2EMIA

Solution structure of the c2h2 type zinc finger (region 547-579) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERHYECSECGKAFIQKSTLSMHQRIHRGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 547-579) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 484
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emiA01
3EPJA 2EOQA 5KL6A 1A1HA 2DLKA 1WJPA 1BBOA 5KL4A 4R2QA 3UK3C 5KL2A 2ELZA 2EOIA 2ENAA 2YTFA 2YTEA 2EN6A 2VRDA 2YU5A 1UN6B 4R2CA 1JK2A 2DMIA 2EMBA 2EL6A 2EOFA 1B69A 2EOEA 2CT1A 2ENCA 2J7JA 2YTPA 2EMIA 2EPCA 3EPLA 1G2DC 1A1FA 2LCEA 2R1FA 2YTQA 2EOMA 3EPKA 2EOJA 1X6FA 2EMCA 1G2FC 2ADRA 2YTDA 1Z1BA 2DGCA 2EOZA 1BB8A 2WBUA 2EN7A 2BB8A 2ELYA 4IJDA 2EPXA 2WCC3 1A1KA 1YUJA 2LO3A 2EM9A 2PRTA 2EN2A 2EMAA 2EMGA 2GLIA 2EOXA 1X6HA 2EQ3A 2EN3A 1A1GA 2EPZA 2EMHA 2EP3A 2EM2A 2EPRA 1KJKA 2JP9A 2EMXA 2EM5A 4R2RA 2EPUA 3EPHA 1YUIA 4GZNC 2I13A 2EORA 2A25A 2EM6A 3M99B 5KL3A 2EJ4A 2YTGA 2EM3A 1LLMC 4R2SA 2WBTA 4FK5C 5KL5A 2NABA 2EOHA 2EN4A 4IS1C 1DGCA 1UBDC 2YTIA 2EQ0A 2WBSA 2EE8A 1MEYC 4R2DA 1TN9A 2EMKA 1ZU1A 2EOYA 1AAYA 2LVHA 2EM4A 4WSGA 3VHTB 2EMZA 2DLQA 1X6EA 2M9AA 2RSIA 1A1IA 1JK1A 2YTNA 1TF6A 2EM8A 1YSAC 2MDGA 2EN8A 4F6MA 2EQ1A 2YSPA 1ZR9A 1F2IG 2YRKA 1TF3A 2CSHA 2EL4A 1X3CA 2EMYA 2YTJA 2LT7A 2EL5A 2EMLA 4F2JC 5KL7A 2YRHA 2JPAA 1X5WA 3MHHC 2EOOA 2ENHA 2MKDA 1ZAAC 2EPAA 2YRMA 2DRPA 4R2PA 2EMFA 2D9HA 4X9JA 2LV2A 2YSOA 1NCSA 2EPPA 4M9VC 2RPCA 3MHSC 1RMDA 2EM7A 2EM0A 2EN1A 2GHFA 2YU8A 4F6NA 2HGHA 2EMWA 4R2EA 1A1LA 2EOSA 2YTOA 2MKNA 2CTDA 2E72A 1A1JA 1P47A 4R2AA
chains in the Genus database with same CATH superfamily
3EPJA 2B7VA 4JI3E 1BBGA 2EOQA 3FIGA 4MLQA 4BBYA 1A1HA 1DQ3A 2DLKA 1UHZA 5KL4A 3T1HE 2ELZA 3HXLA 3JAMC 3T1YE 3KZZA 2YU5A 4DV3E 4WXCA 1B69A 3HTXA 1EH6A 2YT4A 4JV5E 2UXDE 3AUZA 1YYWA 2YTQA 2M7QA 2EOMA 3EPKA 3RMPA 4TUGA 1G2FC 4BMJA 3BGHA 2WBUA 2EPLX 2BB8A 1WRJA 2EM9A 4WYQB 2EN2A 4B3ME 2KHXA 2RSMA 2LTRA 4F9AB 4JI0E 3ADGA 2H36X 4GEQB 2EPNA 5AASA 4WSPA 5KL3A 5TSEA 1LLMC 2N3GA 3MSWA 2WBTA 5IT9C 5KL5A 2NABA 4LF8E 4IS1C 4AQYE 2EQ0A 4KZSA 4R2DA 1TN9A 4DUZE 1ZU1A 3C4TA 1AAYA 2HHHE 1X47A 5IV8B 4WSGA 2BBGA 2JOXA 1NEIA 4HTGA 5LMNE 2DB2A 2YTNA 4JI8E 1TF6A 3H09A 2KOUA 2UUAE 1ZBTA 4NHRA 5AE2A 2CSHA 2EMYA 2EL5A 2B3TB 2VQFE 4J8ZA 4R03A 3J81C 2UXBE 3KWRA 3THNA 1WHQA 2EOOA 2FGGA 2MDRA 4X62E 2L2KB 1FJGE 4DR6E 1ZBQA 4DV0E 4DV2E 2V88A 1RMDA 2EM0A 2B9DA 2GHFA 2YU8A 4JYAE 4R2EA 2LJUA 2LMZA 4DV5E 4JI2E 4BS9A 4JI7E 1A1JA 2G7HA 4DR1E 3IWDA 2F8BA 5BR8E 3OTOE 1T4OA 4RHBB 2VE7C 1X48A 2EOIA 2ENAA 2LUPB 3P1XA 3F6HA 1PDAA 4R2CA 4Q28A 1JK2A 2DMYA 2WZOA 2VF1A 1PJSA 2EOFA 2E1MA 3J7Yp 2EMIA 2EPCA 3EPLA 1GQEA 2VQEE 2V86A 3JU0A 4GKJE 4JI1E 1X6FA 3BBGA 4O4KA 2EMCA 2ADRA 2YTDA 1Z1BA 2L3CA 1N3GA 2DGCA 4LF4E 2EOZA 1IQOA 1BB8A 4JI6E 3ZOQB 2WCC3 2LO3A 2EMGA 2EWLA 1KYQA 2LJHA 2V83A 1A1GA 2RQLA 2EPRA 2EMXA 1YUIA 2IHR1 2EM6A 3M99B 2B7TA 2F4VE 3EQ1A 5ADZA 2CPNA 4O24A 5A6BA 4X8WA 2EN4A 2JXPA 1UBDC 4GKKE 2LTSA 4L5NC 2WBSA 4DR4E 5CFFE 1MEYC 4LFAE 2EPOA 4WFTA 1EKZA 3LLHA 1HR0E 1XNQE 3VK6A 4O5GA 3J80C 2N8XA 2L92A 5T6JA 4O43A 1EH7A 4X64E 1A1IA 5AC4A 2EN8A 2YSPA 1ZR9A 5A6AA 3IWBA 1T38A 1TF3A 2YZTA 2DIXA 1RC7A 1X3CA 3QG5C 4LTYA 2LT7A 1UILA 4X65E 1XNRE 4F2JC 4L8NA 2YRHA 3TQMA 2JPAA 3MHHC 1X5WA 3BIDA 3F6GA 2HJJA 1IBKE 1IMUA 4DV7E 4R2PA 3HQ1A 2D9HA 4NXNE 2LV2A 1GTKA 4OOGC 2LBSB 1SFEA 1N34E 3THOB 2RPCA 3MHSC 2EN1A 4X66E 2HGHA 2EMWA 4BHCA 2EOSA 2YTOA 1YPNA 2MKNA 2L6MA 2LRSA 1P47A 2MC6A 4DV4E 5IWAE 1N32E 4R2QA 3C6KA 2YTFA 2YTEA 1XMOE 4DR2E 2EN6A 2VRDA 1UN6B 2N3HA 1HNZE 2DMIA 2LE2A 2EL6A 2CT1A 2J7JA 2YTPA 3HPSA 5A6KA 1YFHA 1SR9A 2EPKX 2L2NA 2R1FA 2YPNA 4DR7E 2ZM6E 4F54A 2EOJA 2NA2A 1WXRA 2ELYA 4IJDA 2EPXA 1YUJA 2RS6A 2PRTA 2EMAA 2K7IA 5LMUE 2GLIA 2ODRC 5A6JA 1QNTA 4F9CB 4JI5E 2MC5A 2EPZA 2EP3A 1STUA 2EM2A 1KJKA 1HNWE 2JP9A 1WHNA 2EM5A 4M30A 4R2RA 2EPUA 4GZNC 4BCAA 2EORA 5AE3A 4NXME 2EJ4A 2EM3A 3DF6A 4R2SA 4LF7E 2RS7A 5AE1A 3K6QA 4FK5C 4DV6E 4DR3E 1DGCA 4HEIA 4M2ZA 2YTIA 1N36E 3ADLA 4LF5E 4Q35B 2EOYA 2UUBE 3C6MA 2EM4A 2UUCE 2EMZA 1PJQA 2EZ6A 2DLQA 2M9AA 1O0WA 1HNXE 1X49A 1FKAE 2L2MA 1EH8A 2EM8A 2MDGA 4B3TE 4DUYE 2JY9A 1T4LB 2YRKA 2Q8UA 2EL4A 5DNYA 2YTJA 2UU9E 4WPYA 4LF9E 2L33A 2EMLA 2L3JA 4DR5E 4P7DA 2ENHA 2MKDA 4ZYEA 5F3WA 5A69A 2E5LE 1PJTA 3JTZA 5LLQA 2JWOA 4OX9E 4LU9A 4TUIA 4X9JA 2HC5A 4MLVA 1N33E 4WX9A 4NZVA 3LMLA 4F6NA 1A1LA 4R8OA 2CTDA 4BHBA 2K4VA 2E72A 1PKPA 4R2AA 3ADJA 3HPZA 1IBLE 2JR1A 5KL6A 1WJPA 1BBOA 2M4IA 5KL2A 3UK3C 2R76A 3L00A 3C4BA 4DKKA 4LF6E 5LL6R 4JI4E 2NUGA 2EMBA 1T4NA 2KONA 4B3SE 2EOEA 2ENCA 1G2DC 4ZYGA 1A1FA 2LCEA 2L8TA 1MGTA 2V85A 4M0VA 2JOBA 5IXMB 1IBME 4I8OA 2LUQA 4ZYHA 1QU6A 4LFBE 2EN7A 2FTXB 1A1KA 2V89A 1J26A 2EOXA 1X6HA 2EQ3A 3IWCA 2NUEA 2YWQA 2EN3A 2EMHA 2GPIA 3OMLA 1IQSA 5AC5A 3EPHA 2I13A 3KZYA 2A25A 2YTGA 1YYKA 2NUFA 4LFCE 2EOHA 1J5EE 2EE8A 2RTXA 3BF2A 5A2QC 2EMKA 5FLXC 3J7AG 2M1SA 2LVHA 2I9IA 2ODRD 3VHTB 2FV4B 2V87A 1RQ0A 4KHPE 1X6EA 1GZ6A 2RSIA 1JK1A 1L4SA 4BC9A 1YSAC 4F6MA 2EQ1A 1XMQE 1F2IG 4DMIA 4WXDA 1YYOA 3VYXA 2UXCE 2DSYA 2JYAA 3AV0A 4N4RB 1DI2A 5KL7A 4F9BB 4K0KE 1ZAAC 2JVAA 2EPAA 3ADIA 2YRMA 2DRPA 1YZ9A 2EMFA 4P78A 2YSOA 4YHHE 1NCSA 2EPPA 4KWYA 4M9VC 4YY3E 3VYYA 2V8QB 2EM7A 2EPMX 1I94E 4DV1E 4ZYDA 5A6BD 4BC7A 3DJWA 4RH8A 1T39A 4B3RE 3ECRA 1AH5A
chains in the Genus database with same CATH topology
3EPJA 2EOQA 5KL6A 1A1HA 2DLKA 1WJPA 1BBOA 5KL4A 4R2QA 3UK3C 5KL2A 2ELZA 2EOIA 2ENAA 2YTFA 2YTEA 2EN6A 2VRDA 2YU5A 1UN6B 4R2CA 1JK2A 2DMIA 2EMBA 2EL6A 2EOFA 1B69A 2EOEA 2CT1A 2ENCA 2J7JA 2YTPA 2EMIA 2EPCA 3EPLA 1G2DC 1A1FA 2LCEA 2R1FA 2YTQA 2EOMA 3EPKA 2EOJA 1X6FA 2EMCA 1G2FC 2ADRA 2YTDA 1Z1BA 2DGCA 2EOZA 1BB8A 2WBUA 2EN7A 2BB8A 2ELYA 4IJDA 2EPXA 2WCC3 1A1KA 1YUJA 2LO3A 2EM9A 2PRTA 2EN2A 2EMAA 2EMGA 2GLIA 2EOXA 1X6HA 2EQ3A 2EN3A 1A1GA 2EPZA 2EMHA 2EP3A 2EM2A 2EPRA 1KJKA 2JP9A 2EMXA 2EM5A 4R2RA 2EPUA 3EPHA 1YUIA 4GZNC 2I13A 2EORA 2A25A 2EM6A 3M99B 5KL3A 2EJ4A 2YTGA 2EM3A 1LLMC 4R2SA 2WBTA 4FK5C 5KL5A 2NABA 2EOHA 2EN4A 4IS1C 1DGCA 1UBDC 2YTIA 2EQ0A 2WBSA 2EE8A 1MEYC 4R2DA 1TN9A 2EMKA 1ZU1A 2EOYA 1AAYA 2LVHA 2EM4A 4WSGA 3VHTB 2EMZA 2DLQA 1X6EA 2M9AA 2RSIA 1A1IA 1JK1A 2YTNA 1TF6A 2EM8A 1YSAC 2MDGA 2EN8A 4F6MA 2EQ1A 2YSPA 1ZR9A 1F2IG 2YRKA 1TF3A 2CSHA 2EL4A 1X3CA 2EMYA 2YTJA 2LT7A 2EL5A 2EMLA 4F2JC 5KL7A 2YRHA 2JPAA 1X5WA 3MHHC 2EOOA 2ENHA 2MKDA 1ZAAC 2EPAA 2YRMA 2DRPA 4R2PA 2EMFA 2D9HA 4X9JA 2LV2A 2YSOA 1NCSA 2EPPA 4M9VC 2RPCA 3MHSC 1RMDA 2EM7A 2EM0A 2EN1A 2GHFA 2YU8A 4F6NA 2HGHA 2EMWA 4R2EA 1A1LA 2EOSA 2YTOA 2MKNA 2CTDA 2E72A 1A1JA 1P47A 4R2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPJ A;  2EOQ A;  5KL6 A;  1A1H A;  2DLK A;  1WJP A;  1BBO A;  5KL4 A;  4R2Q A;  3UK3 C;  5KL2 A;  2ELZ A;  2EOI A;  2ENA A;  2YTF A;  2YTE A;  2EN6 A;  2VRD A;  2YU5 A;  1UN6 B;  4R2C A;  1JK2 A;  2DMI A;  2EMB A;  2EL6 A;  2EOF A;  1B69 A;  2EOE A;  2CT1 A;  2ENC A;  2J7J A;  2YTP A;  2EMI A;  2EPC A;  3EPL A;  1G2D C;  1A1F A;  2LCE A;  2R1F A;  2YTQ A;  2EOM A;  3EPK A;  2EOJ A;  1X6F A;  2EMC A;  1G2F C;  2ADR A;  2YTD A;  1Z1B A;  2DGC A;  2EOZ A;  1BB8 A;  2WBU A;  2EN7 A;  2BB8 A;  2ELY A;  4IJD A;  2EPX A;  2WCC 3;  1A1K A;  1YUJ A;  2LO3 A;  2EM9 A;  2PRT A;  2EN2 A;  2EMA A;  2EMG A;  2GLI A;  2EOX A;  1X6H A;  2EQ3 A;  2EN3 A;  1A1G A;  2EPZ A;  2EMH A;  2EP3 A;  2EM2 A;  2EPR A;  1KJK A;  2JP9 A;  2EMX A;  2EM5 A;  4R2R A;  2EPU A;  3EPH A;  1YUI A;  4GZN C;  2I13 A;  2EOR A;  2A25 A;  2EM6 A;  3M99 B;  5KL3 A;  2EJ4 A;  2YTG A;  2EM3 A;  1LLM C;  4R2S A;  2WBT A;  4FK5 C;  5KL5 A;  2NAB A;  2EOH A;  2EN4 A;  4IS1 C;  1DGC A;  1UBD C;  2YTI A;  2EQ0 A;  2WBS A;  2EE8 A;  1MEY C;  4R2D A;  1TN9 A;  2EMK A;  1ZU1 A;  2EOY A;  1AAY A;  2LVH A;  2EM4 A;  4WSG A;  3VHT B;  2EMZ A;  2DLQ A;  1X6E A;  2M9A A;  2RSI A;  1A1I A;  1JK1 A;  2YTN A;  1TF6 A;  2EM8 A;  1YSA C;  2MDG A;  2EN8 A;  4F6M A;  2EQ1 A;  2YSP A;  1ZR9 A;  1F2I G;  2YRK A;  1TF3 A;  2CSH A;  2EL4 A;  1X3C A;  2EMY A;  2YTJ A;  2LT7 A;  2EL5 A;  2EML A;  4F2J C;  5KL7 A;  2YRH A;  2JPA A;  1X5W A;  3MHH C;  2EOO A;  2ENH A;  2MKD A;  1ZAA C;  2EPA A;  2YRM A;  2DRP A;  4R2P A;  2EMF A;  2D9H A;  4X9J A;  2LV2 A;  2YSO A;  1NCS A;  2EPP A;  4M9V C;  2RPC A;  3MHS C;  1RMD A;  2EM7 A;  2EM0 A;  2EN1 A;  2GHF A;  2YU8 A;  4F6N A;  2HGH A;  2EMW A;  4R2E A;  1A1L A;  2EOS A;  2YTO A;  2MKN A;  2CTD A;  2E72 A;  1A1J A;  1P47 A;  4R2A A; 
#chains in the Genus database with same CATH topology
 3EPJ A;  2B7V A;  4JI3 E;  1BBG A;  2EOQ A;  3FIG A;  4MLQ A;  4BBY A;  1A1H A;  1DQ3 A;  2DLK A;  1UHZ A;  5KL4 A;  3T1H E;  2ELZ A;  3HXL A;  3JAM C;  3T1Y E;  3KZZ A;  2YU5 A;  4DV3 E;  4WXC A;  1B69 A;  3HTX A;  1EH6 A;  2YT4 A;  4JV5 E;  2UXD E;  3AUZ A;  1YYW A;  2YTQ A;  2M7Q A;  2EOM A;  3EPK A;  3RMP A;  4TUG A;  1G2F C;  4BMJ A;  3BGH A;  2WBU A;  2EPL X;  2BB8 A;  1WRJ A;  2EM9 A;  4WYQ B;  2EN2 A;  4B3M E;  2KHX A;  2RSM A;  2LTR A;  4F9A B;  4JI0 E;  3ADG A;  2H36 X;  4GEQ B;  2EPN A;  5AAS A;  4WSP A;  5KL3 A;  5TSE A;  1LLM C;  2N3G A;  3MSW A;  2WBT A;  5IT9 C;  5KL5 A;  2NAB A;  4LF8 E;  4IS1 C;  4AQY E;  2EQ0 A;  4KZS A;  4R2D A;  1TN9 A;  4DUZ E;  1ZU1 A;  3C4T A;  1AAY A;  2HHH E;  1X47 A;  5IV8 B;  4WSG A;  2BBG A;  2JOX A;  1NEI A;  4HTG A;  5LMN E;  2DB2 A;  2YTN A;  4JI8 E;  1TF6 A;  3H09 A;  2KOU A;  2UUA E;  1ZBT A;  4NHR A;  5AE2 A;  2CSH A;  2EMY A;  2EL5 A;  2B3T B;  2VQF E;  4J8Z A;  4R03 A;  3J81 C;  2UXB E;  3KWR A;  3THN A;  1WHQ A;  2EOO A;  2FGG A;  2MDR A;  4X62 E;  2L2K B;  1FJG E;  4DR6 E;  1ZBQ A;  4DV0 E;  4DV2 E;  2V88 A;  1RMD A;  2EM0 A;  2B9D A;  2GHF A;  2YU8 A;  4JYA E;  4R2E A;  2LJU A;  2LMZ A;  4DV5 E;  4JI2 E;  4BS9 A;  4JI7 E;  1A1J A;  2G7H A;  4DR1 E;  3IWD A;  2F8B A;  5BR8 E;  3OTO E;  1T4O A;  4RHB B;  2VE7 C;  1X48 A;  2EOI A;  2ENA A;  2LUP B;  3P1X A;  3F6H A;  1PDA A;  4R2C A;  4Q28 A;  1JK2 A;  2DMY A;  2WZO A;  2VF1 A;  1PJS A;  2EOF A;  2E1M A;  3J7Y p;  2EMI A;  2EPC A;  3EPL A;  1GQE A;  2VQE E;  2V86 A;  3JU0 A;  4GKJ E;  4JI1 E;  1X6F A;  3BBG A;  4O4K A;  2EMC A;  2ADR A;  2YTD A;  1Z1B A;  2L3C A;  1N3G A;  2DGC A;  4LF4 E;  2EOZ A;  1IQO A;  1BB8 A;  4JI6 E;  3ZOQ B;  2WCC 3;  2LO3 A;  2EMG A;  2EWL A;  1KYQ A;  2LJH A;  2V83 A;  1A1G A;  2RQL A;  2EPR A;  2EMX A;  1YUI A;  2IHR 1;  2EM6 A;  3M99 B;  2B7T A;  2F4V E;  3EQ1 A;  5ADZ A;  2CPN A;  4O24 A;  5A6B A;  4X8W A;  2EN4 A;  2JXP A;  1UBD C;  4GKK E;  2LTS A;  4L5N C;  2WBS A;  4DR4 E;  5CFF E;  1MEY C;  4LFA E;  2EPO A;  4WFT A;  1EKZ A;  3LLH A;  1HR0 E;  1XNQ E;  3VK6 A;  4O5G A;  3J80 C;  2N8X A;  2L92 A;  5T6J A;  4O43 A;  1EH7 A;  4X64 E;  1A1I A;  5AC4 A;  2EN8 A;  2YSP A;  1ZR9 A;  5A6A A;  3IWB A;  1T38 A;  1TF3 A;  2YZT A;  2DIX A;  1RC7 A;  1X3C A;  3QG5 C;  4LTY A;  2LT7 A;  1UIL A;  4X65 E;  1XNR E;  4F2J C;  4L8N A;  2YRH A;  3TQM A;  2JPA A;  3MHH C;  1X5W A;  3BID A;  3F6G A;  2HJJ A;  1IBK E;  1IMU A;  4DV7 E;  4R2P A;  3HQ1 A;  2D9H A;  4NXN E;  2LV2 A;  1GTK A;  4OOG C;  2LBS B;  1SFE A;  1N34 E;  3THO B;  2RPC A;  3MHS C;  2EN1 A;  4X66 E;  2HGH A;  2EMW A;  4BHC A;  2EOS A;  2YTO A;  1YPN A;  2MKN A;  2L6M A;  2LRS A;  1P47 A;  2MC6 A;  4DV4 E;  5IWA E;  1N32 E;  4R2Q A;  3C6K A;  2YTF A;  2YTE A;  1XMO E;  4DR2 E;  2EN6 A;  2VRD A;  1UN6 B;  2N3H A;  1HNZ E;  2DMI A;  2LE2 A;  2EL6 A;  2CT1 A;  2J7J A;  2YTP A;  3HPS A;  5A6K A;  1YFH A;  1SR9 A;  2EPK X;  2L2N A;  2R1F A;  2YPN A;  4DR7 E;  2ZM6 E;  4F54 A;  2EOJ A;  2NA2 A;  1WXR A;  2ELY A;  4IJD A;  2EPX A;  1YUJ A;  2RS6 A;  2PRT A;  2EMA A;  2K7I A;  5LMU E;  2GLI A;  2ODR C;  5A6J A;  1QNT A;  4F9C B;  4JI5 E;  2MC5 A;  2EPZ A;  2EP3 A;  1STU A;  2EM2 A;  1KJK A;  1HNW E;  2JP9 A;  1WHN A;  2EM5 A;  4M30 A;  4R2R A;  2EPU A;  4GZN C;  4BCA A;  2EOR A;  5AE3 A;  4NXM E;  2EJ4 A;  2EM3 A;  3DF6 A;  4R2S A;  4LF7 E;  2RS7 A;  5AE1 A;  3K6Q A;  4FK5 C;  4DV6 E;  4DR3 E;  1DGC A;  4HEI A;  4M2Z A;  2YTI A;  1N36 E;  3ADL A;  4LF5 E;  4Q35 B;  2EOY A;  2UUB E;  3C6M A;  2EM4 A;  2UUC E;  2EMZ A;  1PJQ A;  2EZ6 A;  2DLQ A;  2M9A A;  1O0W A;  1HNX E;  1X49 A;  1FKA E;  2L2M A;  1EH8 A;  2EM8 A;  2MDG A;  4B3T E;  4DUY E;  2JY9 A;  1T4L B;  2YRK A;  2Q8U A;  2EL4 A;  5DNY A;  2YTJ A;  2UU9 E;  4WPY A;  4LF9 E;  2L33 A;  2EML A;  2L3J A;  4DR5 E;  4P7D A;  2ENH A;  2MKD A;  4ZYE A;  5F3W A;  5A69 A;  2E5L E;  1PJT A;  3JTZ A;  5LLQ A;  2JWO A;  4OX9 E;  4LU9 A;  4TUI A;  4X9J A;  2HC5 A;  4MLV A;  1N33 E;  4WX9 A;  4NZV A;  3LML A;  4F6N A;  1A1L A;  4R8O A;  2CTD A;  4BHB A;  2K4V A;  2E72 A;  1PKP A;  4R2A A;  3ADJ A;  3HPZ A;  1IBL E;  2JR1 A;  5KL6 A;  1WJP A;  1BBO A;  2M4I A;  5KL2 A;  3UK3 C;  2R76 A;  3L00 A;  3C4B A;  4DKK A;  4LF6 E;  5LL6 R;  4JI4 E;  2NUG A;  2EMB A;  1T4N A;  2KON A;  4B3S E;  2EOE A;  2ENC A;  1G2D C;  4ZYG A;  1A1F A;  2LCE A;  2L8T A;  1MGT A;  2V85 A;  4M0V A;  2JOB A;  5IXM B;  1IBM E;  4I8O A;  2LUQ A;  4ZYH A;  1QU6 A;  4LFB E;  2EN7 A;  2FTX B;  1A1K A;  2V89 A;  1J26 A;  2EOX A;  1X6H A;  2EQ3 A;  3IWC A;  2NUE A;  2YWQ A;  2EN3 A;  2EMH A;  2GPI A;  3OML A;  1IQS A;  5AC5 A;  3EPH A;  2I13 A;  3KZY A;  2A25 A;  2YTG A;  1YYK A;  2NUF A;  4LFC E;  2EOH A;  1J5E E;  2EE8 A;  2RTX A;  3BF2 A;  5A2Q C;  2EMK A;  5FLX C;  3J7A G;  2M1S A;  2LVH A;  2I9I A;  2ODR D;  3VHT B;  2FV4 B;  2V87 A;  1RQ0 A;  4KHP E;  1X6E A;  1GZ6 A;  2RSI A;  1JK1 A;  1L4S A;  4BC9 A;  1YSA C;  4F6M A;  2EQ1 A;  1XMQ E;  1F2I G;  4DMI A;  4WXD A;  1YYO A;  3VYX A;  2UXC E;  2DSY A;  2JYA A;  3AV0 A;  4N4R B;  1DI2 A;  5KL7 A;  4F9B B;  4K0K E;  1ZAA C;  2JVA A;  2EPA A;  3ADI A;  2YRM A;  2DRP A;  1YZ9 A;  2EMF A;  4P78 A;  2YSO A;  4YHH E;  1NCS A;  2EPP A;  4KWY A;  4M9V C;  4YY3 E;  3VYY A;  2V8Q B;  2EM7 A;  2EPM X;  1I94 E;  4DV1 E;  4ZYD A;  5A6B D;  4BC7 A;  3DJW A;  4RH8 A;  1T39 A;  4B3R E;  3ECR A;  1AH5 A; 
#chains in the Genus database with same CATH homology
 3EPJ A;  2EOQ A;  5KL6 A;  1A1H A;  2DLK A;  1WJP A;  1BBO A;  5KL4 A;  4R2Q A;  3UK3 C;  5KL2 A;  2ELZ A;  2EOI A;  2ENA A;  2YTF A;  2YTE A;  2EN6 A;  2VRD A;  2YU5 A;  1UN6 B;  4R2C A;  1JK2 A;  2DMI A;  2EMB A;  2EL6 A;  2EOF A;  1B69 A;  2EOE A;  2CT1 A;  2ENC A;  2J7J A;  2YTP A;  2EMI A;  2EPC A;  3EPL A;  1G2D C;  1A1F A;  2LCE A;  2R1F A;  2YTQ A;  2EOM A;  3EPK A;  2EOJ A;  1X6F A;  2EMC A;  1G2F C;  2ADR A;  2YTD A;  1Z1B A;  2DGC A;  2EOZ A;  1BB8 A;  2WBU A;  2EN7 A;  2BB8 A;  2ELY A;  4IJD A;  2EPX A;  2WCC 3;  1A1K A;  1YUJ A;  2LO3 A;  2EM9 A;  2PRT A;  2EN2 A;  2EMA A;  2EMG A;  2GLI A;  2EOX A;  1X6H A;  2EQ3 A;  2EN3 A;  1A1G A;  2EPZ A;  2EMH A;  2EP3 A;  2EM2 A;  2EPR A;  1KJK A;  2JP9 A;  2EMX A;  2EM5 A;  4R2R A;  2EPU A;  3EPH A;  1YUI A;  4GZN C;  2I13 A;  2EOR A;  2A25 A;  2EM6 A;  3M99 B;  5KL3 A;  2EJ4 A;  2YTG A;  2EM3 A;  1LLM C;  4R2S A;  2WBT A;  4FK5 C;  5KL5 A;  2NAB A;  2EOH A;  2EN4 A;  4IS1 C;  1DGC A;  1UBD C;  2YTI A;  2EQ0 A;  2WBS A;  2EE8 A;  1MEY C;  4R2D A;  1TN9 A;  2EMK A;  1ZU1 A;  2EOY A;  1AAY A;  2LVH A;  2EM4 A;  4WSG A;  3VHT B;  2EMZ A;  2DLQ A;  1X6E A;  2M9A A;  2RSI A;  1A1I A;  1JK1 A;  2YTN A;  1TF6 A;  2EM8 A;  1YSA C;  2MDG A;  2EN8 A;  4F6M A;  2EQ1 A;  2YSP A;  1ZR9 A;  1F2I G;  2YRK A;  1TF3 A;  2CSH A;  2EL4 A;  1X3C A;  2EMY A;  2YTJ A;  2LT7 A;  2EL5 A;  2EML A;  4F2J C;  5KL7 A;  2YRH A;  2JPA A;  1X5W A;  3MHH C;  2EOO A;  2ENH A;  2MKD A;  1ZAA C;  2EPA A;  2YRM A;  2DRP A;  4R2P A;  2EMF A;  2D9H A;  4X9J A;  2LV2 A;  2YSO A;  1NCS A;  2EPP A;  4M9V C;  2RPC A;  3MHS C;  1RMD A;  2EM7 A;  2EM0 A;  2EN1 A;  2GHF A;  2YU8 A;  4F6N A;  2HGH A;  2EMW A;  4R2E A;  1A1L A;  2EOS A;  2YTO A;  2MKN A;  2CTD A;  2E72 A;  1A1J A;  1P47 A;  4R2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...