2EMIA

Solution structure of the c2h2 type zinc finger (region 547-579) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERHYECSECGKAFIQKSTLSMHQRIHRGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 547-579) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emiA01
2EN3A 2EOQA 2YTPA 1B69A 1BBOA 1DGCA 2EOZA 2VRDA 2WBSA 2EMLA 1X3CA 2EORA 2LV2A 1YUJA 1A1GA 2YTIA 2RPCA 2EMBA 2EQ1A 2JPAA 2EMCA 2MDGA 1X6HA 1P47A 2EOMA 2EOFA 2M9AA 1X6EA 2EMAA 2MKNA 2EPUA 3VHTB 1AAYA 2LT7A 2EN4A 3UK3C 2NABA 1TN9A 1Z1BA 1ZAAC 2CSHA 2EN1A 2EOXA 4R2CA 2HGHA 2CT1A 1G2FC 2EM6A 2EMFA 5KL4A 2YTQA 2YU5A 2EOYA 1ZR9A 1UBDC 2EM4A 1A1FA 1RMDA 2EN7A 2A25A 2EMWA 2EM7A 2EOEA 4R2PA 1TF3A 4R2QA 2PRTA 2LCEA 4WSGA 1UN6B 5KL3A 2YTDA 2YTEA 2EMIA 2EM9A 4R2SA 4R2RA 2EE8A 2LO3A 2EM5A 2YTOA 2BB8A 2EPAA 4R2DA 1KJKA 5KL2A 2YRMA 2EQ0A 5KL7A 1YSAC 1A1HA 2EP3A 2MKDA 2I13A 2EMXA 2YSPA 3EPJA 1JK1A 2ENAA 4F2JC 2EQ3A 2GLIA 2EPRA 2EMZA 1X6FA 2EL6A 2WCC3 1JK2A 2ELYA 3MHHC 2RSIA 5KL6A 2EOHA 2YRHA 4GZNC 2EN8A 2EM0A 2EM8A 2EPXA 4F6NA 2DLQA 2EOJA 2DMIA 2EJ4A 2EPZA 1NCSA 2EOOA 1G2DC 4M9VC 4IJDA 4IS1C 2WBUA 2EL4A 1TF6A 1X5WA 4R2EA 5KL5A 2EMYA 2WBTA 2YSOA 1F2IG 1A1IA 2YRKA 4FK5C 2E72A 1A1KA 1A1LA 1LLMC 2DGCA 1WJPA 4X9JA 2EM2A 4R2AA 3EPHA 2YTJA 2DLKA 2GHFA 2R1FA 2EN2A 2EMKA 3MHSC 2YTNA 1ZU1A 2ENCA 2EOIA 2EPCA 1YUIA 2YTFA 2EPPA 2YTGA 3M99B 1BB8A 2CTDA 2DRPA 1MEYC 2YU8A 2LVHA 2ADRA 2ELZA 2EMGA 2D9HA 3EPLA 2JP9A 2EOSA 2ENHA 2EN6A 1A1JA 4F6MA 2J7JA 3EPKA 2EMHA 2EL5A 2EM3A
chains in the Genus database with same CATH superfamily
2EOQA 5DNYA 4LF4E 1I94E 2UUBE 1N33E 3ECRA 2LMZA 2V8QB 2EOZA 2VRDA 4LFAE 1A1GA 1YFHA 1KYQA 4BS9A 2RPCA 1XMOE 2JPAA 1X6HA 4KZSA 3C6MA 2JVAA 4LF9E 3HPSA 2MKNA 2EPUA 3VHTB 3VYYA 2EN4A 1TN9A 3ZOQB 3HXLA 1G2FC 2LBSB 2YTQA 2GPIA 5A6JA 2EOYA 2WZOA 2A25A 2JR1A 5BR8E 2EOEA 4R2PA 4O4KA 1UN6B 3BBGA 4WYQB 2EMIA 4OX9E 4R2SA 4GEQB 2LO3A 2EPAA 4BMJA 5A6AA 4WSPA 5IXMB 2F8BA 4JI7E 4BHCA 2EQ0A 5KL7A 3F6GA 2EP3A 2B3TB 2MKDA 4ZYEA 5AE2A 4DV1E 2YSPA 2LUQA 4F9BB 3EPJA 5IWAE 4WFTA 1O0WA 3IWBA 2EQ3A 1X6FA 1JK2A 3F6HA 5KL6A 4GZNC 4DR3E 3C4BA 2EM0A 1X48A 2B7VA 1PKPA 1DI2A 2DLQA 2UXDE 2DMIA 1YYOA 4GKKE 2UU9E 2ODRC 5T6JA 2LE2A 4ZYGA 2L2MA 4M9VC 4DKKA 1X5WA 5KL5A 1A1IA 4F9AB 4FK5C 1HNXE 4DV7E 1LLMC 1IQSA 3VYXA 2EM2A 1WHNA 3LMLA 4R2AA 1HNWE 4RHBB 2FGGA 1ZBTA 4P78A 4O43A 2L2NA 2EPCA 1N32E 5AE1A 2YTGA 3M99B 1BB8A 2DRPA 5FLXC 2KHXA 4DR5E 4R03A 2JP9A 2EOSA 2ENHA 2N3HA 1A1JA 5A69A 1QNTA 4ZYDA 2EN3A 4LF6E 5LLQA 4JI0E 1B69A 2MC6A 3P1XA 4AQYE 2KONA 4R8OA 1MGTA 1PJSA 1UILA 2EORA 1X49A 2B7TA 2YTIA 4HTGA 1XMQE 2LJHA 2EMBA 2JOBA 2MDGA 2H36X 2G7HA 2EOMA 2M9AA 2EMAA 2NUFA 2N8XA 2JYAA 1AAYA 2LT7A 3UK3C 2LUPB 1ZAAC 2EOXA 2CT1A 2MC5A 4LFBE 2EMFA 4JYAE 4HEIA 5IT9C 1ZR9A 2L2KB 1A1FA 1RMDA 2EM7A 1TF3A 2YPNA 4R2QA 4WSGA 1XNQE 2JOXA 4YHHE 3T1YE 2YTEA 1T39A 4R2RA 2EE8A 2YTOA 2UUAE 4ZYHA 1YYKA 2YRMA 1IBLE 4F54A 1T4OA 2EPNA 4K0KE 1JK1A 2ENAA 1WXRA 2EPRA 2ELYA 3ADJA 5AE3A 1N36E 2EOHA 2E1MA 4O24A 2IHR1 1YYWA 1IQOA 4M2ZA 2EPXA 4F6NA 1X47A 3C4TA 2E5LE 2L92A 4JV5E 1G2DC 1RQ0A 2FTXB 2CPNA 2N3GA 2EMYA 2DSYA 2EPOA 2WBTA 2YSOA 1F2IG 4LF7E 1WHQA 2E72A 2K4VA 1AH5A 4NHRA 2UXCE 2EPKX 4WX9A 3EPHA 2YTJA 2GHFA 2R1FA 3AUZA 2EMKA 2R76A 1GZ6A 2YTNA 2EOIA 2UXBE 2I9IA 1YUIA 4DUZE 1EKZA 5A6BA 2V88A 3ADGA 2CTDA 4JI3E 1MEYC 1PJTA 2VE7C 2NUGA 1WRJA 5CFFE 3LLHA 2EMGA 2YT4A 4F6MA 3H09A 2KOUA 4B3RE 3K6QA 2J7JA 4DR2E 3EPKA 4I8OA 2EWLA 2EM3A 1T4NA 2EPLX 2M7QA 2NA2A 2ODRD 2VF1A 4DMIA 2V86A 4LFCE 2V85A 3J7AG 1EH8A 4TUGA 1BBOA 3J80C 3BIDA 2WBSA 1J5EE 2EMLA 3MSWA 1X3CA 1YUJA 2ZM6E 1UHZA 2M4IA 3AV0A 3FIGA 1HNZE 3BGHA 4BHBA 3EQ1A 1IBME 1P47A 1T38A 4Q28A 5A6BD 4YY3E 4DV2E 2FV4B 1ZBQA 4BC9A 4TUIA 1Z1BA 2CSHA 1SR9A 2EN1A 2L8TA 4L8NA 5AC5A 2VQFE 4R2CA 1QU6A 2HGHA 3IWCA 2EM6A 1HR0E 4F9CB 2YU5A 1UBDC 2NUEA 2EM4A 4OOGC 3KZZA 3JU0A 2LJUA 2Q8UA 3THNA 1T4LB 3OTOE 2LCEA 1N34E 2LTRA 2EM5A 1YPNA 2BB8A 1KJKA 2L33A 2JWOA 4BC7A 5KL2A 5LMUE 4MLVA 1YSAC 3BF2A 2RS7A 2I13A 2EMXA 2LTSA 1BBGA 4F2JC 3JTZA 2WCC3 2EMZA 2EL6A 1SFEA 3DF6A 2RSIA 3C6KA 3J81C 2YRHA 1DQ3A 2EN8A 4JI6E 4NXNE 2MDRA 1NCSA 2EOOA 4JI4E 4IJDA 4IS1C 4DR6E 2EL4A 1TF6A 2YRKA 1A1LA 5AC4A 1WJPA 2DMYA 3HTXA 4MLQA 5A2QC 3T1HE 3KZYA 2B9DA 4X62E 1GQEA 5LMNE 1L4SA 2EPPA 4B3ME 2F4VE 2L3CA 4X8WA 2YU8A 2EPMX 1N3GA 2LVHA 2HHHE 4L5NC 2ELZA 4B3SE 2RS6A 4N4RB 4JI1E 2L6MA 2EN6A 1EH7A 4Q35B 4JI5E 1FJGE 2EMHA 4JI8E 1NEIA 3DJWA 2YTPA 4GKJE 3HPZA 4NZVA 2JXPA 4P7DA 2BBGA 1DGCA 2LV2A 4LF5E 1J26A 4DV4E 5ADZA 4DV3E 2M1SA 2EQ1A 2EMCA 4JI2E 4DUYE 5A6KA 3L00A 2DIXA 4DV6E 2V89A 2EOFA 4LTYA 4DR1E 1X6EA 4DV0E 1XNRE 2NABA 2YZTA 3QG5C 3ADLA 5KL4A 1PJQA 2EN7A 2EMWA 3RMPA 1GTKA 2PRTA 2DB2A 5KL3A 2YTDA 4X64E 2EM9A 4O5GA 4DV5E 2L3JA 3ADIA 4R2DA 4RH8A 1RC7A 3OMLA 4DR4E 3VK6A 1A1HA 4J8ZA 3J7Yp 1STUA 4X66E 2GLIA 4LF8E 4KWYA 3MHHC 5LL6R 1EH6A 1FKAE 2EM8A 3KWRA 4BBYA 2EOJA 2RQLA 5IV8B 2EJ4A 2EPZA 4LU9A 4WXDA 4WPYA 1PDAA 2K7IA 2WBUA 3JAMC 4R2EA 2V87A 1IMUA 1A1KA 4NXME 3IWDA 2DGCA 4BCAA 2RTXA 3THOB 4X9JA 2VQEE 5AASA 4X65E 4WXCA 2DLKA 3TQMA 2EN2A 3MHSC 1ZU1A 2ENCA 1YZ9A 3HQ1A 2YTFA 2UUCE 1IBKE 2LRSA 4DR7E 5F3WA 2YWQA 4KHPE 2HC5A 2RSMA 2HJJA 2ADRA 2EZ6A 2V83A 4M0VA 2D9HA 2JY9A 4M30A 3EPLA 5TSEA 4B3TE 2EL5A
chains in the Genus database with same CATH topology
2EN3A 2EOQA 2YTPA 1B69A 1BBOA 1DGCA 2EOZA 2VRDA 2WBSA 2EMLA 1X3CA 2EORA 2LV2A 1YUJA 1A1GA 2YTIA 2RPCA 2EMBA 2EQ1A 2JPAA 2EMCA 2MDGA 1X6HA 1P47A 2EOMA 2EOFA 2M9AA 1X6EA 2EMAA 2MKNA 2EPUA 3VHTB 1AAYA 2LT7A 2EN4A 3UK3C 2NABA 1TN9A 1Z1BA 1ZAAC 2CSHA 2EN1A 2EOXA 4R2CA 2HGHA 2CT1A 1G2FC 2EM6A 2EMFA 5KL4A 2YTQA 2YU5A 2EOYA 1ZR9A 1UBDC 2EM4A 1A1FA 1RMDA 2EN7A 2A25A 2EMWA 2EM7A 2EOEA 4R2PA 1TF3A 4R2QA 2PRTA 2LCEA 4WSGA 1UN6B 5KL3A 2YTDA 2YTEA 2EMIA 2EM9A 4R2SA 4R2RA 2EE8A 2LO3A 2EM5A 2YTOA 2BB8A 2EPAA 4R2DA 1KJKA 5KL2A 2YRMA 2EQ0A 5KL7A 1YSAC 1A1HA 2EP3A 2MKDA 2I13A 2EMXA 2YSPA 3EPJA 1JK1A 2ENAA 4F2JC 2EQ3A 2GLIA 2EPRA 2EMZA 1X6FA 2EL6A 2WCC3 1JK2A 2ELYA 3MHHC 2RSIA 5KL6A 2EOHA 2YRHA 4GZNC 2EN8A 2EM0A 2EM8A 2EPXA 4F6NA 2DLQA 2EOJA 2DMIA 2EJ4A 2EPZA 1NCSA 2EOOA 1G2DC 4M9VC 4IJDA 4IS1C 2WBUA 2EL4A 1TF6A 1X5WA 4R2EA 5KL5A 2EMYA 2WBTA 2YSOA 1F2IG 1A1IA 2YRKA 4FK5C 2E72A 1A1KA 1A1LA 1LLMC 2DGCA 1WJPA 4X9JA 2EM2A 4R2AA 3EPHA 2YTJA 2DLKA 2GHFA 2R1FA 2EN2A 2EMKA 3MHSC 2YTNA 1ZU1A 2ENCA 2EOIA 2EPCA 1YUIA 2YTFA 2EPPA 2YTGA 3M99B 1BB8A 2CTDA 2DRPA 1MEYC 2YU8A 2LVHA 2ADRA 2ELZA 2EMGA 2D9HA 3EPLA 2JP9A 2EOSA 2ENHA 2EN6A 1A1JA 4F6MA 2J7JA 3EPKA 2EMHA 2EL5A 2EM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN3 A;  2EOQ A;  2YTP A;  1B69 A;  1BBO A;  1DGC A;  2EOZ A;  2VRD A;  2WBS A;  2EML A;  1X3C A;  2EOR A;  2LV2 A;  1YUJ A;  1A1G A;  2YTI A;  2RPC A;  2EMB A;  2EQ1 A;  2JPA A;  2EMC A;  2MDG A;  1X6H A;  1P47 A;  2EOM A;  2EOF A;  2M9A A;  1X6E A;  2EMA A;  2MKN A;  2EPU A;  3VHT B;  1AAY A;  2LT7 A;  2EN4 A;  3UK3 C;  2NAB A;  1TN9 A;  1Z1B A;  1ZAA C;  2CSH A;  2EN1 A;  2EOX A;  4R2C A;  2HGH A;  2CT1 A;  1G2F C;  2EM6 A;  2EMF A;  5KL4 A;  2YTQ A;  2YU5 A;  2EOY A;  1ZR9 A;  1UBD C;  2EM4 A;  1A1F A;  1RMD A;  2EN7 A;  2A25 A;  2EMW A;  2EM7 A;  2EOE A;  4R2P A;  1TF3 A;  4R2Q A;  2PRT A;  2LCE A;  4WSG A;  1UN6 B;  5KL3 A;  2YTD A;  2YTE A;  2EMI A;  2EM9 A;  4R2S A;  4R2R A;  2EE8 A;  2LO3 A;  2EM5 A;  2YTO A;  2BB8 A;  2EPA A;  4R2D A;  1KJK A;  5KL2 A;  2YRM A;  2EQ0 A;  5KL7 A;  1YSA C;  1A1H A;  2EP3 A;  2MKD A;  2I13 A;  2EMX A;  2YSP A;  3EPJ A;  1JK1 A;  2ENA A;  4F2J C;  2EQ3 A;  2GLI A;  2EPR A;  2EMZ A;  1X6F A;  2EL6 A;  2WCC 3;  1JK2 A;  2ELY A;  3MHH C;  2RSI A;  5KL6 A;  2EOH A;  2YRH A;  4GZN C;  2EN8 A;  2EM0 A;  2EM8 A;  2EPX A;  4F6N A;  2DLQ A;  2EOJ A;  2DMI A;  2EJ4 A;  2EPZ A;  1NCS A;  2EOO A;  1G2D C;  4M9V C;  4IJD A;  4IS1 C;  2WBU A;  2EL4 A;  1TF6 A;  1X5W A;  4R2E A;  5KL5 A;  2EMY A;  2WBT A;  2YSO A;  1F2I G;  1A1I A;  2YRK A;  4FK5 C;  2E72 A;  1A1K A;  1A1L A;  1LLM C;  2DGC A;  1WJP A;  4X9J A;  2EM2 A;  4R2A A;  3EPH A;  2YTJ A;  2DLK A;  2GHF A;  2R1F A;  2EN2 A;  2EMK A;  3MHS C;  2YTN A;  1ZU1 A;  2ENC A;  2EOI A;  2EPC A;  1YUI A;  2YTF A;  2EPP A;  2YTG A;  3M99 B;  1BB8 A;  2CTD A;  2DRP A;  1MEY C;  2YU8 A;  2LVH A;  2ADR A;  2ELZ A;  2EMG A;  2D9H A;  3EPL A;  2JP9 A;  2EOS A;  2ENH A;  2EN6 A;  1A1J A;  4F6M A;  2J7J A;  3EPK A;  2EMH A;  2EL5 A;  2EM3 A; 
#chains in the Genus database with same CATH topology
 2EOQ A;  5DNY A;  4LF4 E;  1I94 E;  2UUB E;  1N33 E;  3ECR A;  2LMZ A;  2V8Q B;  2EOZ A;  2VRD A;  4LFA E;  1A1G A;  1YFH A;  1KYQ A;  4BS9 A;  2RPC A;  1XMO E;  2JPA A;  1X6H A;  4KZS A;  3C6M A;  2JVA A;  4LF9 E;  3HPS A;  2MKN A;  2EPU A;  3VHT B;  3VYY A;  2EN4 A;  1TN9 A;  3ZOQ B;  3HXL A;  1G2F C;  2LBS B;  2YTQ A;  2GPI A;  5A6J A;  2EOY A;  2WZO A;  2A25 A;  2JR1 A;  5BR8 E;  2EOE A;  4R2P A;  4O4K A;  1UN6 B;  3BBG A;  4WYQ B;  2EMI A;  4OX9 E;  4R2S A;  4GEQ B;  2LO3 A;  2EPA A;  4BMJ A;  5A6A A;  4WSP A;  5IXM B;  2F8B A;  4JI7 E;  4BHC A;  2EQ0 A;  5KL7 A;  3F6G A;  2EP3 A;  2B3T B;  2MKD A;  4ZYE A;  5AE2 A;  4DV1 E;  2YSP A;  2LUQ A;  4F9B B;  3EPJ A;  5IWA E;  4WFT A;  1O0W A;  3IWB A;  2EQ3 A;  1X6F A;  1JK2 A;  3F6H A;  5KL6 A;  4GZN C;  4DR3 E;  3C4B A;  2EM0 A;  1X48 A;  2B7V A;  1PKP A;  1DI2 A;  2DLQ A;  2UXD E;  2DMI A;  1YYO A;  4GKK E;  2UU9 E;  2ODR C;  5T6J A;  2LE2 A;  4ZYG A;  2L2M A;  4M9V C;  4DKK A;  1X5W A;  5KL5 A;  1A1I A;  4F9A B;  4FK5 C;  1HNX E;  4DV7 E;  1LLM C;  1IQS A;  3VYX A;  2EM2 A;  1WHN A;  3LML A;  4R2A A;  1HNW E;  4RHB B;  2FGG A;  1ZBT A;  4P78 A;  4O43 A;  2L2N A;  2EPC A;  1N32 E;  5AE1 A;  2YTG A;  3M99 B;  1BB8 A;  2DRP A;  5FLX C;  2KHX A;  4DR5 E;  4R03 A;  2JP9 A;  2EOS A;  2ENH A;  2N3H A;  1A1J A;  5A69 A;  1QNT A;  4ZYD A;  2EN3 A;  4LF6 E;  5LLQ A;  4JI0 E;  1B69 A;  2MC6 A;  3P1X A;  4AQY E;  2KON A;  4R8O A;  1MGT A;  1PJS A;  1UIL A;  2EOR A;  1X49 A;  2B7T A;  2YTI A;  4HTG A;  1XMQ E;  2LJH A;  2EMB A;  2JOB A;  2MDG A;  2H36 X;  2G7H A;  2EOM A;  2M9A A;  2EMA A;  2NUF A;  2N8X A;  2JYA A;  1AAY A;  2LT7 A;  3UK3 C;  2LUP B;  1ZAA C;  2EOX A;  2CT1 A;  2MC5 A;  4LFB E;  2EMF A;  4JYA E;  4HEI A;  5IT9 C;  1ZR9 A;  2L2K B;  1A1F A;  1RMD A;  2EM7 A;  1TF3 A;  2YPN A;  4R2Q A;  4WSG A;  1XNQ E;  2JOX A;  4YHH E;  3T1Y E;  2YTE A;  1T39 A;  4R2R A;  2EE8 A;  2YTO A;  2UUA E;  4ZYH A;  1YYK A;  2YRM A;  1IBL E;  4F54 A;  1T4O A;  2EPN A;  4K0K E;  1JK1 A;  2ENA A;  1WXR A;  2EPR A;  2ELY A;  3ADJ A;  5AE3 A;  1N36 E;  2EOH A;  2E1M A;  4O24 A;  2IHR 1;  1YYW A;  1IQO A;  4M2Z A;  2EPX A;  4F6N A;  1X47 A;  3C4T A;  2E5L E;  2L92 A;  4JV5 E;  1G2D C;  1RQ0 A;  2FTX B;  2CPN A;  2N3G A;  2EMY A;  2DSY A;  2EPO A;  2WBT A;  2YSO A;  1F2I G;  4LF7 E;  1WHQ A;  2E72 A;  2K4V A;  1AH5 A;  4NHR A;  2UXC E;  2EPK X;  4WX9 A;  3EPH A;  2YTJ A;  2GHF A;  2R1F A;  3AUZ A;  2EMK A;  2R76 A;  1GZ6 A;  2YTN A;  2EOI A;  2UXB E;  2I9I A;  1YUI A;  4DUZ E;  1EKZ A;  5A6B A;  2V88 A;  3ADG A;  2CTD A;  4JI3 E;  1MEY C;  1PJT A;  2VE7 C;  2NUG A;  1WRJ A;  5CFF E;  3LLH A;  2EMG A;  2YT4 A;  4F6M A;  3H09 A;  2KOU A;  4B3R E;  3K6Q A;  2J7J A;  4DR2 E;  3EPK A;  4I8O A;  2EWL A;  2EM3 A;  1T4N A;  2EPL X;  2M7Q A;  2NA2 A;  2ODR D;  2VF1 A;  4DMI A;  2V86 A;  4LFC E;  2V85 A;  3J7A G;  1EH8 A;  4TUG A;  1BBO A;  3J80 C;  3BID A;  2WBS A;  1J5E E;  2EML A;  3MSW A;  1X3C A;  1YUJ A;  2ZM6 E;  1UHZ A;  2M4I A;  3AV0 A;  3FIG A;  1HNZ E;  3BGH A;  4BHB A;  3EQ1 A;  1IBM E;  1P47 A;  1T38 A;  4Q28 A;  5A6B D;  4YY3 E;  4DV2 E;  2FV4 B;  1ZBQ A;  4BC9 A;  4TUI A;  1Z1B A;  2CSH A;  1SR9 A;  2EN1 A;  2L8T A;  4L8N A;  5AC5 A;  2VQF E;  4R2C A;  1QU6 A;  2HGH A;  3IWC A;  2EM6 A;  1HR0 E;  4F9C B;  2YU5 A;  1UBD C;  2NUE A;  2EM4 A;  4OOG C;  3KZZ A;  3JU0 A;  2LJU A;  2Q8U A;  3THN A;  1T4L B;  3OTO E;  2LCE A;  1N34 E;  2LTR A;  2EM5 A;  1YPN A;  2BB8 A;  1KJK A;  2L33 A;  2JWO A;  4BC7 A;  5KL2 A;  5LMU E;  4MLV A;  1YSA C;  3BF2 A;  2RS7 A;  2I13 A;  2EMX A;  2LTS A;  1BBG A;  4F2J C;  3JTZ A;  2WCC 3;  2EMZ A;  2EL6 A;  1SFE A;  3DF6 A;  2RSI A;  3C6K A;  3J81 C;  2YRH A;  1DQ3 A;  2EN8 A;  4JI6 E;  4NXN E;  2MDR A;  1NCS A;  2EOO A;  4JI4 E;  4IJD A;  4IS1 C;  4DR6 E;  2EL4 A;  1TF6 A;  2YRK A;  1A1L A;  5AC4 A;  1WJP A;  2DMY A;  3HTX A;  4MLQ A;  5A2Q C;  3T1H E;  3KZY A;  2B9D A;  4X62 E;  1GQE A;  5LMN E;  1L4S A;  2EPP A;  4B3M E;  2F4V E;  2L3C A;  4X8W A;  2YU8 A;  2EPM X;  1N3G A;  2LVH A;  2HHH E;  4L5N C;  2ELZ A;  4B3S E;  2RS6 A;  4N4R B;  4JI1 E;  2L6M A;  2EN6 A;  1EH7 A;  4Q35 B;  4JI5 E;  1FJG E;  2EMH A;  4JI8 E;  1NEI A;  3DJW A;  2YTP A;  4GKJ E;  3HPZ A;  4NZV A;  2JXP A;  4P7D A;  2BBG A;  1DGC A;  2LV2 A;  4LF5 E;  1J26 A;  4DV4 E;  5ADZ A;  4DV3 E;  2M1S A;  2EQ1 A;  2EMC A;  4JI2 E;  4DUY E;  5A6K A;  3L00 A;  2DIX A;  4DV6 E;  2V89 A;  2EOF A;  4LTY A;  4DR1 E;  1X6E A;  4DV0 E;  1XNR E;  2NAB A;  2YZT A;  3QG5 C;  3ADL A;  5KL4 A;  1PJQ A;  2EN7 A;  2EMW A;  3RMP A;  1GTK A;  2PRT A;  2DB2 A;  5KL3 A;  2YTD A;  4X64 E;  2EM9 A;  4O5G A;  4DV5 E;  2L3J A;  3ADI A;  4R2D A;  4RH8 A;  1RC7 A;  3OML A;  4DR4 E;  3VK6 A;  1A1H A;  4J8Z A;  3J7Y p;  1STU A;  4X66 E;  2GLI A;  4LF8 E;  4KWY A;  3MHH C;  5LL6 R;  1EH6 A;  1FKA E;  2EM8 A;  3KWR A;  4BBY A;  2EOJ A;  2RQL A;  5IV8 B;  2EJ4 A;  2EPZ A;  4LU9 A;  4WXD A;  4WPY A;  1PDA A;  2K7I A;  2WBU A;  3JAM C;  4R2E A;  2V87 A;  1IMU A;  1A1K A;  4NXM E;  3IWD A;  2DGC A;  4BCA A;  2RTX A;  3THO B;  4X9J A;  2VQE E;  5AAS A;  4X65 E;  4WXC A;  2DLK A;  3TQM A;  2EN2 A;  3MHS C;  1ZU1 A;  2ENC A;  1YZ9 A;  3HQ1 A;  2YTF A;  2UUC E;  1IBK E;  2LRS A;  4DR7 E;  5F3W A;  2YWQ A;  4KHP E;  2HC5 A;  2RSM A;  2HJJ A;  2ADR A;  2EZ6 A;  2V83 A;  4M0V A;  2D9H A;  2JY9 A;  4M30 A;  3EPL A;  5TSE A;  4B3T E;  2EL5 A; 
#chains in the Genus database with same CATH homology
 2EN3 A;  2EOQ A;  2YTP A;  1B69 A;  1BBO A;  1DGC A;  2EOZ A;  2VRD A;  2WBS A;  2EML A;  1X3C A;  2EOR A;  2LV2 A;  1YUJ A;  1A1G A;  2YTI A;  2RPC A;  2EMB A;  2EQ1 A;  2JPA A;  2EMC A;  2MDG A;  1X6H A;  1P47 A;  2EOM A;  2EOF A;  2M9A A;  1X6E A;  2EMA A;  2MKN A;  2EPU A;  3VHT B;  1AAY A;  2LT7 A;  2EN4 A;  3UK3 C;  2NAB A;  1TN9 A;  1Z1B A;  1ZAA C;  2CSH A;  2EN1 A;  2EOX A;  4R2C A;  2HGH A;  2CT1 A;  1G2F C;  2EM6 A;  2EMF A;  5KL4 A;  2YTQ A;  2YU5 A;  2EOY A;  1ZR9 A;  1UBD C;  2EM4 A;  1A1F A;  1RMD A;  2EN7 A;  2A25 A;  2EMW A;  2EM7 A;  2EOE A;  4R2P A;  1TF3 A;  4R2Q A;  2PRT A;  2LCE A;  4WSG A;  1UN6 B;  5KL3 A;  2YTD A;  2YTE A;  2EMI A;  2EM9 A;  4R2S A;  4R2R A;  2EE8 A;  2LO3 A;  2EM5 A;  2YTO A;  2BB8 A;  2EPA A;  4R2D A;  1KJK A;  5KL2 A;  2YRM A;  2EQ0 A;  5KL7 A;  1YSA C;  1A1H A;  2EP3 A;  2MKD A;  2I13 A;  2EMX A;  2YSP A;  3EPJ A;  1JK1 A;  2ENA A;  4F2J C;  2EQ3 A;  2GLI A;  2EPR A;  2EMZ A;  1X6F A;  2EL6 A;  2WCC 3;  1JK2 A;  2ELY A;  3MHH C;  2RSI A;  5KL6 A;  2EOH A;  2YRH A;  4GZN C;  2EN8 A;  2EM0 A;  2EM8 A;  2EPX A;  4F6N A;  2DLQ A;  2EOJ A;  2DMI A;  2EJ4 A;  2EPZ A;  1NCS A;  2EOO A;  1G2D C;  4M9V C;  4IJD A;  4IS1 C;  2WBU A;  2EL4 A;  1TF6 A;  1X5W A;  4R2E A;  5KL5 A;  2EMY A;  2WBT A;  2YSO A;  1F2I G;  1A1I A;  2YRK A;  4FK5 C;  2E72 A;  1A1K A;  1A1L A;  1LLM C;  2DGC A;  1WJP A;  4X9J A;  2EM2 A;  4R2A A;  3EPH A;  2YTJ A;  2DLK A;  2GHF A;  2R1F A;  2EN2 A;  2EMK A;  3MHS C;  2YTN A;  1ZU1 A;  2ENC A;  2EOI A;  2EPC A;  1YUI A;  2YTF A;  2EPP A;  2YTG A;  3M99 B;  1BB8 A;  2CTD A;  2DRP A;  1MEY C;  2YU8 A;  2LVH A;  2ADR A;  2ELZ A;  2EMG A;  2D9H A;  3EPL A;  2JP9 A;  2EOS A;  2ENH A;  2EN6 A;  1A1J A;  4F6M A;  2J7J A;  3EPK A;  2EMH A;  2EL5 A;  2EM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...