;  2NUE A;  2JP9 A;  3BBG A;  1YYO A;  1N34 E;  3EQ1 A;  4I8O A;  5AC5 A;  3HPZ A;  2L3C A;  5A6J A;  1YYK A;  1RMD A;  1F2I G;  1TF3 A;  4X9J A;  3QG5 C;  2EN4 A;  1IMU A;  4M2Z A;  2UUA E;  2EMY A;  3JTZ A;  4B3R E;  3THO B;  3HXL A;  2V85 A;  3C6M A;  2D9H A;  4BS9 A;  4DR4 E;  1NCS A;  2V87 A;  2JVA A;  2WZO A;  3J80 C;  4WPY A;  4F54 A;  4DV5 E;  4OX9 E;  2RSM A;  1X47 A;  2YTE A;  3AV0 A;  1T4L B;  2KHX A;  2EOO A;  2A25 A;  4HTG A;  4BMJ A;  4HEI A;  2EM4 A;  4JI8 E;  2EPP A;  4P7D A;  5AAS A;  4DR6 E;  2VRD A;  4JI6 E;  4DR5 E;  2RPC A;  4M30 A;  1A1H A;  1WJP A;  3BID A;  2EM5 A;  2EMH A;  1G2D C;  3IWD A;  5A6K A;  5F3W A;  4R2Q A;  4L8N A;  4DV0 E;  5FLX C;  2LTR A;  2NAB A;  1YYW A;  1T38 A;  2EOQ A;  2PRT A;  1L4S A;  3ECR A;  3C6K A;  1B69 A;  1XNQ E;  1X48 A;  4DKK A;  4GKK E;  1YPN A;  2LJU A;  4DV4 E;  4L5N C;  2EPM X;  3P1X A;  2F4V E;  1QU6 A;  1J5E E;  3EPL A;  2ELY A;  2EN2 A;  1IBL E;  2VQE E;  1X6H A;  2V89 A;  2EL5 A;  1NEI A;  5AC4 A;  3HPS A;  1PJS A;  2CPN A;  5LMN E;  1STU A;  4F6M A;  4R8O A;  1FKA E;  3KZY A;  2KOU A;  4J8Z A;  3AUZ A;  5KL2 A;  1N3G A;  4X65 E;  4LF8 E;  4O24 A;  2EPU A;  5LL6 R;  3H09 A;  4RH8 A;  5ADZ A;  3KWR A;  1DQ3 A;  1DI2 A;  4JI0 E; 
#chains in the Genus database with same CATH homology
 2JP9 A;  5KL6 A;  2YTF A;  3MHS C;  2EJ4 A;  2YRH A;  2YU5 A;  4M9V C;  2J7J A;  4R2R A;  2WBU A;  1A1I A;  2EMW A;  2EP3 A;  2YU8 A;  2EPA A;  2YSP A;  1UN6 B;  1RMD A;  2EM8 A;  1F2I G;  2EMG A;  2YTD A;  1TF3 A;  2RSI A;  4X9J A;  4F2J C;  2EN4 A;  4R2E A;  2BB8 A;  2EMY A;  3VHT B;  4IJD A;  2YTN A;  1P47 A;  1ZU1 A;  1A1L A;  2D9H A;  1AAY A;  4R2A A;  1NCS A;  1G2F C;  2EM0 A;  5KL5 A;  2EL4 A;  2EML A;  2YTE A;  1BBO A;  2EOO A;  2EOS A;  2A25 A;  2ELZ A;  2EOY A;  2EN8 A;  4F6N A;  2EQ0 A;  2EPC A;  1JK2 A;  1A1F A;  2EM4 A;  2LO3 A;  2DRP A;  5KL3 A;  2EMZ A;  2EPP A;  2EM3 A;  4R2S A;  2EOZ A;  2EM7 A;  2EOE A;  2EMX A;  2EMC A;  2VRD A;  1KJK A;  1ZR9 A;  2ENC A;  2RPC A;  2EN1 A;  1A1H A;  2LT7 A;  2YTQ A;  1WJP A;  2EN7 A;  1LLM C;  1MEY C;  2EM6 A;  3EPH A;  2EM5 A;  2EMH A;  4WSG A;  2ADR A;  1JK1 A;  3EPK A;  1G2D C;  2HGH A;  2MKD A;  4R2Q A;  2EMI A;  2YTP A;  4FK5 C;  1A1J A;  1X6E A;  1BB8 A;  1YSA C;  2EE8 A;  2EQ1 A;  2YTI A;  1X5W A;  4R2D A;  2NAB A;  2R1F A;  2LCE A;  2CTD A;  2EOQ A;  1DGC A;  2YTO A;  1YUI A;  2PRT A;  1Z1B A;  2EOF A;  2ENA A;  2LVH A;  2EPX A;  1B69 A;  2EPR A;  4IS1 C;  2YTJ A;  2YRM A;  1TF6 A;  2DLQ A;  2EM2 A;  2EMA A;  4GZN C;  2EL6 A;  2EN6 A;  2EMB A;  3UK3 C;  1X3C A;  2I13 A;  2YRK A;  2EOM A;  2EOH A;  3EPL A;  2ELY A;  2EN2 A;  3EPJ A;  2GLI A;  1X6H A;  2DMI A;  2EL5 A;  2LV2 A;  2JPA A;  2GHF A;  1YUJ A;  1A1K A;  5KL4 A;  2EM9 A;  2EOI A;  2DGC A;  2CSH A;  2DLK A;  2MKN A;  2CT1 A;  1A1G A;  2EQ3 A;  2WBT A;  2MDG A;  1TN9 A;  2YSO A;  4F6M A;  2WBS A;  3M99 B;  2EMK A;  2EOJ A;  5KL2 A;  4R2P A;  1UBD C;  1X6F A;  4R2C A;  2EOX A;  2EPZ A;  2EN3 A;  2M9A A;  3MHH C;  2EPU A;  5KL7 A;  2ENH A;  2EOR A;  2WCC 3;  1ZAA C;  2YTG A;  2E72 A;  2EMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...