4DKKA

The x-ray crystal structure of the human stau1 ssm-'rbd'5 domain-swapped dimer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
104
Chain Sequence
b'GSKATVTAIARELLYGGTSPTAETILKNNISGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDAALNILKLLSELD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-binding protein Staufen homolog 1
publication title Staufen1 dimerizes through a conserved motif and a degenerate dsRNA-binding domain to promote mRNA decay.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 28
structure length 104
sequence length 112
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dkkA02
1T4NA 4JI8E 2DB2A 4YHHE 1YYOA 3J7Yp 1T4LB 4LFBE 5LMUE 2UUBE 3T1YE 1HNWE 1N32E 2L2NA 2LBSB 4DR2E 2L33A 3C4BA 4LF9E 1J26A 2JY9A 1PKPA 2B3TB 4LF5E 2N3HA 1DI2A 5LMNE 2L3CA 1YZ9A 1EKZA 3VYYA 4DUZE 4WYQB 2VQFE 4DR7E 2F4VE 1QU6A 2YT4A 1N36E 1FJGE 4YY3E 1IBKE 4JI6E 1HNZE 4GKKE 1N33E 5CFFE 1N34E 2L3JA 2UUAE 2UXDE 1J5EE 2RS6A 2EZ6A 4JYAE 4DV0E 2CPNA 1FKAE 5BR8E 4X65E 4JV5E 4DV7E 5IWAE 4B3SE 4B3TE 2B7TA 2DMYA 4DV3E 3T1HE 4DR5E 3VYXA 4JI5E 3OTOE 2LUPB 2NUFA 1YYWA 4NXNE 4X62E 4M30A 4WFTA 2N3GA 4M2ZA 2L2MA 2LJHA 4JI1E 4X66E 2NUEA 1RC7A 4LF7E 1XMQE 4DKKA 2NA2A 4B3RE 1ZBTA 4JI7E 1XNQE 1WHNA 1GQEA 4JI4E 1T4OA 2KHXA 4DR3E 4K0KE 3ADJA 4X8WA 4DV5E 1O0WA 4DV1E 1HNXE 1XMOE 4LF4E 2L2KB 4AQYE 4B3ME 1RQ0A 4JI0E 1IBLE 3HTXA 1XNRE 1X49A 1WHQA 2LUQA 2VQEE 1UHZA 1X48A 4DR1E 1UILA 4DR4E 2JVAA 4NXME 2RTXA 1I94E 2UXBE 1STUA 4X64E 2LRSA 2UUCE 4OOGC 2HHHE 4LF6E 4DV2E 2LTSA 2DIXA 3P1XA 1HR0E 3ADGA 4GKJE 4JI2E 4DR6E 3ADLA 2E5LE 1IBME 4DV4E 3C4TA 2B7VA 4JI3E 4DUYE 2IHR1 2UU9E 2ZM6E 1X47A 2RSMA 2MDRA 4KHPE 1YYKA 2LTRA 4LF8E 2NUGA 2UXCE 3ADIA 4OX9E 4DV6E 4LFAE 2RS7A 4LFCE 3LLHA
chains in the Genus database with same CATH superfamily
4JI8E 2V88A 4N4RB 1PJTA 1DGCA 2YTFA 2UUBE 1HNWE 2YTJA 2L2NA 5LL6R 2CT1A 3C4BA 4LF9E 5T6JA 1A1JA 1PKPA 4TUIA 5IT9C 1YZ9A 4DUZE 3F6HA 2CTDA 4F2JC 2MC6A 2EM2A 4R2CA 4DR7E 2WCC3 1ZAAC 2K7IA 2VRDA 3EQ1A 2GPIA 5AE2A 2GHFA 1N36E 1MGTA 1IBKE 2RPCA 5FLXC 5AE3A 2NABA 1ZR9A 4R8OA 3L00A 2YTOA 2ODRC 1WXRA 1YUJA 4DV0E 2CPNA 2EOEA 1B69A 4X65E 5LLQA 1SR9A 4L5NC 4B3SE 2J7JA 2LMZA 2VF1A 2YTNA 1A1GA 2EM7A 3BBGA 2JXPA 2B9DA 2BB8A 4M30A 4WFTA 2MDGA 1JK1A 4JI1E 2ODRD 2EMWA 1A1FA 2EORA 1IMUA 4B3RE 5A2QC 2MC5A 1RMDA 1ZBTA 2DSYA 2ENAA 1WHNA 4BS9A 5A6AA 4L8NA 2V83A 4AQYE 3HTXA 3ECRA 4F6MA 2R1FA 2RQLA 1UILA 3C6MA 2JVAA 4F9BB 1I94E 2EOQA 3F6GA 2LRSA 4R2QA 2EPOA 2JYAA 2M9AA 1HR0E 4BCAA 4R2PA 2EJ4A 2R76A 1TN9A 2B7VA 2EOOA 3HPSA 1BBOA 1X47A 2EMXA 1YYKA 4LF8E 2EPNA 4R2DA 3M99B 2UXCE 2HJJA 4LFAE 1FKAE 1NEIA 4LFCE 2EPPA 1T4NA 2EPCA 4BMJA 1A1LA 2LV2A 4R2RA 4YHHE 1WJPA 2DLQA 3IWDA 4WSGA 3RMPA 2MKDA 2L33A 1J26A 2JY9A 4F9CB 2DMIA 2D9HA 2EMFA 2L3CA 2YRKA 5ADZA 3VYYA 2VQFE 1YSAC 1KYQA 2FGGA 3VHTB 2EPXA 4BC9A 2M4IA 4YY3E 4JI6E 4GKKE 5CFFE 2FTXB 2K4VA 3EPHA 1UBDC 2UXDE 3J81C 1ZBQA 5F3WA 2KOUA 3MHSC 4HEIA 2N8XA 4ZYHA 2G7HA 5IWAE 2YRHA 4B3TE 2B7TA 2EL6A 2EN1A 4JI5E 1AH5A 1YYWA 2EOMA 3K6QA 2ENHA 2YU8A 4X62E 2MKNA 2LVHA 2L2MA 2KONA 2LJHA 2EMAA 4F6NA 2EPUA 4X66E 2EOZA 5AC5A 2JPAA 3FIGA 4WXCA 4ZYGA 2EM5A 4DKKA 2YTIA 2EM6A 1IQSA 2KHXA 2BBGA 3ADJA 4F9AB 4X8WA 4DV5E 1HNXE 1X3CA 1XMOE 1T38A 5KL3A 2L2KB 2L92A 5AASA 1ZU1A 1YPNA 1XNRE 5KL5A 2ELYA 3DJWA 2EL5A 2LUQA 3DF6A 2VQEE 1AAYA 4BHCA 1KJKA 1DQ3A 2RTXA 2EMCA 2UXBE 1STUA 1A1HA 4X64E 2UUCE 5KL2A 2HHHE 4LF6E 1NCSA 2I9IA 1PJSA 2YPNA 1PJQA 2YU5A 4WPYA 3P1XA 3HQ1A 3EPKA 2EWLA 4JI2E 4DR6E 1X6FA 2E5LE 2EOFA 5KL7A 2IHR1 1MEYC 5A6KA 2YSPA 4Q28A 1P47A 4BBYA 2Q8UA 2L8TA 2LTRA 2EOYA 4ZYDA 2ENCA 2EN7A 2DGCA 4DV6E 2WBTA 2EP3A 4WSPA 4O5GA 2DRPA 1T4LB 5LMUE 1N32E 2EOXA 2EM0A 4DR2E 4M9VC 2EL4A 2B3TB 2EMHA 2JOBA 1DI2A 5A6BD 5LMNE 4WYQB 2F4VE 4WXDA 3J80C 4Q35B 2EM4A 2EPMX 1QU6A 2VE7C 3IWCA 1A1IA 1HNZE 1EH6A 1N33E 3VK6A 1N34E 2L3JA 2RS6A 4BC7A 4NHRA 4P7DA 2A25A 5BR8E 2LE2A 2EE8A 2EPLX 2JR1A 1TF3A 5KL4A 2EQ0A 1GZ6A 3TQMA 2DMYA 2WBSA 5IV8B 5AE1A 3VYXA 2YTEA 3ZOQB 3OTOE 3C6KA 2NUFA 4O43A 3HXLA 3KZZA 2GLIA 3JAMC 4F54A 5TSEA 3OMLA 2CSHA 3EPJA 1RC7A 2NUEA 2EMYA 4KWYA 1XMQE 4MLQA 2EN4A 2NA2A 2ELZA 4J8ZA 4JI7E 1Z1BA 4M0VA 4GZNC 2ADRA 1GQEA 4JI4E 2JP9A 4NZVA 1O0WA 4DV1E 4P78A 1EH7A 4LF4E 2EM3A 1JK2A 4JI0E 4IS1C 1IBLE 2YWQA 2EPRA 1GTKA 4R03A 1WHQA 2EMZA 3H09A 4O24A 1UHZA 2YTQA 4DR4E 4NXME 4I8OA 2EM9A 4R2SA 3THNA 4OOGC 4IJDA 2LTSA 2EOSA 2DIXA 1G2DC 2EPKX 2I13A 2WBUA 4GKJE 4R2AA 2F8BA 2YZTA 5KL6A 1IBME 1WRJA 3C4TA 4DV4E 5AC4A 1PDAA 4JI3E 4DUYE 4RHBB 2HC5A 2H36X 2JWOA 2V86A 2ZM6E 1YFHA 2RSMA 2MDRA 1L4SA 4KHPE 3KZYA 2L6MA 4GEQB 4FK5C 2LT7A 2NUGA 2EMGA 3BF2A 3ADIA 2M7QA 1X6HA 2EOHA 4DMIA 2DLKA 1BB8A 2DB2A 1YYOA 4LTYA 3J7Yp 4LFBE 3J7AG 2YSOA 2EOIA 3T1YE 1IQOA 2LBSB 1N3GA 5IXMB 1YUIA 4HTGA 2N3HA 2EMBA 2YTPA 4LF5E 1EKZA 3KWRA 2LO3A 1X5WA 3UK3C 2EN2A 4MLVA 4X9JA 1LLMC 2YT4A 4KZSA 1TF6A 1FJGE 3AV0A 2YRMA 3EPLA 2UUAE 2LJUA 1X6EA 1J5EE 2EZ6A 1F2IG 2EN6A 4JYAE 5A69A 4WX9A 4BHBA 2EOJA 2EMIA 4DV7E 4JV5E 2EPAA 2E72A 2HGHA 3JTZA 4DV3E 3T1HE 4DR5E 2EM8A 3JU0A 2FV4B 2LUPB 2V89A 2EN8A 4NXNE 2N3GA 4M2ZA 2EMKA 2M1SA 3AUZA 4LF7E 2JOXA 4ZYEA 5A6BA 2V8QB 1QNTA 2V85A 1XNQE 3MSWA 3IWBA 1G2FC 4K0KE 1T4OA 4TUGA 4DR3E 2E1MA 3THOB 3MHHC 2YTDA 2PRTA 2RSIA 3HPZA 4B3ME 1RQ0A 1X49A 3QG5C 1X48A 2EN3A 2WZOA 4DR1E 3BIDA 1EH8A 4LU9A 4R2EA 4DV2E 5A6JA 3LMLA 2EQ3A 3ADGA 3ADLA 4RH8A 1T39A 3BGHA 1UN6B 1BBGA 2UU9E 1A1KA 5DNYA 2EMLA 2YTGA 2V87A 4O4KA 2EQ1A 1SFEA 4OX9E 2RS7A 2LCEA 2EPZA 3LLHA
chains in the Genus database with same CATH topology
1T4NA 2V88A 4WSPA 4JI8E 4BMJA 4JI4E 2DB2A 4YHHE 4LTYA 3J7Yp 1YYOA 1T4LB 4LFBE 4K0KE 3IWDA 5LMUE 2UUBE 3J7AG 3T1YE 1HNWE 1N32E 2L2NA 5LL6R 3RMPA 2LBSB 4DR2E 2L33A 3C4BA 4LF9E 1J26A 5T6JA 2JY9A 1PKPA 4F9CB 2B3TB 2JOBA 4LF5E 2N3HA 1DI2A 4TUIA 5LMNE 2L3CA 5IT9C 1YZ9A 1EKZA 5ADZA 3F6HA 3KWRA 3VYYA 2MC6A 4WYQB 2VQFE 4DUZE 4DR7E 2F4VE 3J80C 5AE2A 1QU6A 2FGGA 2YT4A 4KZSA 4BC9A 1N36E 2M4IA 2VE7C 1FJGE 3AV0A 3IWCA 4YY3E 5FLXC 1IBKE 5AE3A 1HNZE 4JI6E 5CFFE 2K4VA 2FTXB 4GKKE 3VK6A 1N34E 1N33E 2L3JA 4R8OA 2UUAE 2UXDE 1J5EE 2RS6A 4BC7A 2EZ6A 3J81C 2ODRC 1ZBQA 1WXRA 5F3WA 4JYAE 4P7DA 2KOUA 4DV0E 2CPNA 1FKAE 5BR8E 2LE2A 4X65E 4JV5E 2JR1A 4DV7E 2G7HA 1SR9A 5IWAE 4L5NC 3JTZA 4B3SE 4B3TE 2B7TA 1GZ6A 2LMZA 2DMYA 4DV3E 3T1HE 2VF1A 4DR5E 5AE1A 3JU0A 3VYXA 4JI5E 2FV4B 3ZOQB 3OTOE 2LUPB 2V89A 2NUFA 1YYWA 3K6QA 4NXNE 3HXLA 4X62E 2B9DA 4M30A 3JAMC 2N3GA 4WFTA 4M2ZA 2L2MA 2KONA 2LJHA 4JI1E 2ODRD 4F54A 2M1SA 3OMLA 4X66E 3FIGA 1RC7A 2NUEA 3AUZA 4LF7E 2JOXA 1XMQE 4DKKA 2NA2A 4B3RE 5A2QC 2MC5A 1ZBTA 2DSYA 2V8QB 2V85A 4J8ZA 4JI7E 1WHNA 3MSWA 3IWBA 4M0VA 1XNQE 1GQEA 4BS9A 1T4OA 2KHXA 4TUGA 2E1MA 3ADJA 4L8NA 4F9AB 4DR3E 4X8WA 4DV5E 1O0WA 4DV1E 1HNXE 4P78A 2V83A 1XMOE 4LF4E 2L2KB 3HPZA 2L92A 4AQYE 4B3ME 1RQ0A 5AASA 4JI0E 1IBLE 3HTXA 1XNRE 1X49A 4R03A 3DJWA 1WHQA 3H09A 2LUQA 3DF6A 2VQEE 1UHZA 1X48A 2WZOA 4DR1E 1DQ3A 1UILA 4DR4E 2JVAA 4F9BB 2RTXA 1I94E 4I8OA 1STUA 4NXME 2UXBE 3F6GA 4X64E 2LRSA 2UUCE 4LU9A 4OOGC 2HHHE 4LF6E 4DV2E 2LTSA 2DIXA 4WPYA 3LMLA 3P1XA 3HQ1A 1HR0E 3ADGA 2EWLA 4GKJE 2F8BA 4JI2E 4BCAA 4DR6E 3ADLA 2E5LE 2YZTA 1IBME 4DV4E 3C4TA 2B7VA 4JI3E 4DUYE 2H36X 2IHR1 2JWOA 3HPSA 4Q28A 2UU9E 2V86A 4BBYA 2ZM6E 1X47A 5DNYA 2RSMA 2MDRA 4KHPE 2L8TA 2L6MA 2LTRA 4GEQB 4LF8E 2V87A 1YYKA 2NUGA 2UXCE 3ADIA 4OX9E 2M7QA 4DV6E 4LFAE 2RS7A 4LFCE 3LLHA 4DMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4N A;  4JI8 E;  2DB2 A;  4YHH E;  1YYO A;  3J7Y p;  1T4L B;  4LFB E;  5LMU E;  2UUB E;  3T1Y E;  1HNW E;  1N32 E;  2L2N A;  2LBS B;  4DR2 E;  2L33 A;  3C4B A;  4LF9 E;  1J26 A;  2JY9 A;  1PKP A;  2B3T B;  4LF5 E;  2N3H A;  1DI2 A;  5LMN E;  2L3C A;  1YZ9 A;  1EKZ A;  3VYY A;  4DUZ E;  4WYQ B;  2VQF E;  4DR7 E;  2F4V E;  1QU6 A;  2YT4 A;  1N36 E;  1FJG E;  4YY3 E;  1IBK E;  4JI6 E;  1HNZ E;  4GKK E;  1N33 E;  5CFF E;  1N34 E;  2L3J A;  2UUA E;  2UXD E;  1J5E E;  2RS6 A;  2EZ6 A;  4JYA E;  4DV0 E;  2CPN A;  1FKA E;  5BR8 E;  4X65 E;  4JV5 E;  4DV7 E;  5IWA E;  4B3S E;  4B3T E;  2B7T A;  2DMY A;  4DV3 E;  3T1H E;  4DR5 E;  3VYX A;  4JI5 E;  3OTO E;  2LUP B;  2NUF A;  1YYW A;  4NXN E;  4X62 E;  4M30 A;  4WFT A;  2N3G A;  4M2Z A;  2L2M A;  2LJH A;  4JI1 E;  4X66 E;  2NUE A;  1RC7 A;  4LF7 E;  1XMQ E;  4DKK A;  2NA2 A;  4B3R E;  1ZBT A;  4JI7 E;  1XNQ E;  1WHN A;  1GQE A;  4JI4 E;  1T4O A;  2KHX A;  4DR3 E;  4K0K E;  3ADJ A;  4X8W A;  4DV5 E;  1O0W A;  4DV1 E;  1HNX E;  1XMO E;  4LF4 E;  2L2K B;  4AQY E;  4B3M E;  1RQ0 A;  4JI0 E;  1IBL E;  3HTX A;  1XNR E;  1X49 A;  1WHQ A;  2LUQ A;  2VQE E;  1UHZ A;  1X48 A;  4DR1 E;  1UIL A;  4DR4 E;  2JVA A;  4NXM E;  2RTX A;  1I94 E;  2UXB E;  1STU A;  4X64 E;  2LRS A;  2UUC E;  4OOG C;  2HHH E;  4LF6 E;  4DV2 E;  2LTS A;  2DIX A;  3P1X A;  1HR0 E;  3ADG A;  4GKJ E;  4JI2 E;  4DR6 E;  3ADL A;  2E5L E;  1IBM E;  4DV4 E;  3C4T A;  2B7V A;  4JI3 E;  4DUY E;  2IHR 1;  2UU9 E;  2ZM6 E;  1X47 A;  2RSM A;  2MDR A;  4KHP E;  1YYK A;  2LTR A;  4LF8 E;  2NUG A;  2UXC E;  3ADI A;  4OX9 E;  4DV6 E;  4LFA E;  2RS7 A;  4LFC E;  3LLH A; 
#chains in the Genus database with same CATH topology
 4JI8 E;  2V88 A;  4N4R B;  1PJT A;  1DGC A;  2YTF A;  2UUB E;  1HNW E;  2YTJ A;  2L2N A;  5LL6 R;  2CT1 A;  3C4B A;  4LF9 E;  5T6J A;  1A1J A;  1PKP A;  4TUI A;  5IT9 C;  1YZ9 A;  4DUZ E;  3F6H A;  2CTD A;  4F2J C;  2MC6 A;  2EM2 A;  4R2C A;  4DR7 E;  2WCC 3;  1ZAA C;  2K7I A;  2VRD A;  3EQ1 A;  2GPI A;  5AE2 A;  2GHF A;  1N36 E;  1MGT A;  1IBK E;  2RPC A;  5FLX C;  5AE3 A;  2NAB A;  1ZR9 A;  4R8O A;  3L00 A;  2YTO A;  2ODR C;  1WXR A;  1YUJ A;  4DV0 E;  2CPN A;  2EOE A;  1B69 A;  4X65 E;  5LLQ A;  1SR9 A;  4L5N C;  4B3S E;  2J7J A;  2LMZ A;  2VF1 A;  2YTN A;  1A1G A;  2EM7 A;  3BBG A;  2JXP A;  2B9D A;  2BB8 A;  4M30 A;  4WFT A;  2MDG A;  1JK1 A;  4JI1 E;  2ODR D;  2EMW A;  1A1F A;  2EOR A;  1IMU A;  4B3R E;  5A2Q C;  2MC5 A;  1RMD A;  1ZBT A;  2DSY A;  2ENA A;  1WHN A;  4BS9 A;  5A6A A;  4L8N A;  2V83 A;  4AQY E;  3HTX A;  3ECR A;  4F6M A;  2R1F A;  2RQL A;  1UIL A;  3C6M A;  2JVA A;  4F9B B;  1I94 E;  2EOQ A;  3F6G A;  2LRS A;  4R2Q A;  2EPO A;  2JYA A;  2M9A A;  1HR0 E;  4BCA A;  4R2P A;  2EJ4 A;  2R76 A;  1TN9 A;  2B7V A;  2EOO A;  3HPS A;  1BBO A;  1X47 A;  2EMX A;  1YYK A;  4LF8 E;  2EPN A;  4R2D A;  3M99 B;  2UXC E;  2HJJ A;  4LFA E;  1FKA E;  1NEI A;  4LFC E;  2EPP A;  1T4N A;  2EPC A;  4BMJ A;  1A1L A;  2LV2 A;  4R2R A;  4YHH E;  1WJP A;  2DLQ A;  3IWD A;  4WSG A;  3RMP A;  2MKD A;  2L33 A;  1J26 A;  2JY9 A;  4F9C B;  2DMI A;  2D9H A;  2EMF A;  2L3C A;  2YRK A;  5ADZ A;  3VYY A;  2VQF E;  1YSA C;  1KYQ A;  2FGG A;  3VHT B;  2EPX A;  4BC9 A;  2M4I A;  4YY3 E;  4JI6 E;  4GKK E;  5CFF E;  2FTX B;  2K4V A;  3EPH A;  1UBD C;  2UXD E;  3J81 C;  1ZBQ A;  5F3W A;  2KOU A;  3MHS C;  4HEI A;  2N8X A;  4ZYH A;  2G7H A;  5IWA E;  2YRH A;  4B3T E;  2B7T A;  2EL6 A;  2EN1 A;  4JI5 E;  1AH5 A;  1YYW A;  2EOM A;  3K6Q A;  2ENH A;  2YU8 A;  4X62 E;  2MKN A;  2LVH A;  2L2M A;  2KON A;  2LJH A;  2EMA A;  4F6N A;  2EPU A;  4X66 E;  2EOZ A;  5AC5 A;  2JPA A;  3FIG A;  4WXC A;  4ZYG A;  2EM5 A;  4DKK A;  2YTI A;  2EM6 A;  1IQS A;  2KHX A;  2BBG A;  3ADJ A;  4F9A B;  4X8W A;  4DV5 E;  1HNX E;  1X3C A;  1XMO E;  1T38 A;  5KL3 A;  2L2K B;  2L92 A;  5AAS A;  1ZU1 A;  1YPN A;  1XNR E;  5KL5 A;  2ELY A;  3DJW A;  2EL5 A;  2LUQ A;  3DF6 A;  2VQE E;  1AAY A;  4BHC A;  1KJK A;  1DQ3 A;  2RTX A;  2EMC A;  2UXB E;  1STU A;  1A1H A;  4X64 E;  2UUC E;  5KL2 A;  2HHH E;  4LF6 E;  1NCS A;  2I9I A;  1PJS A;  2YPN A;  1PJQ A;  2YU5 A;  4WPY A;  3P1X A;  3HQ1 A;  3EPK A;  2EWL A;  4JI2 E;  4DR6 E;  1X6F A;  2E5L E;  2EOF A;  5KL7 A;  2IHR 1;  1MEY C;  5A6K A;  2YSP A;  4Q28 A;  1P47 A;  4BBY A;  2Q8U A;  2L8T A;  2LTR A;  2EOY A;  4ZYD A;  2ENC A;  2EN7 A;  2DGC A;  4DV6 E;  2WBT A;  2EP3 A;  4WSP A;  4O5G A;  2DRP A;  1T4L B;  5LMU E;  1N32 E;  2EOX A;  2EM0 A;  4DR2 E;  4M9V C;  2EL4 A;  2B3T B;  2EMH A;  2JOB A;  1DI2 A;  5A6B D;  5LMN E;  4WYQ B;  2F4V E;  4WXD A;  3J80 C;  4Q35 B;  2EM4 A;  2EPM X;  1QU6 A;  2VE7 C;  3IWC A;  1A1I A;  1HNZ E;  1EH6 A;  1N33 E;  3VK6 A;  1N34 E;  2L3J A;  2RS6 A;  4BC7 A;  4NHR A;  4P7D A;  2A25 A;  5BR8 E;  2LE2 A;  2EE8 A;  2EPL X;  2JR1 A;  1TF3 A;  5KL4 A;  2EQ0 A;  1GZ6 A;  3TQM A;  2DMY A;  2WBS A;  5IV8 B;  5AE1 A;  3VYX A;  2YTE A;  3ZOQ B;  3OTO E;  3C6K A;  2NUF A;  4O43 A;  3HXL A;  3KZZ A;  2GLI A;  3JAM C;  4F54 A;  5TSE A;  3OML A;  2CSH A;  3EPJ A;  1RC7 A;  2NUE A;  2EMY A;  4KWY A;  1XMQ E;  4MLQ A;  2EN4 A;  2NA2 A;  2ELZ A;  4J8Z A;  4JI7 E;  1Z1B A;  4M0V A;  4GZN C;  2ADR A;  1GQE A;  4JI4 E;  2JP9 A;  4NZV A;  1O0W A;  4DV1 E;  4P78 A;  1EH7 A;  4LF4 E;  2EM3 A;  1JK2 A;  4JI0 E;  4IS1 C;  1IBL E;  2YWQ A;  2EPR A;  1GTK A;  4R03 A;  1WHQ A;  2EMZ A;  3H09 A;  4O24 A;  1UHZ A;  2YTQ A;  4DR4 E;  4NXM E;  4I8O A;  2EM9 A;  4R2S A;  3THN A;  4OOG C;  4IJD A;  2LTS A;  2EOS A;  2DIX A;  1G2D C;  2EPK X;  2I13 A;  2WBU A;  4GKJ E;  4R2A A;  2F8B A;  2YZT A;  5KL6 A;  1IBM E;  1WRJ A;  3C4T A;  4DV4 E;  5AC4 A;  1PDA A;  4JI3 E;  4DUY E;  4RHB B;  2HC5 A;  2H36 X;  2JWO A;  2V86 A;  2ZM6 E;  1YFH A;  2RSM A;  2MDR A;  1L4S A;  4KHP E;  3KZY A;  2L6M A;  4GEQ B;  4FK5 C;  2LT7 A;  2NUG A;  2EMG A;  3BF2 A;  3ADI A;  2M7Q A;  1X6H A;  2EOH A;  4DMI A;  2DLK A;  1BB8 A;  2DB2 A;  1YYO A;  4LTY A;  3J7Y p;  4LFB E;  3J7A G;  2YSO A;  2EOI A;  3T1Y E;  1IQO A;  2LBS B;  1N3G A;  5IXM B;  1YUI A;  4HTG A;  2N3H A;  2EMB A;  2YTP A;  4LF5 E;  1EKZ A;  3KWR A;  2LO3 A;  1X5W A;  3UK3 C;  2EN2 A;  4MLV A;  4X9J A;  1LLM C;  2YT4 A;  4KZS A;  1TF6 A;  1FJG E;  3AV0 A;  2YRM A;  3EPL A;  2UUA E;  2LJU A;  1X6E A;  1J5E E;  2EZ6 A;  1F2I G;  2EN6 A;  4JYA E;  5A69 A;  4WX9 A;  4BHB A;  2EOJ A;  2EMI A;  4DV7 E;  4JV5 E;  2EPA A;  2E72 A;  2HGH A;  3JTZ A;  4DV3 E;  3T1H E;  4DR5 E;  2EM8 A;  3JU0 A;  2FV4 B;  2LUP B;  2V89 A;  2EN8 A;  4NXN E;  2N3G A;  4M2Z A;  2EMK A;  2M1S A;  3AUZ A;  4LF7 E;  2JOX A;  4ZYE A;  5A6B A;  2V8Q B;  1QNT A;  2V85 A;  1XNQ E;  3MSW A;  3IWB A;  1G2F C;  4K0K E;  1T4O A;  4TUG A;  4DR3 E;  2E1M A;  3THO B;  3MHH C;  2YTD A;  2PRT A;  2RSI A;  3HPZ A;  4B3M E;  1RQ0 A;  1X49 A;  3QG5 C;  1X48 A;  2EN3 A;  2WZO A;  4DR1 E;  3BID A;  1EH8 A;  4LU9 A;  4R2E A;  4DV2 E;  5A6J A;  3LML A;  2EQ3 A;  3ADG A;  3ADL A;  4RH8 A;  1T39 A;  3BGH A;  1UN6 B;  1BBG A;  2UU9 E;  1A1K A;  5DNY A;  2EML A;  2YTG A;  2V87 A;  4O4K A;  2EQ1 A;  1SFE A;  4OX9 E;  2RS7 A;  2LCE A;  2EPZ A;  3LLH A; 
#chains in the Genus database with same CATH homology
 1T4N A;  2V88 A;  4WSP A;  4JI8 E;  4BMJ A;  4JI4 E;  2DB2 A;  4YHH E;  4LTY A;  3J7Y p;  1YYO A;  1T4L B;  4LFB E;  4K0K E;  3IWD A;  5LMU E;  2UUB E;  3J7A G;  3T1Y E;  1HNW E;  1N32 E;  2L2N A;  5LL6 R;  3RMP A;  2LBS B;  4DR2 E;  2L33 A;  3C4B A;  4LF9 E;  1J26 A;  5T6J A;  2JY9 A;  1PKP A;  4F9C B;  2B3T B;  2JOB A;  4LF5 E;  2N3H A;  1DI2 A;  4TUI A;  5LMN E;  2L3C A;  5IT9 C;  1YZ9 A;  1EKZ A;  5ADZ A;  3F6H A;  3KWR A;  3VYY A;  2MC6 A;  4WYQ B;  2VQF E;  4DUZ E;  4DR7 E;  2F4V E;  3J80 C;  5AE2 A;  1QU6 A;  2FGG A;  2YT4 A;  4KZS A;  4BC9 A;  1N36 E;  2M4I A;  2VE7 C;  1FJG E;  3AV0 A;  3IWC A;  4YY3 E;  5FLX C;  1IBK E;  5AE3 A;  1HNZ E;  4JI6 E;  5CFF E;  2K4V A;  2FTX B;  4GKK E;  3VK6 A;  1N34 E;  1N33 E;  2L3J A;  4R8O A;  2UUA E;  2UXD E;  1J5E E;  2RS6 A;  4BC7 A;  2EZ6 A;  3J81 C;  2ODR C;  1ZBQ A;  1WXR A;  5F3W A;  4JYA E;  4P7D A;  2KOU A;  4DV0 E;  2CPN A;  1FKA E;  5BR8 E;  2LE2 A;  4X65 E;  4JV5 E;  2JR1 A;  4DV7 E;  2G7H A;  1SR9 A;  5IWA E;  4L5N C;  3JTZ A;  4B3S E;  4B3T E;  2B7T A;  1GZ6 A;  2LMZ A;  2DMY A;  4DV3 E;  3T1H E;  2VF1 A;  4DR5 E;  5AE1 A;  3JU0 A;  3VYX A;  4JI5 E;  2FV4 B;  3ZOQ B;  3OTO E;  2LUP B;  2V89 A;  2NUF A;  1YYW A;  3K6Q A;  4NXN E;  3HXL A;  4X62 E;  2B9D A;  4M30 A;  3JAM C;  2N3G A;  4WFT A;  4M2Z A;  2L2M A;  2KON A;  2LJH A;  4JI1 E;  2ODR D;  4F54 A;  2M1S A;  3OML A;  4X66 E;  3FIG A;  1RC7 A;  2NUE A;  3AUZ A;  4LF7 E;  2JOX A;  1XMQ E;  4DKK A;  2NA2 A;  4B3R E;  5A2Q C;  2MC5 A;  1ZBT A;  2DSY A;  2V8Q B;  2V85 A;  4J8Z A;  4JI7 E;  1WHN A;  3MSW A;  3IWB A;  4M0V A;  1XNQ E;  1GQE A;  4BS9 A;  1T4O A;  2KHX A;  4TUG A;  2E1M A;  3ADJ A;  4L8N A;  4F9A B;  4DR3 E;  4X8W A;  4DV5 E;  1O0W A;  4DV1 E;  1HNX E;  4P78 A;  2V83 A;  1XMO E;  4LF4 E;  2L2K B;  3HPZ A;  2L92 A;  4AQY E;  4B3M E;  1RQ0 A;  5AAS A;  4JI0 E;  1IBL E;  3HTX A;  1XNR E;  1X49 A;  4R03 A;  3DJW A;  1WHQ A;  3H09 A;  2LUQ A;  3DF6 A;  2VQE E;  1UHZ A;  1X48 A;  2WZO A;  4DR1 E;  1DQ3 A;  1UIL A;  4DR4 E;  2JVA A;  4F9B B;  2RTX A;  1I94 E;  4I8O A;  1STU A;  4NXM E;  2UXB E;  3F6G A;  4X64 E;  2LRS A;  2UUC E;  4LU9 A;  4OOG C;  2HHH E;  4LF6 E;  4DV2 E;  2LTS A;  2DIX A;  4WPY A;  3LML A;  3P1X A;  3HQ1 A;  1HR0 E;  3ADG A;  2EWL A;  4GKJ E;  2F8B A;  4JI2 E;  4BCA A;  4DR6 E;  3ADL A;  2E5L E;  2YZT A;  1IBM E;  4DV4 E;  3C4T A;  2B7V A;  4JI3 E;  4DUY E;  2H36 X;  2IHR 1;  2JWO A;  3HPS A;  4Q28 A;  2UU9 E;  2V86 A;  4BBY A;  2ZM6 E;  1X47 A;  5DNY A;  2RSM A;  2MDR A;  4KHP E;  2L8T A;  2L6M A;  2LTR A;  4GEQ B;  4LF8 E;  2V87 A;  1YYK A;  2NUG A;  2UXC E;  3ADI A;  4OX9 E;  2M7Q A;  4DV6 E;  4LFA E;  2RS7 A;  4LFC E;  3LLH A;  4DMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...