2EMIA

Solution structure of the c2h2 type zinc finger (region 547-579) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGERHYECSECGKAFIQKSTLSMHQRIHRGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 547-579) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emiA01
2JPAA 2EOFA 4F6NA 2EOQA 2EN3A 1X6FA 2CT1A 2YTQA 2WBUA 1YUJA 5KL5A 1X6EA 1TF3A 1BBOA 1JK1A 2LO3A 1YUIA 2YRMA 2MDGA 1A1FA 1RMDA 2VRDA 1UN6B 2RPCA 1G2FC 1TF6A 2R1FA 4R2PA 1A1LA 2LV2A 3EPJA 2EM6A 2GHFA 3MHHC 1YSAC 2YTPA 2WBTA 2EN2A 2YTNA 2EE8A 3VHTB 3M99B 1A1JA 2J7JA 2EOJA 2EMIA 2EMLA 1ZR9A 4WSGA 4F6MA 2LVHA 2YTOA 4GZNC 2D9HA 2LT7A 2CTDA 5KL3A 2EN7A 2EMFA 4R2CA 2EN8A 2EN4A 1ZAAC 2EPPA 5KL7A 1LLMC 2EQ0A 4R2EA 1F2IG 3EPHA 2I13A 2YSPA 2PRTA 2BB8A 4R2AA 1A1HA 2ENHA 2EPAA 2YTGA 2MKDA 1X6HA 2EM5A 5KL6A 1NCSA 2EM0A 2EMWA 1MEYC 2EL6A 2EOZA 2YTJA 1WJPA 4FK5C 2EOHA 2WCC3 1G2DC 1BB8A 2EL4A 2WBSA 2EPRA 3UK3C 1A1GA 2EM9A 1P47A 2MKNA 2DLQA 2EPUA 4R2RA 2EMZA 2EMGA 2DRPA 4R2QA 2EM3A 1AAYA 2YTDA 2EMXA 2ELYA 2EMCA 2EOIA 2A25A 2HGHA 2EORA 2EL5A 2ADRA 2EOSA 2YU8A 2LCEA 2YRHA 3EPKA 1X5WA 2EOOA 2EMYA 3MHSC 2E72A 1A1KA 2JP9A 2DMIA 4X9JA 2EM2A 2EMKA 1TN9A 2EPZA 2RSIA 2EOEA 2EJ4A 2ELZA 2YRKA 2EP3A 2DGCA 2M9AA 2EM7A 1A1IA 2EMBA 1Z1BA 2EOMA 1X3CA 2EPCA 5KL2A 1DGCA 2EQ1A 2CSHA 1ZU1A 3EPLA 2YTEA 1JK2A 4IS1C 2EPXA 2EMHA 2YTIA 2EMAA 2YU5A 1B69A 4IJDA 4R2DA 2EM8A 2NABA 1UBDC 5KL4A 1KJKA 2DLKA 2EQ3A 2GLIA 2EM4A 2EOXA 2EN6A 2ENAA 2EN1A 2YSOA 2EOYA 4R2SA 2ENCA 4F2JC 2YTFA 4M9VC
chains in the Genus database with same CATH superfamily
4B3ME 3HQ1A 4JI0E 4F6NA 4LFAE 2YTQA 2WBUA 2KONA 1XMOE 2EPMX 2MDGA 1RMDA 3VK6A 1QU6A 4R2PA 1MGTA 5LMUE 3BBGA 3T1HE 1WHQA 4BC7A 2ODRC 4BHBA 2VE7C 2EMIA 1NEIA 3FIGA 1ZR9A 4BMJA 2V8QB 2FTXB 2LBSB 4GZNC 3KZYA 2D9HA 1WHNA 1QNTA 3ECRA 2UXBE 5KL3A 2EMFA 2YT4A 4B3TE 3KWRA 2EN4A 1YZ9A 2EQ0A 2F8BA 2LUPB 2EZ6A 2RTXA 2UXCE 1EH7A 1F2IG 4Q35B 2YSPA 2BB8A 2MKDA 1X6HA 2LTSA 5T6JA 4AQYE 4LU9A 2EL6A 5A6BA 4KWYA 2NUFA 1WJPA 2EWLA 2M1SA 1G2DC 2EOHA 3AUZA 2WBSA 1YYKA 2EPRA 2UU9E 2EM9A 2MKNA 2KHXA 3LMLA 2Q8UA 1STUA 4JI3E 3IWCA 1X47A 4DR5E 2LRSA 4DV4E 1DQ3A 2R76A 2EPKX 2HGHA 2EORA 2ADRA 1SR9A 2EOSA 1XNRE 1YPNA 1GTKA 4NXNE 1RC7A 1IQSA 4I8OA 1EH8A 2JP9A 4ZYDA 4WXCA 2EMKA 2UUBE 2L92A 4DR6E 5A2QC 2EJ4A 5A6JA 2ELZA 2YRKA 3K6QA 4NXME 4KHPE 1N33E 2EOMA 1I94E 3HPSA 4DV2E 1DGCA 2RS7A 1IBLE 5AC5A 4JI7E 4LTYA 2YU5A 3C4TA 1IBKE 1X48A 1B69A 2V87A 4R2DA 1UBDC 2GLIA 4JI4E 4OX9E 2LE2A 5IWAE 4JI6E 2YTFA 4M9VC 2JPAA 2EOFA 3DJWA 2EN3A 1X6FA 4JV5E 1X6EA 2HJJA 1SFEA 1JK1A 3ADIA 1BBOA 2JXPA 5IXMB 1UN6B 2NUGA 1G2FC 3BF2A 4DR7E 2EPNA 3THOB 5AE2A 4L8NA 3MHHC 2YTPA 3F6HA 3DF6A 2NUEA 2EE8A 4F9AB 3M99B 2EOJA 1UHZA 2G7HA 1IQOA 2EMLA 4WSGA 1KYQA 4F6MA 2YTOA 1HNWE 2V88A 4X62E 2LT7A 2CTDA 4LF6E 2JY9A 4R2CA 2EN8A 4DR4E 1GQEA 1LLMC 4JI1E 2UXDE 3JU0A 3EPHA 2I13A 3RMPA 1A1HA 2ENHA 3HTXA 5KL6A 1NCSA 2EM0A 2JOBA 2VF1A 2V86A 4DUYE 2JOXA 4X65E 5A6BD 3L00A 4HEIA 2L33A 4R8OA 2L2KB 4FK5C 2DIXA 1BB8A 3QG5C 4KZSA 2JVAA 1A1GA 5ADZA 4DUZE 2EPUA 4NZVA 3JAMC 3BGHA 2LTRA 4L5NC 1AAYA 3ADJA 2YTDA 2EMCA 1RQ0A 5CFFE 2YPNA 2A25A 4B3SE 4F9CB 3J7Yp 2MDRA 4BCAA 2YU8A 2DB2A 4GKKE 3EPKA 2ODRD 4DKKA 5IV8B 1PJSA 3MHSC 4JYAE 2LMZA 4BC9A 2EM2A 2MC5A 3KZZA 2EP3A 2DGCA 2V89A 2EM7A 2EMBA 1T38A 1Z1BA 1X3CA 3J81C 2CPNA 1FKAE 4LF4E 3EPLA 3MSWA 2RSMA 4O24A 2EPXA 2EMHA 2B7TA 4IJDA 2L3CA 2NABA 1IBME 4JI2E 5KL4A 1KJKA 2DLKA 4R03A 2VQFE 4WYQB 5F3WA 2EOXA 5LMNE 1FJGE 2EN1A 2YSOA 2EOYA 4R2SA 2ENCA 4F2JC 2HHHE 1N34E 2EOQA 2K7IA 2CT1A 1WRJA 5KL5A 5BR8E 4JI5E 4ZYGA 1TF3A 1YUIA 4MLVA 2VRDA 2FV4B 3LLHA 4DV5E 1TF6A 4N4RB 5A69A 2LV2A 4TUIA 2GHFA 3IWBA 1YSAC 5AE1A 2MC6A 2BBGA 4OOGC 2EN2A 2YTNA 4DV0E 2JWOA 3VHTB 1A1JA 2UUCE 2LVHA 4M30A 2JYAA 4WX9A 3ADLA 2V83A 1PDAA 4TUGA 4JI8E 3OTOE 1T4OA 1BBGA 4R2EA 1T39A 3J7AG 4X8WA 2PRTA 4R2AA 1ZBTA 4RHBB 5LLQA 2ZM6E 2YTGA 1L4SA 2EM5A 4X66E 4BHCA 1N3GA 2N3GA 3ADGA 3HPZA 2EOZA 2YTJA 3OMLA 4RH8A 1T4NA 2L2MA 4LF7E 2LJHA 3P1XA 2L2NA 2EL4A 5AC4A 2RQLA 3UK3C 4DV7E 1PKPA 2DLQA 4R2RA 4YHHE 1J5EE 2KOUA 2EMGA 2EM3A 3C6KA 4DR3E 2EMXA 1T4LB 2ELYA 2E1MA 1YYWA 2L3JA 4WXDA 2LCEA 2B9DA 2EMYA 2E72A 2NA2A 4X9JA 4LFCE 4MLQA 4LF8E 4J8ZA 2EPZA 2H36X 3IWDA 1UILA 2VQEE 4HTGA 2M9AA 3BIDA 3HXLA 2FGGA 2EPCA 1YFHA 4F54A 4GEQB 2EQ1A 5KL2A 1HR0E 2CSHA 3H09A 2YTEA 1HNZE 1N32E 1JK2A 4IS1C 2YTIA 1HNXE 2YWQA 3JTZA 2EM8A 2HC5A 4O5GA 2EQ3A 2EM4A 4NHRA 2EN6A 4GKJE 3C6MA 2E5LE 1PJQA 3AV0A 4X64E 1YUJA 5AE3A 2I9IA 5DNYA 2YZTA 4BS9A 1N36E 1ZBQA 2LO3A 2YRMA 1A1FA 2RPCA 2R1FA 1A1LA 1WXRA 4P78A 2EM6A 3EPJA 5LL6R 2WBTA 3THNA 1EKZA 2J7JA 4M0VA 2L8TA 3VYYA 1DI2A 2LUQA 2M4IA 4BBYA 2EN7A 1ZAAC 2EPPA 5KL7A 1XMQE 4LF9E 4DV3E 4O43A 1GZ6A 4WFTA 2EPAA 4YY3E 2LJUA 1MEYC 4DMIA 2EMWA 2V85A 4ZYEA 2B7VA 2B3TB 4WPYA 2N8XA 4DV6E 4DV1E 2WCC3 2DMYA 3F6GA 4P7DA 1P47A 1PJTA 4B3RE 5AASA 2EPOA 2EMZA 3C4BA 5TSEA 4K0KE 4DR2E 1J26A 2DRPA 4R2QA 1AH5A 5FLXC 2M7QA 2EOIA 2DSYA 2K4VA 2EL5A 2EPLX 2N3HA 2JR1A 2YRHA 1X49A 1X5WA 2EOOA 4O4KA 3EQ1A 1A1KA 2DMIA 1O0WA 1XNQE 1EH6A 1TN9A 1YYOA 2RSIA 5A6AA 2EOEA 4Q28A 1IMUA 3T1YE 5IT9C 1A1IA 5A6KA 2UUAE 4M2ZA 4LFBE 2GPIA 2WZOA 2F4VE 2L6MA 4ZYHA 1ZU1A 4WSPA 3ZOQB 4LF5E 4DR1E 2EMAA 3J80C 3VYXA 4F9BB 2IHR1 2RS6A 3TQMA 2ENAA
chains in the Genus database with same CATH topology
2JPAA 2EOFA 4F6NA 2EOQA 2EN3A 1X6FA 2CT1A 2YTQA 2WBUA 1YUJA 5KL5A 1X6EA 1TF3A 1BBOA 1JK1A 2LO3A 1YUIA 2YRMA 2MDGA 1A1FA 1RMDA 2VRDA 1UN6B 2RPCA 1G2FC 1TF6A 2R1FA 4R2PA 1A1LA 2LV2A 3EPJA 2EM6A 2GHFA 3MHHC 1YSAC 2YTPA 2WBTA 2EN2A 2YTNA 2EE8A 3VHTB 3M99B 1A1JA 2J7JA 2EOJA 2EMIA 2EMLA 1ZR9A 4WSGA 4F6MA 2LVHA 2YTOA 4GZNC 2D9HA 2LT7A 2CTDA 5KL3A 2EN7A 2EMFA 4R2CA 2EN8A 2EN4A 1ZAAC 2EPPA 5KL7A 1LLMC 2EQ0A 4R2EA 1F2IG 3EPHA 2I13A 2YSPA 2PRTA 2BB8A 4R2AA 1A1HA 2ENHA 2EPAA 2YTGA 2MKDA 1X6HA 2EM5A 5KL6A 1NCSA 2EM0A 2EMWA 1MEYC 2EL6A 2EOZA 2YTJA 1WJPA 4FK5C 2EOHA 2WCC3 1G2DC 1BB8A 2EL4A 2WBSA 2EPRA 3UK3C 1A1GA 2EM9A 1P47A 2MKNA 2DLQA 2EPUA 4R2RA 2EMZA 2EMGA 2DRPA 4R2QA 2EM3A 1AAYA 2YTDA 2EMXA 2ELYA 2EMCA 2EOIA 2A25A 2HGHA 2EORA 2EL5A 2ADRA 2EOSA 2YU8A 2LCEA 2YRHA 3EPKA 1X5WA 2EOOA 2EMYA 3MHSC 2E72A 1A1KA 2JP9A 2DMIA 4X9JA 2EM2A 2EMKA 1TN9A 2EPZA 2RSIA 2EOEA 2EJ4A 2ELZA 2YRKA 2EP3A 2DGCA 2M9AA 2EM7A 1A1IA 2EMBA 1Z1BA 2EOMA 1X3CA 2EPCA 5KL2A 1DGCA 2EQ1A 2CSHA 1ZU1A 3EPLA 2YTEA 1JK2A 4IS1C 2EPXA 2EMHA 2YTIA 2EMAA 2YU5A 1B69A 4IJDA 4R2DA 2EM8A 2NABA 1UBDC 5KL4A 1KJKA 2DLKA 2EQ3A 2GLIA 2EM4A 2EOXA 2EN6A 2ENAA 2EN1A 2YSOA 2EOYA 4R2SA 2ENCA 4F2JC 2YTFA 4M9VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPA A;  2EOF A;  4F6N A;  2EOQ A;  2EN3 A;  1X6F A;  2CT1 A;  2YTQ A;  2WBU A;  1YUJ A;  5KL5 A;  1X6E A;  1TF3 A;  1BBO A;  1JK1 A;  2LO3 A;  1YUI A;  2YRM A;  2MDG A;  1A1F A;  1RMD A;  2VRD A;  1UN6 B;  2RPC A;  1G2F C;  1TF6 A;  2R1F A;  4R2P A;  1A1L A;  2LV2 A;  3EPJ A;  2EM6 A;  2GHF A;  3MHH C;  1YSA C;  2YTP A;  2WBT A;  2EN2 A;  2YTN A;  2EE8 A;  3VHT B;  3M99 B;  1A1J A;  2J7J A;  2EOJ A;  2EMI A;  2EML A;  1ZR9 A;  4WSG A;  4F6M A;  2LVH A;  2YTO A;  4GZN C;  2D9H A;  2LT7 A;  2CTD A;  5KL3 A;  2EN7 A;  2EMF A;  4R2C A;  2EN8 A;  2EN4 A;  1ZAA C;  2EPP A;  5KL7 A;  1LLM C;  2EQ0 A;  4R2E A;  1F2I G;  3EPH A;  2I13 A;  2YSP A;  2PRT A;  2BB8 A;  4R2A A;  1A1H A;  2ENH A;  2EPA A;  2YTG A;  2MKD A;  1X6H A;  2EM5 A;  5KL6 A;  1NCS A;  2EM0 A;  2EMW A;  1MEY C;  2EL6 A;  2EOZ A;  2YTJ A;  1WJP A;  4FK5 C;  2EOH A;  2WCC 3;  1G2D C;  1BB8 A;  2EL4 A;  2WBS A;  2EPR A;  3UK3 C;  1A1G A;  2EM9 A;  1P47 A;  2MKN A;  2DLQ A;  2EPU A;  4R2R A;  2EMZ A;  2EMG A;  2DRP A;  4R2Q A;  2EM3 A;  1AAY A;  2YTD A;  2EMX A;  2ELY A;  2EMC A;  2EOI A;  2A25 A;  2HGH A;  2EOR A;  2EL5 A;  2ADR A;  2EOS A;  2YU8 A;  2LCE A;  2YRH A;  3EPK A;  1X5W A;  2EOO A;  2EMY A;  3MHS C;  2E72 A;  1A1K A;  2JP9 A;  2DMI A;  4X9J A;  2EM2 A;  2EMK A;  1TN9 A;  2EPZ A;  2RSI A;  2EOE A;  2EJ4 A;  2ELZ A;  2YRK A;  2EP3 A;  2DGC A;  2M9A A;  2EM7 A;  1A1I A;  2EMB A;  1Z1B A;  2EOM A;  1X3C A;  2EPC A;  5KL2 A;  1DGC A;  2EQ1 A;  2CSH A;  1ZU1 A;  3EPL A;  2YTE A;  1JK2 A;  4IS1 C;  2EPX A;  2EMH A;  2YTI A;  2EMA A;  2YU5 A;  1B69 A;  4IJD A;  4R2D A;  2EM8 A;  2NAB A;  1UBD C;  5KL4 A;  1KJK A;  2DLK A;  2EQ3 A;  2GLI A;  2EM4 A;  2EOX A;  2EN6 A;  2ENA A;  2EN1 A;  2YSO A;  2EOY A;  4R2S A;  2ENC A;  4F2J C;  2YTF A;  4M9V C; 
#chains in the Genus database with same CATH topology
 4B3M E;  3HQ1 A;  4JI0 E;  4F6N A;  4LFA E;  2YTQ A;  2WBU A;  2KON A;  1XMO E;  2EPM X;  2MDG A;  1RMD A;  3VK6 A;  1QU6 A;  4R2P A;  1MGT A;  5LMU E;  3BBG A;  3T1H E;  1WHQ A;  4BC7 A;  2ODR C;  4BHB A;  2VE7 C;  2EMI A;  1NEI A;  3FIG A;  1ZR9 A;  4BMJ A;  2V8Q B;  2FTX B;  2LBS B;  4GZN C;  3KZY A;  2D9H A;  1WHN A;  1QNT A;  3ECR A;  2UXB E;  5KL3 A;  2EMF A;  2YT4 A;  4B3T E;  3KWR A;  2EN4 A;  1YZ9 A;  2EQ0 A;  2F8B A;  2LUP B;  2EZ6 A;  2RTX A;  2UXC E;  1EH7 A;  1F2I G;  4Q35 B;  2YSP A;  2BB8 A;  2MKD A;  1X6H A;  2LTS A;  5T6J A;  4AQY E;  4LU9 A;  2EL6 A;  5A6B A;  4KWY A;  2NUF A;  1WJP A;  2EWL A;  2M1S A;  1G2D C;  2EOH A;  3AUZ A;  2WBS A;  1YYK A;  2EPR A;  2UU9 E;  2EM9 A;  2MKN A;  2KHX A;  3LML A;  2Q8U A;  1STU A;  4JI3 E;  3IWC A;  1X47 A;  4DR5 E;  2LRS A;  4DV4 E;  1DQ3 A;  2R76 A;  2EPK X;  2HGH A;  2EOR A;  2ADR A;  1SR9 A;  2EOS A;  1XNR E;  1YPN A;  1GTK A;  4NXN E;  1RC7 A;  1IQS A;  4I8O A;  1EH8 A;  2JP9 A;  4ZYD A;  4WXC A;  2EMK A;  2UUB E;  2L92 A;  4DR6 E;  5A2Q C;  2EJ4 A;  5A6J A;  2ELZ A;  2YRK A;  3K6Q A;  4NXM E;  4KHP E;  1N33 E;  2EOM A;  1I94 E;  3HPS A;  4DV2 E;  1DGC A;  2RS7 A;  1IBL E;  5AC5 A;  4JI7 E;  4LTY A;  2YU5 A;  3C4T A;  1IBK E;  1X48 A;  1B69 A;  2V87 A;  4R2D A;  1UBD C;  2GLI A;  4JI4 E;  4OX9 E;  2LE2 A;  5IWA E;  4JI6 E;  2YTF A;  4M9V C;  2JPA A;  2EOF A;  3DJW A;  2EN3 A;  1X6F A;  4JV5 E;  1X6E A;  2HJJ A;  1SFE A;  1JK1 A;  3ADI A;  1BBO A;  2JXP A;  5IXM B;  1UN6 B;  2NUG A;  1G2F C;  3BF2 A;  4DR7 E;  2EPN A;  3THO B;  5AE2 A;  4L8N A;  3MHH C;  2YTP A;  3F6H A;  3DF6 A;  2NUE A;  2EE8 A;  4F9A B;  3M99 B;  2EOJ A;  1UHZ A;  2G7H A;  1IQO A;  2EML A;  4WSG A;  1KYQ A;  4F6M A;  2YTO A;  1HNW E;  2V88 A;  4X62 E;  2LT7 A;  2CTD A;  4LF6 E;  2JY9 A;  4R2C A;  2EN8 A;  4DR4 E;  1GQE A;  1LLM C;  4JI1 E;  2UXD E;  3JU0 A;  3EPH A;  2I13 A;  3RMP A;  1A1H A;  2ENH A;  3HTX A;  5KL6 A;  1NCS A;  2EM0 A;  2JOB A;  2VF1 A;  2V86 A;  4DUY E;  2JOX A;  4X65 E;  5A6B D;  3L00 A;  4HEI A;  2L33 A;  4R8O A;  2L2K B;  4FK5 C;  2DIX A;  1BB8 A;  3QG5 C;  4KZS A;  2JVA A;  1A1G A;  5ADZ A;  4DUZ E;  2EPU A;  4NZV A;  3JAM C;  3BGH A;  2LTR A;  4L5N C;  1AAY A;  3ADJ A;  2YTD A;  2EMC A;  1RQ0 A;  5CFF E;  2YPN A;  2A25 A;  4B3S E;  4F9C B;  3J7Y p;  2MDR A;  4BCA A;  2YU8 A;  2DB2 A;  4GKK E;  3EPK A;  2ODR D;  4DKK A;  5IV8 B;  1PJS A;  3MHS C;  4JYA E;  2LMZ A;  4BC9 A;  2EM2 A;  2MC5 A;  3KZZ A;  2EP3 A;  2DGC A;  2V89 A;  2EM7 A;  2EMB A;  1T38 A;  1Z1B A;  1X3C A;  3J81 C;  2CPN A;  1FKA E;  4LF4 E;  3EPL A;  3MSW A;  2RSM A;  4O24 A;  2EPX A;  2EMH A;  2B7T A;  4IJD A;  2L3C A;  2NAB A;  1IBM E;  4JI2 E;  5KL4 A;  1KJK A;  2DLK A;  4R03 A;  2VQF E;  4WYQ B;  5F3W A;  2EOX A;  5LMN E;  1FJG E;  2EN1 A;  2YSO A;  2EOY A;  4R2S A;  2ENC A;  4F2J C;  2HHH E;  1N34 E;  2EOQ A;  2K7I A;  2CT1 A;  1WRJ A;  5KL5 A;  5BR8 E;  4JI5 E;  4ZYG A;  1TF3 A;  1YUI A;  4MLV A;  2VRD A;  2FV4 B;  3LLH A;  4DV5 E;  1TF6 A;  4N4R B;  5A69 A;  2LV2 A;  4TUI A;  2GHF A;  3IWB A;  1YSA C;  5AE1 A;  2MC6 A;  2BBG A;  4OOG C;  2EN2 A;  2YTN A;  4DV0 E;  2JWO A;  3VHT B;  1A1J A;  2UUC E;  2LVH A;  4M30 A;  2JYA A;  4WX9 A;  3ADL A;  2V83 A;  1PDA A;  4TUG A;  4JI8 E;  3OTO E;  1T4O A;  1BBG A;  4R2E A;  1T39 A;  3J7A G;  4X8W A;  2PRT A;  4R2A A;  1ZBT A;  4RHB B;  5LLQ A;  2ZM6 E;  2YTG A;  1L4S A;  2EM5 A;  4X66 E;  4BHC A;  1N3G A;  2N3G A;  3ADG A;  3HPZ A;  2EOZ A;  2YTJ A;  3OML A;  4RH8 A;  1T4N A;  2L2M A;  4LF7 E;  2LJH A;  3P1X A;  2L2N A;  2EL4 A;  5AC4 A;  2RQL A;  3UK3 C;  4DV7 E;  1PKP A;  2DLQ A;  4R2R A;  4YHH E;  1J5E E;  2KOU A;  2EMG A;  2EM3 A;  3C6K A;  4DR3 E;  2EMX A;  1T4L B;  2ELY A;  2E1M A;  1YYW A;  2L3J A;  4WXD A;  2LCE A;  2B9D A;  2EMY A;  2E72 A;  2NA2 A;  4X9J A;  4LFC E;  4MLQ A;  4LF8 E;  4J8Z A;  2EPZ A;  2H36 X;  3IWD A;  1UIL A;  2VQE E;  4HTG A;  2M9A A;  3BID A;  3HXL A;  2FGG A;  2EPC A;  1YFH A;  4F54 A;  4GEQ B;  2EQ1 A;  5KL2 A;  1HR0 E;  2CSH A;  3H09 A;  2YTE A;  1HNZ E;  1N32 E;  1JK2 A;  4IS1 C;  2YTI A;  1HNX E;  2YWQ A;  3JTZ A;  2EM8 A;  2HC5 A;  4O5G A;  2EQ3 A;  2EM4 A;  4NHR A;  2EN6 A;  4GKJ E;  3C6M A;  2E5L E;  1PJQ A;  3AV0 A;  4X64 E;  1YUJ A;  5AE3 A;  2I9I A;  5DNY A;  2YZT A;  4BS9 A;  1N36 E;  1ZBQ A;  2LO3 A;  2YRM A;  1A1F A;  2RPC A;  2R1F A;  1A1L A;  1WXR A;  4P78 A;  2EM6 A;  3EPJ A;  5LL6 R;  2WBT A;  3THN A;  1EKZ A;  2J7J A;  4M0V A;  2L8T A;  3VYY A;  1DI2 A;  2LUQ A;  2M4I A;  4BBY A;  2EN7 A;  1ZAA C;  2EPP A;  5KL7 A;  1XMQ E;  4LF9 E;  4DV3 E;  4O43 A;  1GZ6 A;  4WFT A;  2EPA A;  4YY3 E;  2LJU A;  1MEY C;  4DMI A;  2EMW A;  2V85 A;  4ZYE A;  2B7V A;  2B3T B;  4WPY A;  2N8X A;  4DV6 E;  4DV1 E;  2WCC 3;  2DMY A;  3F6G A;  4P7D A;  1P47 A;  1PJT A;  4B3R E;  5AAS A;  2EPO A;  2EMZ A;  3C4B A;  5TSE A;  4K0K E;  4DR2 E;  1J26 A;  2DRP A;  4R2Q A;  1AH5 A;  5FLX C;  2M7Q A;  2EOI A;  2DSY A;  2K4V A;  2EL5 A;  2EPL X;  2N3H A;  2JR1 A;  2YRH A;  1X49 A;  1X5W A;  2EOO A;  4O4K A;  3EQ1 A;  1A1K A;  2DMI A;  1O0W A;  1XNQ E;  1EH6 A;  1TN9 A;  1YYO A;  2RSI A;  5A6A A;  2EOE A;  4Q28 A;  1IMU A;  3T1Y E;  5IT9 C;  1A1I A;  5A6K A;  2UUA E;  4M2Z A;  4LFB E;  2GPI A;  2WZO A;  2F4V E;  2L6M A;  4ZYH A;  1ZU1 A;  4WSP A;  3ZOQ B;  4LF5 E;  4DR1 E;  2EMA A;  3J80 C;  3VYX A;  4F9B B;  2IHR 1;  2RS6 A;  3TQM A;  2ENA A; 
#chains in the Genus database with same CATH homology
 2JPA A;  2EOF A;  4F6N A;  2EOQ A;  2EN3 A;  1X6F A;  2CT1 A;  2YTQ A;  2WBU A;  1YUJ A;  5KL5 A;  1X6E A;  1TF3 A;  1BBO A;  1JK1 A;  2LO3 A;  1YUI A;  2YRM A;  2MDG A;  1A1F A;  1RMD A;  2VRD A;  1UN6 B;  2RPC A;  1G2F C;  1TF6 A;  2R1F A;  4R2P A;  1A1L A;  2LV2 A;  3EPJ A;  2EM6 A;  2GHF A;  3MHH C;  1YSA C;  2YTP A;  2WBT A;  2EN2 A;  2YTN A;  2EE8 A;  3VHT B;  3M99 B;  1A1J A;  2J7J A;  2EOJ A;  2EMI A;  2EML A;  1ZR9 A;  4WSG A;  4F6M A;  2LVH A;  2YTO A;  4GZN C;  2D9H A;  2LT7 A;  2CTD A;  5KL3 A;  2EN7 A;  2EMF A;  4R2C A;  2EN8 A;  2EN4 A;  1ZAA C;  2EPP A;  5KL7 A;  1LLM C;  2EQ0 A;  4R2E A;  1F2I G;  3EPH A;  2I13 A;  2YSP A;  2PRT A;  2BB8 A;  4R2A A;  1A1H A;  2ENH A;  2EPA A;  2YTG A;  2MKD A;  1X6H A;  2EM5 A;  5KL6 A;  1NCS A;  2EM0 A;  2EMW A;  1MEY C;  2EL6 A;  2EOZ A;  2YTJ A;  1WJP A;  4FK5 C;  2EOH A;  2WCC 3;  1G2D C;  1BB8 A;  2EL4 A;  2WBS A;  2EPR A;  3UK3 C;  1A1G A;  2EM9 A;  1P47 A;  2MKN A;  2DLQ A;  2EPU A;  4R2R A;  2EMZ A;  2EMG A;  2DRP A;  4R2Q A;  2EM3 A;  1AAY A;  2YTD A;  2EMX A;  2ELY A;  2EMC A;  2EOI A;  2A25 A;  2HGH A;  2EOR A;  2EL5 A;  2ADR A;  2EOS A;  2YU8 A;  2LCE A;  2YRH A;  3EPK A;  1X5W A;  2EOO A;  2EMY A;  3MHS C;  2E72 A;  1A1K A;  2JP9 A;  2DMI A;  4X9J A;  2EM2 A;  2EMK A;  1TN9 A;  2EPZ A;  2RSI A;  2EOE A;  2EJ4 A;  2ELZ A;  2YRK A;  2EP3 A;  2DGC A;  2M9A A;  2EM7 A;  1A1I A;  2EMB A;  1Z1B A;  2EOM A;  1X3C A;  2EPC A;  5KL2 A;  1DGC A;  2EQ1 A;  2CSH A;  1ZU1 A;  3EPL A;  2YTE A;  1JK2 A;  4IS1 C;  2EPX A;  2EMH A;  2YTI A;  2EMA A;  2YU5 A;  1B69 A;  4IJD A;  4R2D A;  2EM8 A;  2NAB A;  1UBD C;  5KL4 A;  1KJK A;  2DLK A;  2EQ3 A;  2GLI A;  2EM4 A;  2EOX A;  2EN6 A;  2ENA A;  2EN1 A;  2YSO A;  2EOY A;  4R2S A;  2ENC A;  4F2J C;  2YTF A;  4M9V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...