4DKKA

The x-ray crystal structure of the human stau1 ssm-'rbd'5 domain-swapped dimer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
104
Chain Sequence
GSKATVTAIARELLYGGTSPTAETILKNNISGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDAALNILKLLSELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Staufen1 dimerizes through a conserved motif and a degenerate dsRNA-binding domain to promote mRNA decay.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Double-stranded RNA-binding protein Staufen homolog 1
total genus 28
structure length 104
sequence length 112
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dkkA02
1PKPA 5LMUE 2DB2A 4M30A 1X47A 4JI8E 1WHNA 2L33A 2KHXA 2LRSA 3J7Yp 3C4TA 1T4NA 2RTXA 2ZM6E 4JI7E 4DV2E 4DV3E 2L2KB 2LJHA 4WYQB 4WFTA 1WHQA 4LF9E 3LLHA 2VQEE 2UXCE 4YHHE 4JI6E 1J5EE 1GQEA 2HHHE 4X65E 4DV7E 4B3ME 2YT4A 4DR4E 4KHPE 2B7VA 1XNQE 4DV5E 1HNZE 4DKKA 1T4OA 4JI4E 2UUBE 4DUYE 4JYAE 4GKKE 2UXDE 1XNRE 1O0WA 2L3CA 4DR7E 2DMYA 4JI1E 3ADGA 2UXBE 3HTXA 2MDRA 2NUGA 4JV5E 4DUZE 1HNXE 2NUFA 4LF4E 4NXME 1YZ9A 2L2MA 2B3TB 4LF6E 3VYYA 4LFCE 2DIXA 2E5LE 5LMNE 1IBLE 4B3RE 1N36E 1XMQE 3C4BA 2LUPB 1STUA 1DI2A 3VYXA 1RC7A 1UHZA 2LTRA 3T1YE 1FKAE 2LTSA 2IHR1 3ADLA 4LF5E 2CPNA 4OX9E 4K0KE 3T1HE 4JI2E 4DR2E 1EKZA 2LUQA 4AQYE 4DV4E 4B3TE 1X48A 2NA2A 1ZBTA 4YY3E 1HNWE 2RS7A 1RQ0A 4B3SE 4X66E 2LBSB 1UILA 2B7TA 4DR1E 4DV6E 1QU6A 2UUCE 2UUAE 4NXNE 4DV1E 2JVAA 1YYWA 4LFBE 4DR5E 1T4LB 1I94E 1X49A 4DV0E 1IBME 4JI5E 1N32E 2N3HA 2L2NA 4LF7E 2NUEA 4DR6E 4X8WA 1FJGE 4X64E 2EZ6A 3P1XA 1N34E 2VQFE 1N33E 1XMOE 1HR0E 3ADIA 4OOGC 1IBKE 4JI0E 1YYOA 1YYKA 4LFAE 3OTOE 2RSMA 5IWAE 4JI3E 4X62E 4LF8E 4GKJE 2JY9A 4DR3E 2L3JA 4M2ZA 2UU9E 3ADJA 1J26A 5BR8E 5CFFE 2N3GA 2F4VE 2RS6A
chains in the Genus database with same CATH superfamily
1PKPA 2ADRA 3IWDA 2EMHA 2JOXA 2KOUA 3KWRA 2EMIA 2L33A 2M1SA 2LRSA 1YPNA 2EL6A 3J7Yp 1EH7A 3C4TA 1T4NA 2RTXA 1X5WA 4P78A 2EPKX 3MSWA 2Q8UA 3VK6A 4DV3E 2L2KB 4WFTA 4LF9E 3LLHA 4F9CB 2VQEE 2L8TA 2WBSA 4YHHE 3J80C 1J5EE 2EMFA 1TN9A 4X65E 2EMBA 2EM8A 2YT4A 2YTOA 1XNQE 3BIDA 4TUIA 2UUBE 2EOJA 2EMWA 4HEIA 2EN7A 1LLMC 2V87A 5IXMB 2DMYA 1JK2A 4JI1E 2JWOA 2EPOA 3KZZA 1A1IA 2M4IA 3JTZA 4DUZE 2NUFA 4RHBB 2L2MA 4F2JC 2YRHA 1T38A 1IBLE 4WPYA 1UBDC 1DI2A 3VYXA 4BBYA 1UN6B 2LTSA 2IHR1 2EOYA 3T1HE 4JI2E 2ENAA 4B3TE 4DV4E 3BF2A 1L4SA 1ZBQA 2M9AA 4IJDA 2NA2A 2EP3A 1YUIA 4X66E 5T6JA 2RPCA 2EL5A 2EE8A 4L5NC 1N3GA 2MKNA 3HPZA 2UUAE 4NXNE 4LFBE 3VHTB 4DR5E 1G2DC 3EQ1A 1T4LB 1WXRA 1I94E 2WZOA 4DV0E 2DGCA 1IBME 2EPRA 1N32E 4LF7E 4BHCA 5KL6A 1A1LA 2NUEA 3F6GA 1RMDA 4GEQB 2EN2A 2BB8A 3BGHA 3RMPA 2CT1A 1YSAC 2DLKA 1A1KA 4JI0E 3M99B 5AC4A 4LF8E 4JI3E 3J81C 1X3CA 4HTGA 2JPAA 1IMUA 2EM2A 2EPZA 4F6NA 4WSGA 2N3GA 2D9HA 3IWCA 4WX9A 1BB8A 2DB2A 2YTDA 4O43A 3QG5C 4BMJA 2EMAA 2JP9A 1BBOA 2EMYA 2EN8A 2M7QA 3EPHA 2ZM6E 3K6QA 4JI7E 2H36X 2LJHA 1YUJA 2EPPA 5KL4A 5KL7A 2YTNA 4X9JA 2EPNA 2EN3A 2R1FA 2HHHE 2EPCA 3TQMA 2EWLA 2JR1A 2HC5A 4KHPE 4NHRA 2EMGA 4M0VA 1T4OA 2LVHA 2WBUA 4Q28A 2LO3A 4FK5C 1IQSA 2UXDE 2L92A 4F9AB 4DR7E 2L6MA 4MLVA 2EMCA 2MKDA 2LCEA 2YTGA 3HTXA 2NUGA 4LF4E 1MEYC 1A1FA 3IWBA 2J7JA 2YZTA 4N4RB 4R2RA 2RSIA 2CTDA 4WXCA 1T39A 1ZU1A 2LUPB 1B69A 1STUA 2DRPA 2DLQA 1AAYA 4TUGA 1QNTA 2EMLA 3T1YE 3ADLA 2EQ1A 1MGTA 1KYQA 5F3WA 2DMIA 1PJSA 2EL4A 2YU5A 2LE2A 4BCAA 4AQYE 2EN6A 2PRTA 2V89A 2EM3A 4B3SE 3EPLA 1P47A 2LBSB 4L8NA 1UILA 2B7TA 2EOIA 2UUCE 4DV6E 2YTEA 2JVAA 1YYWA 2CSHA 2V8QB 3C6MA 2EQ0A 4R2SA 2GPIA 2L2NA 5IT9C 2I13A 2E72A 2YTPA 3P1XA 2EPMX 1N34E 4R2EA 1XMOE 2YTFA 4ZYEA 2WBTA 1F2IG 1NEIA 2YPNA 4J8ZA 1PJTA 1YYKA 5A6BA 2EN1A 4LFAE 2RSMA 2EOEA 4KWYA 4BHBA 4M2ZA 3C6KA 2L3JA 2V85A 2UU9E 4O4KA 1YFHA 1J26A 4P7DA 5CFFE 2RS6A 5AE3A 5LMUE 1SFEA 4ZYDA 4M30A 2K7IA 1X47A 2ODRC 5FLXC 4JI8E 2KHXA 2MC5A 3DJWA 2ODRD 4WYQB 2YWQA 1WHQA 2EMKA 4JI6E 1GQEA 5A6KA 1ZR9A 2EORA 2YTJA 3F6HA 4DR4E 5AASA 4DV5E 4JI4E 4DKKA 2V88A 3MHSC 2MC6A 4DUYE 2EOXA 4DMIA 4MLQA 1XNRE 1O0WA 2FV4B 2L3CA 1G2FC 2EOZA 2FTXB 3HQ1A 3ADGA 2JOBA 4NZVA 1ZAAC 2UXBE 3FIGA 1JK1A 4NXME 1YZ9A 4LU9A 4O5GA 3UK3C 2DIXA 2K4VA 4BS9A 2LJUA 1XMQE 3C4BA 3THOB 3H09A 5AE1A 2G7HA 1A1JA 1UHZA 2LTRA 4LF5E 5KL5A 4OX9E 5AC5A 4K0KE 3DF6A 2FGGA 2HGHA 2I9IA 4DR2E 3HXLA 2LV2A 2LUQA 1ZBTA 2VE7C 2VF1A 1KJKA 3OMLA 2KONA 2JYAA 4RH8A 4R2AA 2YRKA 4WSPA 4DR1E 1QU6A 2EN4A 2YTQA 4DV1E 4ZYHA 4R2PA 2B9DA 1X49A 4IS1C 4O24A 4BC9A 4JI5E 2N3HA 4Q35B 4DR6E 2EM5A 1FJGE 2EZ6A 4X64E 4KZSA 1IQOA 1X6HA 1WJPA 1HR0E 3ADIA 2YSPA 1IBKE 2EOQA 4F6MA 4X62E 2LMZA 2VRDA 4F54A 2JY9A 2EPAA 4DR3E 2LT7A 3ZOQB 2EOSA 2DSYA 3ADJA 2EM7A 2V86A 5BR8E 5A6JA 2F4VE 2ENCA 1X6FA 2GHFA 5A69A 5KL3A 1SR9A 1AH5A 4GZNC 3BBGA 1WHNA 3MHHC 4BC7A 1GTKA 4DV2E 2JXPA 5TSEA 2UXCE 2EMZA 4DV7E 2V83A 4R2QA 4B3ME 2B7VA 1Z1BA 1HNZE 2N8XA 4R8OA 2ELYA 2F8BA 3AV0A 4JYAE 4GKKE 4I8OA 1BBGA 3KZYA 2EM9A 1A1GA 2ENHA 2EJ4A 2EQ3A 3L00A 5LLQA 4F9BB 2MDRA 4JV5E 1HNXE 1A1HA 2B3TB 4LF6E 3ECRA 3VYYA 4LFCE 2E5LE 5LMNE 3EPJA 4B3RE 2R76A 1N36E 5KL2A 1TF3A 1PDAA 2NABA 1EH6A 2RQLA 1DQ3A 4ZYGA 2YSOA 1RC7A 1FKAE 1DGCA 2CPNA 2EOOA 3THNA 4R03A 1EKZA 1X48A 2E1MA 2EOMA 4M9VC 4YY3E 1HNWE 2RS7A 1RQ0A 5IV8B 2EM4A 1EH8A 1GZ6A 1TF6A 4WXDA 3J7AG 5LL6R 2EMXA 3HPSA 2GLIA 2WCC3 3LMLA 2EM0A 2YU8A 5AE2A 5A2QC 2HJJA 5A6AA 5ADZA 1PJQA 2EOFA 4X8WA 1WRJA 5DNYA 2VQFE 1N33E 2A25A 2EOHA 2EPLX 2ELZA 4OOGC 3AUZA 3JAMC 2EPUA 1YYOA 3OTOE 2BBGA 5IWAE 1X6EA 2YTIA 4GKJE 5A6BD 4R2DA 3JU0A 1NCSA 2EM6A 4LTYA 4R2CA 2YRMA 2MDGA 3EPKA 2EPXA
chains in the Genus database with same CATH topology
1PKPA 3IWCA 3IWDA 5AE3A 5LMUE 2JOXA 2KOUA 2DB2A 1SR9A 4M30A 1X47A 2ODRC 3KWRA 5FLXC 4BMJA 4JI8E 1WHNA 4BC7A 2L33A 2KHXA 2M1SA 2LRSA 2MC5A 3DJWA 2M7QA 3J7Yp 2ODRD 3C4TA 1T4NA 2RTXA 3K6QA 2ZM6E 4JI7E 2H36X 4P78A 3MSWA 3VK6A 4DV2E 4DV3E 2L2KB 2LJHA 4WYQB 4WFTA 1WHQA 4LF9E 3LLHA 4F9CB 2VQEE 2L8TA 2UXCE 4YHHE 4JI6E 3J80C 1J5EE 1GQEA 2HHHE 4X65E 2EWLA 4DV7E 2V83A 4B3ME 2JR1A 3F6HA 2YT4A 4DR4E 5AASA 4KHPE 2B7VA 1XNQE 4DV5E 1HNZE 4M0VA 2V88A 1T4OA 4DKKA 2MC6A 4Q28A 4R8OA 4TUIA 4DUYE 2UUBE 2F8BA 3AV0A 4DMIA 4JYAE 4GKKE 4I8OA 2UXDE 1XNRE 2V87A 1O0WA 2L92A 4F9AB 2FV4B 2L3CA 4DR7E 2FTXB 2DMYA 2L6MA 4JI1E 3HQ1A 2JWOA 3ADGA 2JOBA 2UXBE 3FIGA 4F9BB 2M4IA 3HTXA 2MDRA 2NUGA 3JTZA 4JV5E 4DUZE 1HNXE 2NUFA 4LF4E 4NXME 1YZ9A 2L2MA 4LU9A 2B3TB 4LF6E 3IWBA 2YZTA 3VYYA 4LFCE 2DIXA 2E5LE 5LMNE 2K4VA 1IBLE 4BS9A 4B3RE 1N36E 1XMQE 3C4BA 2LUPB 1STUA 4WPYA 1DI2A 3H09A 5AE1A 1DQ3A 4TUGA 2G7HA 3VYXA 4BBYA 1UHZA 2LTRA 3T1YE 1RC7A 2LTSA 1FKAE 2IHR1 3ADLA 4LF5E 2CPNA 4OX9E 5F3WA 4K0KE 3DF6A 2FGGA 3T1HE 4JI2E 4DR2E 3HXLA 4R03A 4BCAA 2LE2A 2LUQA 4AQYE 4DV4E 1EKZA 4B3TE 1ZBQA 1X48A 2E1MA 2V89A 2NA2A 1ZBTA 4YY3E 2VE7C 2VF1A 2RS7A 1RQ0A 4B3SE 1HNWE 4X66E 3OMLA 2KONA 1GZ6A 5T6JA 2LBSB 4L5NC 4L8NA 4WSPA 1UILA 3J7AG 5LL6R 2B7TA 3HPSA 4DR1E 3LMLA 1QU6A 3HPZA 4DV6E 2UUCE 2UUAE 4NXNE 4DV1E 2JVAA 1YYWA 4LFBE 4DR5E 5AE2A 5A2QC 2B9DA 1WXRA 2V8QB 1T4LB 1X49A 2WZOA 4DV0E 1I94E 5ADZA 1IBME 4JI5E 4BC9A 1N32E 2N3HA 2L2NA 5IT9C 4LF7E 2NUEA 4DR6E 3F6GA 4X8WA 5DNYA 4X64E 1FJGE 3P1XA 2EZ6A 1N34E 4GEQB 2VQFE 4KZSA 1XMOE 1N33E 1HR0E 3RMPA 3ADIA 4OOGC 3AUZA 3JAMC 1IBKE 4J8ZA 4JI0E 1YYOA 1YYKA 4LFAE 3OTOE 2RSMA 5IWAE 4JI3E 4X62E 4LF8E 4GKJE 2LMZA 3J81C 4F54A 2JY9A 3JU0A 4DR3E 2L3JA 4LTYA 2V85A 2UU9E 4M2ZA 3ZOQB 2DSYA 3ADJA 1J26A 2V86A 4P7DA 4JI4E 5BR8E 5CFFE 2N3GA 2F4VE 2RS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKP A;  5LMU E;  2DB2 A;  4M30 A;  1X47 A;  4JI8 E;  1WHN A;  2L33 A;  2KHX A;  2LRS A;  3J7Y p;  3C4T A;  1T4N A;  2RTX A;  2ZM6 E;  4JI7 E;  4DV2 E;  4DV3 E;  2L2K B;  2LJH A;  4WYQ B;  4WFT A;  1WHQ A;  4LF9 E;  3LLH A;  2VQE E;  2UXC E;  4YHH E;  4JI6 E;  1J5E E;  1GQE A;  2HHH E;  4X65 E;  4DV7 E;  4B3M E;  2YT4 A;  4DR4 E;  4KHP E;  2B7V A;  1XNQ E;  4DV5 E;  1HNZ E;  4DKK A;  1T4O A;  4JI4 E;  2UUB E;  4DUY E;  4JYA E;  4GKK E;  2UXD E;  1XNR E;  1O0W A;  2L3C A;  4DR7 E;  2DMY A;  4JI1 E;  3ADG A;  2UXB E;  3HTX A;  2MDR A;  2NUG A;  4JV5 E;  4DUZ E;  1HNX E;  2NUF A;  4LF4 E;  4NXM E;  1YZ9 A;  2L2M A;  2B3T B;  4LF6 E;  3VYY A;  4LFC E;  2DIX A;  2E5L E;  5LMN E;  1IBL E;  4B3R E;  1N36 E;  1XMQ E;  3C4B A;  2LUP B;  1STU A;  1DI2 A;  3VYX A;  1RC7 A;  1UHZ A;  2LTR A;  3T1Y E;  1FKA E;  2LTS A;  2IHR 1;  3ADL A;  4LF5 E;  2CPN A;  4OX9 E;  4K0K E;  3T1H E;  4JI2 E;  4DR2 E;  1EKZ A;  2LUQ A;  4AQY E;  4DV4 E;  4B3T E;  1X48 A;  2NA2 A;  1ZBT A;  4YY3 E;  1HNW E;  2RS7 A;  1RQ0 A;  4B3S E;  4X66 E;  2LBS B;  1UIL A;  2B7T A;  4DR1 E;  4DV6 E;  1QU6 A;  2UUC E;  2UUA E;  4NXN E;  4DV1 E;  2JVA A;  1YYW A;  4LFB E;  4DR5 E;  1T4L B;  1I94 E;  1X49 A;  4DV0 E;  1IBM E;  4JI5 E;  1N32 E;  2N3H A;  2L2N A;  4LF7 E;  2NUE A;  4DR6 E;  4X8W A;  1FJG E;  4X64 E;  2EZ6 A;  3P1X A;  1N34 E;  2VQF E;  1N33 E;  1XMO E;  1HR0 E;  3ADI A;  4OOG C;  1IBK E;  4JI0 E;  1YYO A;  1YYK A;  4LFA E;  3OTO E;  2RSM A;  5IWA E;  4JI3 E;  4X62 E;  4LF8 E;  4GKJ E;  2JY9 A;  4DR3 E;  2L3J A;  4M2Z A;  2UU9 E;  3ADJ A;  1J26 A;  5BR8 E;  5CFF E;  2N3G A;  2F4V E;  2RS6 A; 
#chains in the Genus database with same CATH topology
 1PKP A;  2ADR A;  3IWD A;  2EMH A;  2JOX A;  2KOU A;  3KWR A;  2EMI A;  2L33 A;  2M1S A;  2LRS A;  1YPN A;  2EL6 A;  3J7Y p;  1EH7 A;  3C4T A;  1T4N A;  2RTX A;  1X5W A;  4P78 A;  2EPK X;  3MSW A;  2Q8U A;  3VK6 A;  4DV3 E;  2L2K B;  4WFT A;  4LF9 E;  3LLH A;  4F9C B;  2VQE E;  2L8T A;  2WBS A;  4YHH E;  3J80 C;  1J5E E;  2EMF A;  1TN9 A;  4X65 E;  2EMB A;  2EM8 A;  2YT4 A;  2YTO A;  1XNQ E;  3BID A;  4TUI A;  2UUB E;  2EOJ A;  2EMW A;  4HEI A;  2EN7 A;  1LLM C;  2V87 A;  5IXM B;  2DMY A;  1JK2 A;  4JI1 E;  2JWO A;  2EPO A;  3KZZ A;  1A1I A;  2M4I A;  3JTZ A;  4DUZ E;  2NUF A;  4RHB B;  2L2M A;  4F2J C;  2YRH A;  1T38 A;  1IBL E;  4WPY A;  1UBD C;  1DI2 A;  3VYX A;  4BBY A;  1UN6 B;  2LTS A;  2IHR 1;  2EOY A;  3T1H E;  4JI2 E;  2ENA A;  4B3T E;  4DV4 E;  3BF2 A;  1L4S A;  1ZBQ A;  2M9A A;  4IJD A;  2NA2 A;  2EP3 A;  1YUI A;  4X66 E;  5T6J A;  2RPC A;  2EL5 A;  2EE8 A;  4L5N C;  1N3G A;  2MKN A;  3HPZ A;  2UUA E;  4NXN E;  4LFB E;  3VHT B;  4DR5 E;  1G2D C;  3EQ1 A;  1T4L B;  1WXR A;  1I94 E;  2WZO A;  4DV0 E;  2DGC A;  1IBM E;  2EPR A;  1N32 E;  4LF7 E;  4BHC A;  5KL6 A;  1A1L A;  2NUE A;  3F6G A;  1RMD A;  4GEQ B;  2EN2 A;  2BB8 A;  3BGH A;  3RMP A;  2CT1 A;  1YSA C;  2DLK A;  1A1K A;  4JI0 E;  3M99 B;  5AC4 A;  4LF8 E;  4JI3 E;  3J81 C;  1X3C A;  4HTG A;  2JPA A;  1IMU A;  2EM2 A;  2EPZ A;  4F6N A;  4WSG A;  2N3G A;  2D9H A;  3IWC A;  4WX9 A;  1BB8 A;  2DB2 A;  2YTD A;  4O43 A;  3QG5 C;  4BMJ A;  2EMA A;  2JP9 A;  1BBO A;  2EMY A;  2EN8 A;  2M7Q A;  3EPH A;  2ZM6 E;  3K6Q A;  4JI7 E;  2H36 X;  2LJH A;  1YUJ A;  2EPP A;  5KL4 A;  5KL7 A;  2YTN A;  4X9J A;  2EPN A;  2EN3 A;  2R1F A;  2HHH E;  2EPC A;  3TQM A;  2EWL A;  2JR1 A;  2HC5 A;  4KHP E;  4NHR A;  2EMG A;  4M0V A;  1T4O A;  2LVH A;  2WBU A;  4Q28 A;  2LO3 A;  4FK5 C;  1IQS A;  2UXD E;  2L92 A;  4F9A B;  4DR7 E;  2L6M A;  4MLV A;  2EMC A;  2MKD A;  2LCE A;  2YTG A;  3HTX A;  2NUG A;  4LF4 E;  1MEY C;  1A1F A;  3IWB A;  2J7J A;  2YZT A;  4N4R B;  4R2R A;  2RSI A;  2CTD A;  4WXC A;  1T39 A;  1ZU1 A;  2LUP B;  1B69 A;  1STU A;  2DRP A;  2DLQ A;  1AAY A;  4TUG A;  1QNT A;  2EML A;  3T1Y E;  3ADL A;  2EQ1 A;  1MGT A;  1KYQ A;  5F3W A;  2DMI A;  1PJS A;  2EL4 A;  2YU5 A;  2LE2 A;  4BCA A;  4AQY E;  2EN6 A;  2PRT A;  2V89 A;  2EM3 A;  4B3S E;  3EPL A;  1P47 A;  2LBS B;  4L8N A;  1UIL A;  2B7T A;  2EOI A;  2UUC E;  4DV6 E;  2YTE A;  2JVA A;  1YYW A;  2CSH A;  2V8Q B;  3C6M A;  2EQ0 A;  4R2S A;  2GPI A;  2L2N A;  5IT9 C;  2I13 A;  2E72 A;  2YTP A;  3P1X A;  2EPM X;  1N34 E;  4R2E A;  1XMO E;  2YTF A;  4ZYE A;  2WBT A;  1F2I G;  1NEI A;  2YPN A;  4J8Z A;  1PJT A;  1YYK A;  5A6B A;  2EN1 A;  4LFA E;  2RSM A;  2EOE A;  4KWY A;  4BHB A;  4M2Z A;  3C6K A;  2L3J A;  2V85 A;  2UU9 E;  4O4K A;  1YFH A;  1J26 A;  4P7D A;  5CFF E;  2RS6 A;  5AE3 A;  5LMU E;  1SFE A;  4ZYD A;  4M30 A;  2K7I A;  1X47 A;  2ODR C;  5FLX C;  4JI8 E;  2KHX A;  2MC5 A;  3DJW A;  2ODR D;  4WYQ B;  2YWQ A;  1WHQ A;  2EMK A;  4JI6 E;  1GQE A;  5A6K A;  1ZR9 A;  2EOR A;  2YTJ A;  3F6H A;  4DR4 E;  5AAS A;  4DV5 E;  4JI4 E;  4DKK A;  2V88 A;  3MHS C;  2MC6 A;  4DUY E;  2EOX A;  4DMI A;  4MLQ A;  1XNR E;  1O0W A;  2FV4 B;  2L3C A;  1G2F C;  2EOZ A;  2FTX B;  3HQ1 A;  3ADG A;  2JOB A;  4NZV A;  1ZAA C;  2UXB E;  3FIG A;  1JK1 A;  4NXM E;  1YZ9 A;  4LU9 A;  4O5G A;  3UK3 C;  2DIX A;  2K4V A;  4BS9 A;  2LJU A;  1XMQ E;  3C4B A;  3THO B;  3H09 A;  5AE1 A;  2G7H A;  1A1J A;  1UHZ A;  2LTR A;  4LF5 E;  5KL5 A;  4OX9 E;  5AC5 A;  4K0K E;  3DF6 A;  2FGG A;  2HGH A;  2I9I A;  4DR2 E;  3HXL A;  2LV2 A;  2LUQ A;  1ZBT A;  2VE7 C;  2VF1 A;  1KJK A;  3OML A;  2KON A;  2JYA A;  4RH8 A;  4R2A A;  2YRK A;  4WSP A;  4DR1 E;  1QU6 A;  2EN4 A;  2YTQ A;  4DV1 E;  4ZYH A;  4R2P A;  2B9D A;  1X49 A;  4IS1 C;  4O24 A;  4BC9 A;  4JI5 E;  2N3H A;  4Q35 B;  4DR6 E;  2EM5 A;  1FJG E;  2EZ6 A;  4X64 E;  4KZS A;  1IQO A;  1X6H A;  1WJP A;  1HR0 E;  3ADI A;  2YSP A;  1IBK E;  2EOQ A;  4F6M A;  4X62 E;  2LMZ A;  2VRD A;  4F54 A;  2JY9 A;  2EPA A;  4DR3 E;  2LT7 A;  3ZOQ B;  2EOS A;  2DSY A;  3ADJ A;  2EM7 A;  2V86 A;  5BR8 E;  5A6J A;  2F4V E;  2ENC A;  1X6F A;  2GHF A;  5A69 A;  5KL3 A;  1SR9 A;  1AH5 A;  4GZN C;  3BBG A;  1WHN A;  3MHH C;  4BC7 A;  1GTK A;  4DV2 E;  2JXP A;  5TSE A;  2UXC E;  2EMZ A;  4DV7 E;  2V83 A;  4R2Q A;  4B3M E;  2B7V A;  1Z1B A;  1HNZ E;  2N8X A;  4R8O A;  2ELY A;  2F8B A;  3AV0 A;  4JYA E;  4GKK E;  4I8O A;  1BBG A;  3KZY A;  2EM9 A;  1A1G A;  2ENH A;  2EJ4 A;  2EQ3 A;  3L00 A;  5LLQ A;  4F9B B;  2MDR A;  4JV5 E;  1HNX E;  1A1H A;  2B3T B;  4LF6 E;  3ECR A;  3VYY A;  4LFC E;  2E5L E;  5LMN E;  3EPJ A;  4B3R E;  2R76 A;  1N36 E;  5KL2 A;  1TF3 A;  1PDA A;  2NAB A;  1EH6 A;  2RQL A;  1DQ3 A;  4ZYG A;  2YSO A;  1RC7 A;  1FKA E;  1DGC A;  2CPN A;  2EOO A;  3THN A;  4R03 A;  1EKZ A;  1X48 A;  2E1M A;  2EOM A;  4M9V C;  4YY3 E;  1HNW E;  2RS7 A;  1RQ0 A;  5IV8 B;  2EM4 A;  1EH8 A;  1GZ6 A;  1TF6 A;  4WXD A;  3J7A G;  5LL6 R;  2EMX A;  3HPS A;  2GLI A;  2WCC 3;  3LML A;  2EM0 A;  2YU8 A;  5AE2 A;  5A2Q C;  2HJJ A;  5A6A A;  5ADZ A;  1PJQ A;  2EOF A;  4X8W A;  1WRJ A;  5DNY A;  2VQF E;  1N33 E;  2A25 A;  2EOH A;  2EPL X;  2ELZ A;  4OOG C;  3AUZ A;  3JAM C;  2EPU A;  1YYO A;  3OTO E;  2BBG A;  5IWA E;  1X6E A;  2YTI A;  4GKJ E;  5A6B D;  4R2D A;  3JU0 A;  1NCS A;  2EM6 A;  4LTY A;  4R2C A;  2YRM A;  2MDG A;  3EPK A;  2EPX A; 
#chains in the Genus database with same CATH homology
 1PKP A;  3IWC A;  3IWD A;  5AE3 A;  5LMU E;  2JOX A;  2KOU A;  2DB2 A;  1SR9 A;  4M30 A;  1X47 A;  2ODR C;  3KWR A;  5FLX C;  4BMJ A;  4JI8 E;  1WHN A;  4BC7 A;  2L33 A;  2KHX A;  2M1S A;  2LRS A;  2MC5 A;  3DJW A;  2M7Q A;  3J7Y p;  2ODR D;  3C4T A;  1T4N A;  2RTX A;  3K6Q A;  2ZM6 E;  4JI7 E;  2H36 X;  4P78 A;  3MSW A;  3VK6 A;  4DV2 E;  4DV3 E;  2L2K B;  2LJH A;  4WYQ B;  4WFT A;  1WHQ A;  4LF9 E;  3LLH A;  4F9C B;  2VQE E;  2L8T A;  2UXC E;  4YHH E;  4JI6 E;  3J80 C;  1J5E E;  1GQE A;  2HHH E;  4X65 E;  2EWL A;  4DV7 E;  2V83 A;  4B3M E;  2JR1 A;  3F6H A;  2YT4 A;  4DR4 E;  5AAS A;  4KHP E;  2B7V A;  1XNQ E;  4DV5 E;  1HNZ E;  4M0V A;  2V88 A;  1T4O A;  4DKK A;  2MC6 A;  4Q28 A;  4R8O A;  4TUI A;  4DUY E;  2UUB E;  2F8B A;  3AV0 A;  4DMI A;  4JYA E;  4GKK E;  4I8O A;  2UXD E;  1XNR E;  2V87 A;  1O0W A;  2L92 A;  4F9A B;  2FV4 B;  2L3C A;  4DR7 E;  2FTX B;  2DMY A;  2L6M A;  4JI1 E;  3HQ1 A;  2JWO A;  3ADG A;  2JOB A;  2UXB E;  3FIG A;  4F9B B;  2M4I A;  3HTX A;  2MDR A;  2NUG A;  3JTZ A;  4JV5 E;  4DUZ E;  1HNX E;  2NUF A;  4LF4 E;  4NXM E;  1YZ9 A;  2L2M A;  4LU9 A;  2B3T B;  4LF6 E;  3IWB A;  2YZT A;  3VYY A;  4LFC E;  2DIX A;  2E5L E;  5LMN E;  2K4V A;  1IBL E;  4BS9 A;  4B3R E;  1N36 E;  1XMQ E;  3C4B A;  2LUP B;  1STU A;  4WPY A;  1DI2 A;  3H09 A;  5AE1 A;  1DQ3 A;  4TUG A;  2G7H A;  3VYX A;  4BBY A;  1UHZ A;  2LTR A;  3T1Y E;  1RC7 A;  2LTS A;  1FKA E;  2IHR 1;  3ADL A;  4LF5 E;  2CPN A;  4OX9 E;  5F3W A;  4K0K E;  3DF6 A;  2FGG A;  3T1H E;  4JI2 E;  4DR2 E;  3HXL A;  4R03 A;  4BCA A;  2LE2 A;  2LUQ A;  4AQY E;  4DV4 E;  1EKZ A;  4B3T E;  1ZBQ A;  1X48 A;  2E1M A;  2V89 A;  2NA2 A;  1ZBT A;  4YY3 E;  2VE7 C;  2VF1 A;  2RS7 A;  1RQ0 A;  4B3S E;  1HNW E;  4X66 E;  3OML A;  2KON A;  1GZ6 A;  5T6J A;  2LBS B;  4L5N C;  4L8N A;  4WSP A;  1UIL A;  3J7A G;  5LL6 R;  2B7T A;  3HPS A;  4DR1 E;  3LML A;  1QU6 A;  3HPZ A;  4DV6 E;  2UUC E;  2UUA E;  4NXN E;  4DV1 E;  2JVA A;  1YYW A;  4LFB E;  4DR5 E;  5AE2 A;  5A2Q C;  2B9D A;  1WXR A;  2V8Q B;  1T4L B;  1X49 A;  2WZO A;  4DV0 E;  1I94 E;  5ADZ A;  1IBM E;  4JI5 E;  4BC9 A;  1N32 E;  2N3H A;  2L2N A;  5IT9 C;  4LF7 E;  2NUE A;  4DR6 E;  3F6G A;  4X8W A;  5DNY A;  4X64 E;  1FJG E;  3P1X A;  2EZ6 A;  1N34 E;  4GEQ B;  2VQF E;  4KZS A;  1XMO E;  1N33 E;  1HR0 E;  3RMP A;  3ADI A;  4OOG C;  3AUZ A;  3JAM C;  1IBK E;  4J8Z A;  4JI0 E;  1YYO A;  1YYK A;  4LFA E;  3OTO E;  2RSM A;  5IWA E;  4JI3 E;  4X62 E;  4LF8 E;  4GKJ E;  2LMZ A;  3J81 C;  4F54 A;  2JY9 A;  3JU0 A;  4DR3 E;  2L3J A;  4LTY A;  2V85 A;  2UU9 E;  4M2Z A;  3ZOQ B;  2DSY A;  3ADJ A;  1J26 A;  2V86 A;  4P7D A;  4JI4 E;  5BR8 E;  5CFF E;  2N3G A;  2F4V E;  2RS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...