4DKKA

The x-ray crystal structure of the human stau1 ssm-'rbd'5 domain-swapped dimer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
104
Chain Sequence
GSKATVTAIARELLYGGTSPTAETILKNNISGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDAALNILKLLSELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-binding protein Staufen homolog 1
publication title Staufen1 dimerizes through a conserved motif and a degenerate dsRNA-binding domain to promote mRNA decay.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 28
structure length 104
sequence length 112
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dkkA02
2VQEE 2L2NA 4DR1E 1IBKE 4DKKA 1FKAE 2UUCE 2KHXA 4NXME 5CFFE 2B3TB 3T1YE 3LLHA 4GKJE 3HTXA 4YHHE 1T4LB 4DV6E 1EKZA 1N36E 4DV3E 4DV2E 3P1XA 2HHHE 1XNQE 2DIXA 4DV0E 2B7TA 3OTOE 2L2MA 2UUAE 4LF8E 1HNZE 1J26A 2NUEA 2NUFA 2LTRA 4JI8E 3ADGA 2UUBE 1T4OA 1X49A 1ZBTA 2L33A 5LMUE 1XMOE 2UXBE 1YYOA 4LFBE 4DR5E 3J7Yp 1HNWE 1N33E 4LF4E 2L3JA 4LF6E 4M2ZA 4JI7E 4B3RE 4B3ME 2LTSA 4X64E 4DV1E 2ZM6E 4OX9E 4B3SE 2EZ6A 4DV5E 2RS7A 4JI0E 2DB2A 5BR8E 1PKPA 1HR0E 4YY3E 1T4NA 2IHR1 4B3TE 1GQEA 3C4TA 1IBME 2YT4A 2MDRA 4DR3E 2B7VA 4JI4E 4JV5E 1FJGE 5IWAE 4LF5E 4KHPE 1UHZA 1X47A 4X62E 2UXDE 1RC7A 4AQYE 1J5EE 4DR4E 4JI3E 4DR7E 2LRSA 1N32E 3ADIA 4LFCE 1QU6A 1XNRE 3VYYA 2F4VE 2LUQA 1STUA 1N34E 5LMNE 4DUYE 2VQFE 4JI5E 2N3GA 2L3CA 1YYWA 2NUGA 1WHNA 1YYKA 3ADJA 4WYQB 1X48A 4DV7E 2N3HA 1I94E 4LFAE 1RQ0A 2E5LE 4K0KE 4NXNE 4OOGC 1YZ9A 4DR6E 2JY9A 3ADLA 1HNXE 4X66E 1WHQA 2LUPB 4JI2E 4GKKE 2CPNA 4LF9E 4DR2E 4X65E 2RSMA 4DV4E 4JYAE 1O0WA 3VYXA 2RTXA 2NA2A 2JVAA 4M30A 1UILA 1XMQE 2RS6A 3C4BA 2UXCE 4DUZE 2L2KB 3T1HE 1DI2A 4JI1E 1IBLE 4LF7E 4X8WA 2UU9E 2LBSB 2DMYA 4JI6E 2LJHA 4WFTA
chains in the Genus database with same CATH superfamily
3DJWA 2PRTA 1DGCA 1FKAE 5DNYA 2YWQA 3KZZA 2UUCE 2DLQA 3IWDA 4HTGA 2LVHA 4BCAA 5CFFE 1YUJA 3LLHA 1ZR9A 1B69A 1EKZA 4KZSA 2HHHE 2HJJA 2L2MA 2EN4A 4F9CB 4O4KA 2NUEA 2NUFA 4JI8E 3ADGA 1T4OA 1WRJA 5TSEA 1YYOA 4DR5E 3J7Yp 2FTXB 4LF4E 5ADZA 4LF6E 4B3RE 4B3ME 2WBTA 5KL3A 2L8TA 4WSGA 1DQ3A 4IS1C 1PDAA 3UK3C 3IWBA 2EN8A 1MGTA 4OX9E 2ZM6E 4M0VA 2EN6A 2EZ6A 2Q8UA 2RS7A 3EPHA 2M1SA 2IHR1 1GQEA 2EPUA 5LL6R 4WXDA 5AE3A 2JR1A 2EOJA 2B7VA 1X6HA 1X47A 2UXDE 3HQ1A 2EM6A 3L00A 2LMZA 2EOOA 2EPXA 2EN2A 3ADIA 1N32E 1QU6A 1XNRE 2V86A 4WSPA 3JTZA 1STUA 1X6EA 1N34E 2EN7A 2BBGA 2VQFE 2FV4B 2N3GA 5KL5A 1YFHA 1YYWA 4Q35B 1WJPA 1YYKA 3ADJA 2RQLA 2JP9A 2EOQA 4WYQB 2EMYA 3QG5C 2WZOA 3VHTB 1GTKA 4R2EA 2EPKX 2E5LE 1YZ9A 2JY9A 3EQ1A 2EL4A 2YZTA 1WHQA 2CPNA 4BMJA 1TF3A 1O0WA 2LT7A 3VYXA 1AH5A 3K6QA 1XMQE 4F6NA 1A1KA 3LMLA 2RS6A 3OMLA 4DUZE 1DI2A 4LF7E 2EN3A 4F6MA 4X8WA 3FIGA 2BB8A 2DMYA 2LBSB 2DLKA 2VF1A 2GPIA 2EPAA 2R76A 1IQOA 4R8OA 4R2CA 2CTDA 2KHXA 2B3TB 5A6AA 5A69A 4ZYDA 2MDGA 1UN6B 3HTXA 2EMFA 3KZYA 4DV6E 2YTIA 3P1XA 2HC5A 2DIXA 2KONA 2B7TA 4LF8E 5F3WA 2K7IA 1J26A 2EM0A 1ZBTA 1XMOE 3IWCA 5LMUE 2UXBE 4LFBE 4BHCA 1LLMC 1N33E 4JI7E 2EOIA 2L6MA 4F54A 4X64E 2EWLA 1A1IA 2EMAA 2MC5A 5KL4A 4DV5E 4JI0E 2JOXA 2E1MA 1EH7A 2H36X 2EPMX 4YY3E 1T4NA 4R2QA 2EMHA 4FK5C 4X9JA 1YSAC 2HGHA 2EPLX 3BGHA 1IBME 1RMDA 1Z1BA 3VK6A 4DR3E 2VE7C 3MSWA 3M99B 4HEIA 4KHPE 3HPSA 2EOMA 1RC7A 4AQYE 4P7DA 3THOB 2YTEA 5A6JA 5IT9C 2RSIA 3J7AG 2R1FA 2ODRD 3C6KA 1G2FC 2D9HA 4JI5E 1BBGA 2B9DA 4R2PA 1WHNA 2WBSA 1UBDC 1YPNA 4I8OA 1X48A 3ZOQB 4DV7E 2A25A 2N3HA 4LFAE 4LU9A 5IXMB 2EMZA 4K0KE 4NXNE 2GLIA 3ADLA 1HNXE 3KWRA 2LUPB 4LF9E 1X6FA 4X65E 2RSMA 3EPKA 4DR2E 2EORA 2EMGA 2EP3A 2YU5A 1ZU1A 2YTFA 1TN9A 4GEQB 2YTNA 1L4SA 2EOZA 4NZVA 2EM7A 1BB8A 4JI1E 2ENAA 5AE1A 4RH8A 2JWOA 4JI6E 2LJHA 1YUIA 1PJTA 2L2NA 4DR1E 1IBKE 2CT1A 2F8BA 2LV2A 5A6KA 2DSYA 1KYQA 4F9BB 4NHRA 2EE8A 4DV3E 4DV2E 2EL5A 1G2DC 5KL2A 3OTOE 3EPJA 4KWYA 2G7HA 4M9VC 3AV0A 1N3GA 2M9AA 2RPCA 1A1JA 2I13A 2ELYA 3EPLA 4M2ZA 5AASA 2ENCA 2EMBA 2JYAA 4R2DA 3F6GA 3J81C 2N8XA 5FLXC 4DV1E 5A6BA 1EH6A 2DGCA 1IQSA 4B3SE 2V89A 1A1HA 2EQ3A 2YSPA 5BR8E 2MKNA 1PKPA 2EM5A 4MLQA 3J80C 2EOHA 1ZAAC 1IMUA 1P47A 2YT4A 1JK2A 1NEIA 4JI4E 1T39A 1FJGE 1A1GA 5IWAE 2K4VA 4LF5E 4BS9A 1A1LA 3BIDA 2EM3A 2EOFA 4X62E 1J5EE 2LRSA 2E72A 3THNA 3VYYA 4GZNC 4TUIA 4BC7A 2F4VE 1SFEA 2LUQA 5AC4A 2M7QA 2EL6A 4BC9A 2L3CA 3AUZA 2NUGA 1JK1A 5T6JA 2EM2A 5LLQA 2EMIA 2EM9A 3C6MA 2ODRC 1I94E 1X5WA 4O24A 4P78A 4OOGC 2EPNA 2EJ4A 4X66E 2YRHA 4JI2E 4GKKE 2YU8A 2EPPA 2ELZA 2JPAA 1KJKA 2EQ1A 4M30A 2EOXA 2V85A 3RMPA 1A1FA 1UILA 2ENHA 4F9AB 2EM8A 2YPNA 2MKDA 4BHBA 1EH8A 2L2KB 1IBLE 1ZBQA 2J7JA 3MHSC 2I9IA 2UU9E 3TQMA 2YSOA 4WXCA 4WFTA 1PJQA 4L5NC 2VQEE 2VRDA 4DKKA 2DMIA 4ZYEA 3HXLA 3HPZA 4NXME 4MLVA 3T1YE 3MHHC 3H09A 4GKJE 4YHHE 1T4LB 5AE2A 1N36E 2LJUA 1XNQE 2KOUA 2L92A 4DV0E 2UUAE 2YTJA 1HNZE 2LTRA 1SR9A 2EOSA 2UUBE 1X49A 2L33A 2EN1A 2EMKA 4BBYA 2WCC3 1HNWE 2EPZA 2JXPA 2L3JA 4Q28A 2ADRA 3JAMC 1BBOA 1NCSA 5AC5A 2YTGA 4WPYA 1T38A 2CSHA 2LTSA 2DRPA 5A2QC 4LTYA 2EPRA 4DMIA 2GHFA 2V83A 2DB2A 5IV8B 4R2SA 4TUGA 1AAYA 1HR0E 2YTDA 5A6BD 4B3TE 3BBGA 2FGGA 3C4TA 2MDRA 4JV5E 3ECRA 1UHZA 2JOBA 4IJDA 2YRKA 2YTQA 4DR4E 2EMCA 4JI3E 4DR7E 4LFCE 3DF6A 2EQ0A 3F6HA 4J8ZA 2EOEA 2EPOA 4RHBB 5LMNE 4DUYE 2EOYA 3BF2A 4WX9A 4ZYHA 1GZ6A 5KL7A 4R2AA 2EMXA 2LE2A 1QNTA 3JU0A 1RQ0A 2NABA 4R03A 4O5GA 2YRMA 4DR6E 2M4IA 4ZYGA 2LO3A 4F2JC 1X3CA 2V88A 5KL6A 4DV4E 2V8QB 1MEYC 4JYAE 4R2RA 2EM4A 2MC6A 1PJSA 2EMWA 2RTXA 2NA2A 1TF6A 2JVAA 4O43A 1WXRA 4L8NA 3C4BA 2UXCE 2YTOA 3T1HE 4N4RB 2LCEA 2EPCA 2EMLA 2V87A 2WBUA 2YTPA 1F2IG
chains in the Genus database with same CATH topology
2VQEE 2L2NA 4DR1E 3DJWA 1IBKE 4DKKA 3HXLA 5DNYA 1FKAE 3HPZA 4R8OA 2UUCE 3IWDA 2F8BA 2KHXA 4NXME 4BCAA 2DSYA 2B3TB 5CFFE 3T1YE 3H09A 3LLHA 4GKJE 4F9BB 3HTXA 4YHHE 1T4LB 5AE2A 4DV6E 1EKZA 1N36E 4DV3E 4DV2E 3P1XA 4KZSA 2HHHE 2KOUA 1XNQE 2DIXA 2L92A 2KONA 4DV0E 2B7TA 3OTOE 2L2MA 5F3WA 2UUAE 4F9CB 1HNZE 4LF8E 1J26A 2NUEA 2NUFA 2LTRA 1SR9A 4JI8E 3ADGA 2G7HA 2UUBE 1T4OA 1X49A 1ZBTA 2L33A 3AV0A 3IWCA 4BBYA 5LMUE 1YYOA 1XMOE 4DR5E 4LFBE 2UXBE 3J7Yp 1HNWE 1N33E 2FTXB 2L3JA 4Q28A 5ADZA 4LF4E 4LF6E 4JI7E 3JAMC 4M2ZA 4B3ME 5AASA 4B3RE 2L8TA 1DQ3A 2L6MA 3F6GA 4WPYA 4F54A 3J81C 5FLXC 2LTSA 3IWBA 4X64E 5A2QC 4DV1E 2ZM6E 4OX9E 4LTYA 2EWLA 4DMIA 4M0VA 4B3SE 2EZ6A 2MC5A 2V89A 4DV5E 2RS7A 2JOXA 2V83A 4JI0E 2E1MA 2DB2A 5BR8E 4TUGA 1PKPA 1HR0E 2H36X 2M1SA 3J80C 4YY3E 1T4NA 2IHR1 4B3TE 1GQEA 2FGGA 5LL6R 3C4TA 5AE3A 1IBME 2YT4A 2JR1A 2MDRA 3VK6A 2B7VA 4DR3E 2VE7C 4JI4E 1FJGE 4JV5E 5IWAE 2K4VA 3MSWA 4BS9A 4LF5E 4KHPE 2JOBA 1UHZA 3HPSA 1X47A 4X62E 3HQ1A 1RC7A 2UXDE 4AQYE 1J5EE 2LMZA 4DR4E 4JI3E 4DR7E 2LRSA 1N32E 4P7DA 3ADIA 4LFCE 1QU6A 3DF6A 1XNRE 3VYYA 4TUIA 2V86A 4WSPA 4BC7A 3JTZA 5IT9C 2LUQA 3F6HA 1STUA 4J8ZA 3J7AG 2F4VE 1N34E 2ODRD 2M7QA 5LMNE 4DUYE 4BC9A 2FV4B 2N3GA 2L3CA 3AUZA 2B9DA 2VQFE 4JI5E 1YYWA 1GZ6A 2NUGA 5T6JA 1WHNA 1YYKA 3ADJA 2LE2A 3JU0A 4WYQB 4I8OA 1X48A 3ZOQB 4DV7E 2N3HA 2WZOA 2ODRC 1I94E 4LFAE 4LU9A 4P78A 1RQ0A 4R03A 2E5LE 4K0KE 4NXNE 4OOGC 1YZ9A 4DR6E 2JY9A 3ADLA 1HNXE 2M4IA 2YZTA 3KWRA 4X66E 1WHQA 2LUPB 4JI2E 4GKKE 2CPNA 4LF9E 4DR2E 2V88A 2RSMA 4BMJA 2V8QB 4X65E 4DV4E 4JYAE 1O0WA 3VYXA 2MC6A 2RTXA 2NA2A 2JVAA 4M30A 2V85A 3RMPA 1UILA 3K6QA 4GEQB 1XMQE 4F9AB 1WXRA 3LMLA 2RS6A 3C4BA 4L8NA 2UXCE 3OMLA 4DUZE 2L2KB 3T1HE 1DI2A 4JI1E 1IBLE 4LF7E 1ZBQA 4X8WA 5AE1A 2JWOA 2UU9E 3FIGA 2V87A 2DMYA 2LBSB 4JI6E 2LJHA 4WFTA 4L5NC 2VF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE E;  2L2N A;  4DR1 E;  1IBK E;  4DKK A;  1FKA E;  2UUC E;  2KHX A;  4NXM E;  5CFF E;  2B3T B;  3T1Y E;  3LLH A;  4GKJ E;  3HTX A;  4YHH E;  1T4L B;  4DV6 E;  1EKZ A;  1N36 E;  4DV3 E;  4DV2 E;  3P1X A;  2HHH E;  1XNQ E;  2DIX A;  4DV0 E;  2B7T A;  3OTO E;  2L2M A;  2UUA E;  4LF8 E;  1HNZ E;  1J26 A;  2NUE A;  2NUF A;  2LTR A;  4JI8 E;  3ADG A;  2UUB E;  1T4O A;  1X49 A;  1ZBT A;  2L33 A;  5LMU E;  1XMO E;  2UXB E;  1YYO A;  4LFB E;  4DR5 E;  3J7Y p;  1HNW E;  1N33 E;  4LF4 E;  2L3J A;  4LF6 E;  4M2Z A;  4JI7 E;  4B3R E;  4B3M E;  2LTS A;  4X64 E;  4DV1 E;  2ZM6 E;  4OX9 E;  4B3S E;  2EZ6 A;  4DV5 E;  2RS7 A;  4JI0 E;  2DB2 A;  5BR8 E;  1PKP A;  1HR0 E;  4YY3 E;  1T4N A;  2IHR 1;  4B3T E;  1GQE A;  3C4T A;  1IBM E;  2YT4 A;  2MDR A;  4DR3 E;  2B7V A;  4JI4 E;  4JV5 E;  1FJG E;  5IWA E;  4LF5 E;  4KHP E;  1UHZ A;  1X47 A;  4X62 E;  2UXD E;  1RC7 A;  4AQY E;  1J5E E;  4DR4 E;  4JI3 E;  4DR7 E;  2LRS A;  1N32 E;  3ADI A;  4LFC E;  1QU6 A;  1XNR E;  3VYY A;  2F4V E;  2LUQ A;  1STU A;  1N34 E;  5LMN E;  4DUY E;  2VQF E;  4JI5 E;  2N3G A;  2L3C A;  1YYW A;  2NUG A;  1WHN A;  1YYK A;  3ADJ A;  4WYQ B;  1X48 A;  4DV7 E;  2N3H A;  1I94 E;  4LFA E;  1RQ0 A;  2E5L E;  4K0K E;  4NXN E;  4OOG C;  1YZ9 A;  4DR6 E;  2JY9 A;  3ADL A;  1HNX E;  4X66 E;  1WHQ A;  2LUP B;  4JI2 E;  4GKK E;  2CPN A;  4LF9 E;  4DR2 E;  4X65 E;  2RSM A;  4DV4 E;  4JYA E;  1O0W A;  3VYX A;  2RTX A;  2NA2 A;  2JVA A;  4M30 A;  1UIL A;  1XMQ E;  2RS6 A;  3C4B A;  2UXC E;  4DUZ E;  2L2K B;  3T1H E;  1DI2 A;  4JI1 E;  1IBL E;  4LF7 E;  4X8W A;  2UU9 E;  2LBS B;  2DMY A;  4JI6 E;  2LJH A;  4WFT A; 
#chains in the Genus database with same CATH topology
 3DJW A;  2PRT A;  1DGC A;  1FKA E;  5DNY A;  2YWQ A;  3KZZ A;  2UUC E;  2DLQ A;  3IWD A;  4HTG A;  2LVH A;  4BCA A;  5CFF E;  1YUJ A;  3LLH A;  1ZR9 A;  1B69 A;  1EKZ A;  4KZS A;  2HHH E;  2HJJ A;  2L2M A;  2EN4 A;  4F9C B;  4O4K A;  2NUE A;  2NUF A;  4JI8 E;  3ADG A;  1T4O A;  1WRJ A;  5TSE A;  1YYO A;  4DR5 E;  3J7Y p;  2FTX B;  4LF4 E;  5ADZ A;  4LF6 E;  4B3R E;  4B3M E;  2WBT A;  5KL3 A;  2L8T A;  4WSG A;  1DQ3 A;  4IS1 C;  1PDA A;  3UK3 C;  3IWB A;  2EN8 A;  1MGT A;  4OX9 E;  2ZM6 E;  4M0V A;  2EN6 A;  2EZ6 A;  2Q8U A;  2RS7 A;  3EPH A;  2M1S A;  2IHR 1;  1GQE A;  2EPU A;  5LL6 R;  4WXD A;  5AE3 A;  2JR1 A;  2EOJ A;  2B7V A;  1X6H A;  1X47 A;  2UXD E;  3HQ1 A;  2EM6 A;  3L00 A;  2LMZ A;  2EOO A;  2EPX A;  2EN2 A;  3ADI A;  1N32 E;  1QU6 A;  1XNR E;  2V86 A;  4WSP A;  3JTZ A;  1STU A;  1X6E A;  1N34 E;  2EN7 A;  2BBG A;  2VQF E;  2FV4 B;  2N3G A;  5KL5 A;  1YFH A;  1YYW A;  4Q35 B;  1WJP A;  1YYK A;  3ADJ A;  2RQL A;  2JP9 A;  2EOQ A;  4WYQ B;  2EMY A;  3QG5 C;  2WZO A;  3VHT B;  1GTK A;  4R2E A;  2EPK X;  2E5L E;  1YZ9 A;  2JY9 A;  3EQ1 A;  2EL4 A;  2YZT A;  1WHQ A;  2CPN A;  4BMJ A;  1TF3 A;  1O0W A;  2LT7 A;  3VYX A;  1AH5 A;  3K6Q A;  1XMQ E;  4F6N A;  1A1K A;  3LML A;  2RS6 A;  3OML A;  4DUZ E;  1DI2 A;  4LF7 E;  2EN3 A;  4F6M A;  4X8W A;  3FIG A;  2BB8 A;  2DMY A;  2LBS B;  2DLK A;  2VF1 A;  2GPI A;  2EPA A;  2R76 A;  1IQO A;  4R8O A;  4R2C A;  2CTD A;  2KHX A;  2B3T B;  5A6A A;  5A69 A;  4ZYD A;  2MDG A;  1UN6 B;  3HTX A;  2EMF A;  3KZY A;  4DV6 E;  2YTI A;  3P1X A;  2HC5 A;  2DIX A;  2KON A;  2B7T A;  4LF8 E;  5F3W A;  2K7I A;  1J26 A;  2EM0 A;  1ZBT A;  1XMO E;  3IWC A;  5LMU E;  2UXB E;  4LFB E;  4BHC A;  1LLM C;  1N33 E;  4JI7 E;  2EOI A;  2L6M A;  4F54 A;  4X64 E;  2EWL A;  1A1I A;  2EMA A;  2MC5 A;  5KL4 A;  4DV5 E;  4JI0 E;  2JOX A;  2E1M A;  1EH7 A;  2H36 X;  2EPM X;  4YY3 E;  1T4N A;  4R2Q A;  2EMH A;  4FK5 C;  4X9J A;  1YSA C;  2HGH A;  2EPL X;  3BGH A;  1IBM E;  1RMD A;  1Z1B A;  3VK6 A;  4DR3 E;  2VE7 C;  3MSW A;  3M99 B;  4HEI A;  4KHP E;  3HPS A;  2EOM A;  1RC7 A;  4AQY E;  4P7D A;  3THO B;  2YTE A;  5A6J A;  5IT9 C;  2RSI A;  3J7A G;  2R1F A;  2ODR D;  3C6K A;  1G2F C;  2D9H A;  4JI5 E;  1BBG A;  2B9D A;  4R2P A;  1WHN A;  2WBS A;  1UBD C;  1YPN A;  4I8O A;  1X48 A;  3ZOQ B;  4DV7 E;  2A25 A;  2N3H A;  4LFA E;  4LU9 A;  5IXM B;  2EMZ A;  4K0K E;  4NXN E;  2GLI A;  3ADL A;  1HNX E;  3KWR A;  2LUP B;  4LF9 E;  1X6F A;  4X65 E;  2RSM A;  3EPK A;  4DR2 E;  2EOR A;  2EMG A;  2EP3 A;  2YU5 A;  1ZU1 A;  2YTF A;  1TN9 A;  4GEQ B;  2YTN A;  1L4S A;  2EOZ A;  4NZV A;  2EM7 A;  1BB8 A;  4JI1 E;  2ENA A;  5AE1 A;  4RH8 A;  2JWO A;  4JI6 E;  2LJH A;  1YUI A;  1PJT A;  2L2N A;  4DR1 E;  1IBK E;  2CT1 A;  2F8B A;  2LV2 A;  5A6K A;  2DSY A;  1KYQ A;  4F9B B;  4NHR A;  2EE8 A;  4DV3 E;  4DV2 E;  2EL5 A;  1G2D C;  5KL2 A;  3OTO E;  3EPJ A;  4KWY A;  2G7H A;  4M9V C;  3AV0 A;  1N3G A;  2M9A A;  2RPC A;  1A1J A;  2I13 A;  2ELY A;  3EPL A;  4M2Z A;  5AAS A;  2ENC A;  2EMB A;  2JYA A;  4R2D A;  3F6G A;  3J81 C;  2N8X A;  5FLX C;  4DV1 E;  5A6B A;  1EH6 A;  2DGC A;  1IQS A;  4B3S E;  2V89 A;  1A1H A;  2EQ3 A;  2YSP A;  5BR8 E;  2MKN A;  1PKP A;  2EM5 A;  4MLQ A;  3J80 C;  2EOH A;  1ZAA C;  1IMU A;  1P47 A;  2YT4 A;  1JK2 A;  1NEI A;  4JI4 E;  1T39 A;  1FJG E;  1A1G A;  5IWA E;  2K4V A;  4LF5 E;  4BS9 A;  1A1L A;  3BID A;  2EM3 A;  2EOF A;  4X62 E;  1J5E E;  2LRS A;  2E72 A;  3THN A;  3VYY A;  4GZN C;  4TUI A;  4BC7 A;  2F4V E;  1SFE A;  2LUQ A;  5AC4 A;  2M7Q A;  2EL6 A;  4BC9 A;  2L3C A;  3AUZ A;  2NUG A;  1JK1 A;  5T6J A;  2EM2 A;  5LLQ A;  2EMI A;  2EM9 A;  3C6M A;  2ODR C;  1I94 E;  1X5W A;  4O24 A;  4P78 A;  4OOG C;  2EPN A;  2EJ4 A;  4X66 E;  2YRH A;  4JI2 E;  4GKK E;  2YU8 A;  2EPP A;  2ELZ A;  2JPA A;  1KJK A;  2EQ1 A;  4M30 A;  2EOX A;  2V85 A;  3RMP A;  1A1F A;  1UIL A;  2ENH A;  4F9A B;  2EM8 A;  2YPN A;  2MKD A;  4BHB A;  1EH8 A;  2L2K B;  1IBL E;  1ZBQ A;  2J7J A;  3MHS C;  2I9I A;  2UU9 E;  3TQM A;  2YSO A;  4WXC A;  4WFT A;  1PJQ A;  4L5N C;  2VQE E;  2VRD A;  4DKK A;  2DMI A;  4ZYE A;  3HXL A;  3HPZ A;  4NXM E;  4MLV A;  3T1Y E;  3MHH C;  3H09 A;  4GKJ E;  4YHH E;  1T4L B;  5AE2 A;  1N36 E;  2LJU A;  1XNQ E;  2KOU A;  2L92 A;  4DV0 E;  2UUA E;  2YTJ A;  1HNZ E;  2LTR A;  1SR9 A;  2EOS A;  2UUB E;  1X49 A;  2L33 A;  2EN1 A;  2EMK A;  4BBY A;  2WCC 3;  1HNW E;  2EPZ A;  2JXP A;  2L3J A;  4Q28 A;  2ADR A;  3JAM C;  1BBO A;  1NCS A;  5AC5 A;  2YTG A;  4WPY A;  1T38 A;  2CSH A;  2LTS A;  2DRP A;  5A2Q C;  4LTY A;  2EPR A;  4DMI A;  2GHF A;  2V83 A;  2DB2 A;  5IV8 B;  4R2S A;  4TUG A;  1AAY A;  1HR0 E;  2YTD A;  5A6B D;  4B3T E;  3BBG A;  2FGG A;  3C4T A;  2MDR A;  4JV5 E;  3ECR A;  1UHZ A;  2JOB A;  4IJD A;  2YRK A;  2YTQ A;  4DR4 E;  2EMC A;  4JI3 E;  4DR7 E;  4LFC E;  3DF6 A;  2EQ0 A;  3F6H A;  4J8Z A;  2EOE A;  2EPO A;  4RHB B;  5LMN E;  4DUY E;  2EOY A;  3BF2 A;  4WX9 A;  4ZYH A;  1GZ6 A;  5KL7 A;  4R2A A;  2EMX A;  2LE2 A;  1QNT A;  3JU0 A;  1RQ0 A;  2NAB A;  4R03 A;  4O5G A;  2YRM A;  4DR6 E;  2M4I A;  4ZYG A;  2LO3 A;  4F2J C;  1X3C A;  2V88 A;  5KL6 A;  4DV4 E;  2V8Q B;  1MEY C;  4JYA E;  4R2R A;  2EM4 A;  2MC6 A;  1PJS A;  2EMW A;  2RTX A;  2NA2 A;  1TF6 A;  2JVA A;  4O43 A;  1WXR A;  4L8N A;  3C4B A;  2UXC E;  2YTO A;  3T1H E;  4N4R B;  2LCE A;  2EPC A;  2EML A;  2V87 A;  2WBU A;  2YTP A;  1F2I G; 
#chains in the Genus database with same CATH homology
 2VQE E;  2L2N A;  4DR1 E;  3DJW A;  1IBK E;  4DKK A;  3HXL A;  5DNY A;  1FKA E;  3HPZ A;  4R8O A;  2UUC E;  3IWD A;  2F8B A;  2KHX A;  4NXM E;  4BCA A;  2DSY A;  2B3T B;  5CFF E;  3T1Y E;  3H09 A;  3LLH A;  4GKJ E;  4F9B B;  3HTX A;  4YHH E;  1T4L B;  5AE2 A;  4DV6 E;  1EKZ A;  1N36 E;  4DV3 E;  4DV2 E;  3P1X A;  4KZS A;  2HHH E;  2KOU A;  1XNQ E;  2DIX A;  2L92 A;  2KON A;  4DV0 E;  2B7T A;  3OTO E;  2L2M A;  5F3W A;  2UUA E;  4F9C B;  1HNZ E;  4LF8 E;  1J26 A;  2NUE A;  2NUF A;  2LTR A;  1SR9 A;  4JI8 E;  3ADG A;  2G7H A;  2UUB E;  1T4O A;  1X49 A;  1ZBT A;  2L33 A;  3AV0 A;  3IWC A;  4BBY A;  5LMU E;  1YYO A;  1XMO E;  4DR5 E;  4LFB E;  2UXB E;  3J7Y p;  1HNW E;  1N33 E;  2FTX B;  2L3J A;  4Q28 A;  5ADZ A;  4LF4 E;  4LF6 E;  4JI7 E;  3JAM C;  4M2Z A;  4B3M E;  5AAS A;  4B3R E;  2L8T A;  1DQ3 A;  2L6M A;  3F6G A;  4WPY A;  4F54 A;  3J81 C;  5FLX C;  2LTS A;  3IWB A;  4X64 E;  5A2Q C;  4DV1 E;  2ZM6 E;  4OX9 E;  4LTY A;  2EWL A;  4DMI A;  4M0V A;  4B3S E;  2EZ6 A;  2MC5 A;  2V89 A;  4DV5 E;  2RS7 A;  2JOX A;  2V83 A;  4JI0 E;  2E1M A;  2DB2 A;  5BR8 E;  4TUG A;  1PKP A;  1HR0 E;  2H36 X;  2M1S A;  3J80 C;  4YY3 E;  1T4N A;  2IHR 1;  4B3T E;  1GQE A;  2FGG A;  5LL6 R;  3C4T A;  5AE3 A;  1IBM E;  2YT4 A;  2JR1 A;  2MDR A;  3VK6 A;  2B7V A;  4DR3 E;  2VE7 C;  4JI4 E;  1FJG E;  4JV5 E;  5IWA E;  2K4V A;  3MSW A;  4BS9 A;  4LF5 E;  4KHP E;  2JOB A;  1UHZ A;  3HPS A;  1X47 A;  4X62 E;  3HQ1 A;  1RC7 A;  2UXD E;  4AQY E;  1J5E E;  2LMZ A;  4DR4 E;  4JI3 E;  4DR7 E;  2LRS A;  1N32 E;  4P7D A;  3ADI A;  4LFC E;  1QU6 A;  3DF6 A;  1XNR E;  3VYY A;  4TUI A;  2V86 A;  4WSP A;  4BC7 A;  3JTZ A;  5IT9 C;  2LUQ A;  3F6H A;  1STU A;  4J8Z A;  3J7A G;  2F4V E;  1N34 E;  2ODR D;  2M7Q A;  5LMN E;  4DUY E;  4BC9 A;  2FV4 B;  2N3G A;  2L3C A;  3AUZ A;  2B9D A;  2VQF E;  4JI5 E;  1YYW A;  1GZ6 A;  2NUG A;  5T6J A;  1WHN A;  1YYK A;  3ADJ A;  2LE2 A;  3JU0 A;  4WYQ B;  4I8O A;  1X48 A;  3ZOQ B;  4DV7 E;  2N3H A;  2WZO A;  2ODR C;  1I94 E;  4LFA E;  4LU9 A;  4P78 A;  1RQ0 A;  4R03 A;  2E5L E;  4K0K E;  4NXN E;  4OOG C;  1YZ9 A;  4DR6 E;  2JY9 A;  3ADL A;  1HNX E;  2M4I A;  2YZT A;  3KWR A;  4X66 E;  1WHQ A;  2LUP B;  4JI2 E;  4GKK E;  2CPN A;  4LF9 E;  4DR2 E;  2V88 A;  2RSM A;  4BMJ A;  2V8Q B;  4X65 E;  4DV4 E;  4JYA E;  1O0W A;  3VYX A;  2MC6 A;  2RTX A;  2NA2 A;  2JVA A;  4M30 A;  2V85 A;  3RMP A;  1UIL A;  3K6Q A;  4GEQ B;  1XMQ E;  4F9A B;  1WXR A;  3LML A;  2RS6 A;  3C4B A;  4L8N A;  2UXC E;  3OML A;  4DUZ E;  2L2K B;  3T1H E;  1DI2 A;  4JI1 E;  1IBL E;  4LF7 E;  1ZBQ A;  4X8W A;  5AE1 A;  2JWO A;  2UU9 E;  3FIG A;  2V87 A;  2DMY A;  2LBS B;  4JI6 E;  2LJH A;  4WFT A;  4L5N C;  2VF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...