4DKKA

The x-ray crystal structure of the human stau1 ssm-'rbd'5 domain-swapped dimer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
104
Chain Sequence
GSKATVTAIARELLYGGTSPTAETILKNNISGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDAALNILKLLSELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Double-stranded RNA-binding protein Staufen homolog 1
publication title Staufen1 dimerizes through a conserved motif and a degenerate dsRNA-binding domain to promote mRNA decay.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 104
sequence length 112
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dkkA02
3P1XA 2HHHE 3J7Yp 3VYYA 1I94E 4DV1E 2RTXA 3ADIA 4LF6E 4DV6E 2LJHA 1QU6A 1XNQE 1WHQA 2UXCE 4JI5E 4JI1E 1O0WA 3T1HE 4DR1E 2B7TA 2RS6A 4LFCE 1UHZA 2NUFA 4LF8E 2UXBE 4NXNE 4DV3E 1XMOE 4X64E 4DV0E 4AQYE 3ADLA 2N3GA 2LTRA 4GKJE 1HNWE 2UXDE 4DR3E 1X47A 2DIXA 2LUPB 4OX9E 1DI2A 1UILA 2JVAA 4JYAE 3LLHA 2L3CA 4DV4E 4JI2E 4LF4E 1YYOA 2F4VE 4JI8E 4WYQB 1X48A 4DR5E 5BR8E 2L33A 2L3JA 3HTXA 2B7VA 1EKZA 2LUQA 4JV5E 4YHHE 1T4OA 1XNRE 4M2ZA 4KHPE 2UUCE 2NA2A 4JI3E 1YYKA 2JY9A 1T4LB 2NUGA 2L2MA 2VQFE 2LRSA 4M30A 2E5LE 4DR6E 1WHNA 1N34E 1HNXE 2UUAE 4JI6E 4JI0E 4OOGC 4NXME 4DUZE 3ADJA 2RS7A 2B3TB 4X65E 4GKKE 2UU9E 1RC7A 2MDRA 2NUEA 3C4BA 2L2NA 4YY3E 1YYWA 1HR0E 1T4NA 2YT4A 1FKAE 5CFFE 4K0KE 1GQEA 2DMYA 4DUYE 1HNZE 1PKPA 4DV7E 2IHR1 3C4TA 3T1YE 2LTSA 4LF9E 4JI4E 2LBSB 2DB2A 4X62E 2EZ6A 4LFBE 1RQ0A 1XMQE 4DKKA 4B3TE 2ZM6E 1ZBTA 4WFTA 3OTOE 4DR2E 4DV5E 1YZ9A 1N33E 5LMUE 2VQEE 4LF5E 1IBME 4B3ME 4LF7E 1X49A 4DR4E 1N36E 2N3HA 3ADGA 4X8WA 1N32E 4B3RE 4B3SE 5IWAE 2RSMA 2CPNA 2UUBE 1IBLE 4DR7E 4X66E 3VYXA 2KHXA 4LFAE 4DV2E 1FJGE 1IBKE 1J26A 1J5EE 4JI7E 2L2KB 1STUA 5LMNE
chains in the Genus database with same CATH superfamily
1A1GA 2YTDA 2EN8A 2EPOA 2JP9A 4DV1E 2BBGA 2RTXA 5T6JA 4DV6E 1X6FA 4R8OA 1YPNA 1WHQA 2UXCE 1YUIA 4JI5E 3BF2A 1F2IG 4JI1E 2V89A 2EM8A 2JXPA 1UBDC 4R2AA 4F54A 5AASA 2G7HA 3EPLA 2L6MA 2EE8A 4F6NA 4DV3E 1XMOE 4M9VC 3FIGA 1HNWE 2LTRA 2EOYA 2K7IA 2VRDA 5IV8B 3LLHA 2BB8A 2EPUA 2EPRA 2MC5A 4JI2E 2Q8UA 2ODRD 5FLXC 2F4VE 2GPIA 4WYQB 3EPKA 1X48A 4DR5E 4WXDA 2L33A 2R1FA 4JV5E 3C6MA 2EM7A 1WXRA 1T4OA 1AH5A 3K6QA 2UUCE 4KHPE 2NA2A 2EMFA 2VQFE 2I9IA 2DSYA 2E5LE 1WHNA 2KOUA 2EP3A 3DJWA 3KZZA 3HPSA 5A6JA 4DUZE 2FTXB 2B3TB 2EMCA 4X65E 4L8NA 1RC7A 3AV0A 4R2QA 3C4BA 2L2NA 3J81C 2YSOA 2EM3A 2YT4A 5CFFE 4K0KE 1SFEA 2V83A 2WBTA 1X5WA 2V85A 4N4RB 2YWQA 1L4SA 3C4TA 2YRKA 2EPMX 2EMYA 4R03A 2DB2A 4ZYHA 2PRTA 3RMPA 1XMQE 4B3TE 4RH8A 1ZBTA 4DV5E 1YZ9A 2B9DA 4F6MA 4R2CA 1X49A 3BGHA 4RHBB 3ADGA 4HEIA 2DMIA 5AE1A 4HTGA 2CT1A 2EM5A 1IBLE 2ELYA 4O4KA 2EN1A 4TUGA 4WSGA 4R2DA 1TF6A 2VE7C 3P1XA 2E1MA 2EN3A 2GLIA 1YUJA 2EOXA 4LF6E 4MLQA 1QU6A 1XNQE 2RQLA 2MKDA 1DGCA 2JWOA 2DRPA 2EMKA 2ENAA 2LV2A 4DR1E 2B7TA 5ADZA 3BBGA 4LF8E 2EN6A 1EH8A 3THOB 2UXBE 4ZYGA 1G2FC 2YRMA 4AQYE 3ADLA 2JR1A 4GKJE 2UXDE 2EOZA 1P47A 1A1KA 1AAYA 4O5GA 1NEIA 2HC5A 4OX9E 4F9AB 1LLMC 1UILA 2HJJA 4O24A 2EOMA 4DMIA 3MHHC 1G2DC 4BC9A 2K4VA 2EN4A 4BC7A 2YTIA 2EQ3A 3HTXA 2M9AA 1EH7A 3ZOQB 2EL5A 2MC6A 2YU5A 3KWRA 4M2ZA 2RPCA 1KJKA 5AC4A 4JI3E 2JY9A 4M30A 4KZSA 1YSAC 2V86A 4JI0E 5A6KA 4LU9A 1WJPA 3LMLA 2EOEA 2UU9E 2H36X 2NUEA 2LMZA 3AUZA 2YPNA 2YU8A 1FKAE 1IQSA 2EMIA 2EN2A 2YRHA 2LJUA 1PKPA 4KWYA 1A1IA 4P7DA 2LTSA 2EMWA 4LF9E 2HGHA 4JI4E 4LFBE 4DKKA 2I13A 3OTOE 2EPZA 1N33E 3ECRA 2EL4A 1JK2A 3EPJA 2L8TA 2V8QB 4GEQB 2ENCA 1A1FA 4B3RE 4B3SE 1BBOA 5A6AA 5AC5A 1IMUA 2UUBE 2EMHA 5A6BD 4DV2E 3JTZA 1UN6B 1IBKE 3EPHA 3IWBA 4JI7E 4ZYEA 4TUIA 2L2KB 1T38A 5KL6A 2M7QA 3EQ1A 5LMNE 2EOQA 2HHHE 3J7Yp 3VYYA 1EH6A 3UK3C 1I94E 4NHRA 1MGTA 3ADIA 2E72A 2EMXA 1WRJA 2LJHA 2NABA 1SR9A 4BS9A 2KONA 2EOIA 5AE3A 3T1HE 2EL6A 4LFCE 2EJ4A 2NUFA 2EPPA 4NXNE 2J7JA 5A2QC 4BHCA 2EOSA 2VF1A 4X64E 4DV0E 4P78A 2WCC3 2EPLX 4DR3E 3JAMC 2YTPA 2M4IA 2EMGA 2YTFA 2DIXA 4WSPA 4R2RA 2JVAA 4JYAE 2L3CA 4DV4E 4LF4E 2EPXA 2LO3A 3J7AG 5KL3A 1T39A 5F3WA 1DQ3A 5BR8E 1PJSA 3MSWA 2LUQA 2R76A 4YHHE 1XNRE 5AE2A 5LLQA 1IQOA 1A1LA 1T4LB 2NUGA 2LRSA 4WX9A 2YZTA 1GTKA 1HNXE 2N8XA 2ELZA 2DLQA 2ENHA 3J80C 2WBSA 5TSEA 1QNTA 4I8OA 2MDRA 2JOXA 4YY3E 1YYWA 2ADRA 2L92A 1GQEA 4L5NC 4F9CB 4DUYE 4IS1C 5IXMB 3VK6A 3M99B 1Z1BA 3IWDA 4O43A 4X62E 2EZ6A 1JK1A 2M1SA 1ZBQA 2EM4A 2ZM6E 3HPZA 4WFTA 3BIDA 2WZOA 4R2PA 1KYQA 4DR2E 2JPAA 2EOJA 3OMLA 5LMUE 2YTQA 1X6HA 2CTDA 3THNA 2VQEE 1IBME 4LF7E 2EM6A 3IWCA 1TN9A 4DR4E 1N36E 2LCEA 4WPYA 1NCSA 2MDGA 2EQ0A 4X8WA 1N32E 2EN7A 2CSHA 2ODRC 3DF6A 4LTYA 2RSMA 4F2JC 2CPNA 2EMZA 2DGCA 3F6HA 4BHBA 4X66E 4DR7E 4BMJA 2KHXA 4LFAE 2EOHA 2LVHA 2F8BA 1J26A 4IJDA 2YTNA 1STUA 4GZNC 2JOBA 2EORA 3F6GA 3C6KA 4NZVA 3H09A 2EPCA 4WXCA 3JU0A 2EMAA 1O0WA 1RMDA 2RS6A 4X9JA 1UHZA 1B69A 2YSPA 2N3GA 4R2SA 3QG5C 1X47A 2LUPB 1BB8A 4F9BB 1DI2A 2V88A 1A1HA 1PDAA 5A6BA 3HQ1A 1YYOA 4JI8E 2LE2A 5IT9C 2L3JA 2EPNA 2EM9A 2V87A 2B7VA 2EM0A 1YFHA 1EKZA 2EM2A 2EPKX 2EQ1A 5KL5A 2EOOA 1ZAAC 3HXLA 3KZYA 2EPAA 2YTEA 1TF3A 1YYKA 2L2MA 2EOFA 2WBUA 4MLVA 1X6EA 2YTOA 4DR6E 1N34E 2UUAE 4JI6E 3L00A 1A1JA 2YTGA 2JYAA 4OOGC 4NXME 1GZ6A 3ADJA 2RS7A 2FGGA 1PJTA 2GHFA 4Q28A 2EMBA 4GKKE 4R2EA 1HR0E 1T4NA 2D9HA 1MEYC 4ZYDA 2LT7A 2DMYA 4FK5C 5A69A 1HNZE 4DV7E 2MKNA 4Q35B 2IHR1 5LL6R 3T1YE 2A25A 1PJQA 5KL7A 2LBSB 4BBYA 1RQ0A 3VHTB 3MHSC 2YTJA 5KL4A 4LF5E 4BCAA 4B3ME 1BBGA 1ZU1A 2DLKA 2N3HA 3TQMA 2EMLA 1X3CA 5IWAE 5KL2A 2FV4B 3VYXA 4J8ZA 1FJGE 2EWLA 1ZR9A 1J5EE 4M0VA 5DNYA 2RSIA 1N3GA
chains in the Genus database with same CATH topology
3F6GA 3P1XA 2E1MA 2HHHE 3H09A 3J7Yp 3VYYA 1I94E 4DV1E 2RTXA 5T6JA 4LF6E 4DV6E 3ADIA 2LJHA 1QU6A 4R8OA 1XNQE 1SR9A 4BS9A 2KONA 1WHQA 2UXCE 3JU0A 4JI5E 4JI1E 1O0WA 2JWOA 5AE3A 3T1HE 4DR1E 2V89A 2B7TA 2RS6A 5ADZA 4LFCE 1UHZA 4F54A 2NUFA 4LF8E 5AASA 2G7HA 2UXBE 2L6MA 4NXNE 4DV3E 1XMOE 5A2QC 4X64E 2VF1A 4DV0E 4AQYE 3FIGA 3ADLA 2N3GA 2LTRA 2JR1A 4P78A 4GKJE 1HNWE 2UXDE 4DR3E 3JAMC 2M4IA 1X47A 4WSPA 2DIXA 2LUPB 4OX9E 4F9AB 4F9BB 1DI2A 1UILA 2JVAA 4JYAE 3LLHA 2L3CA 4DV4E 2V88A 4DMIA 2MC5A 4JI2E 4LF4E 4BC9A 2K4VA 2ODRD 3HQ1A 1YYOA 2F4VE 4JI8E 4BC7A 4WYQB 3J7AG 2LE2A 5IT9C 1X48A 5F3WA 4DR5E 1DQ3A 5BR8E 2L33A 2L3JA 3HTXA 3MSWA 2V87A 2B7VA 1EKZA 2LUQA 4JV5E 3ZOQB 4YHHE 2MC6A 1WXRA 1T4OA 3KWRA 1XNRE 3HXLA 4M2ZA 5AE2A 3K6QA 2UUCE 4KHPE 2NA2A 4JI3E 1YYKA 2JY9A 1T4LB 2NUGA 2L2MA 2VQFE 2LRSA 2DSYA 2YZTA 4M30A 4KZSA 2E5LE 4DR6E 1WHNA 1N34E 1HNXE 2UUAE 4JI6E 2V86A 2KOUA 4JI0E 3DJWA 4OOGC 3HPSA 4NXME 4DUZE 1GZ6A 3ADJA 2FTXB 2RS7A 4LU9A 3J80C 2FGGA 3LMLA 4Q28A 2B3TB 4X65E 4GKKE 4L8NA 2UU9E 1RC7A 2H36X 3AV0A 4I8OA 2MDRA 2NUEA 3C4BA 2JOXA 2L2NA 2LMZA 4YY3E 3J81C 3AUZA 1T4NA 1HR0E 1YYWA 2YT4A 1FKAE 5CFFE 4K0KE 2L92A 2V83A 1GQEA 2DMYA 4L5NC 4F9CB 2V85A 1PKPA 4DUYE 4DV7E 1HNZE 3VK6A 2IHR1 3C4TA 5LL6R 5LMNE 4P7DA 3T1YE 2LTSA 4LF9E 3IWDA 4R03A 4JI4E 2LBSB 2DB2A 4BBYA 4X62E 2EZ6A 4LFBE 1RQ0A 3RMPA 1XMQE 2M1SA 4DKKA 1ZBQA 4B3TE 2ZM6E 1ZBTA 3HPZA 4WFTA 2WZOA 3OTOE 4DR2E 4DV5E 1YZ9A 2B9DA 1N33E 3OMLA 5LMUE 2VQEE 4LF5E 4BCAA 1IBME 4B3ME 4LF7E 1X49A 2L8TA 2V8QB 3IWCA 4GEQB 4DR4E 1N36E 4WPYA 2N3HA 3ADGA 4X8WA 1N32E 5AE1A 4B3RE 2ODRC 3DF6A 4LTYA 4B3SE 5IWAE 2RSMA 2CPNA 2UUBE 1IBLE 3F6HA 4DR7E 4X66E 2FV4B 4BMJA 2KHXA 3VYXA 4J8ZA 4LFAE 4DV2E 3JTZA 2F8BA 1FJGE 2EWLA 1IBKE 1J26A 1J5EE 4M0VA 3IWBA 4JI7E 4TUGA 4TUIA 2L2KB 5DNYA 2M7QA 1STUA 5FLXC 2JOBA 2VE7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1X A;  2HHH E;  3J7Y p;  3VYY A;  1I94 E;  4DV1 E;  2RTX A;  3ADI A;  4LF6 E;  4DV6 E;  2LJH A;  1QU6 A;  1XNQ E;  1WHQ A;  2UXC E;  4JI5 E;  4JI1 E;  1O0W A;  3T1H E;  4DR1 E;  2B7T A;  2RS6 A;  4LFC E;  1UHZ A;  2NUF A;  4LF8 E;  2UXB E;  4NXN E;  4DV3 E;  1XMO E;  4X64 E;  4DV0 E;  4AQY E;  3ADL A;  2N3G A;  2LTR A;  4GKJ E;  1HNW E;  2UXD E;  4DR3 E;  1X47 A;  2DIX A;  2LUP B;  4OX9 E;  1DI2 A;  1UIL A;  2JVA A;  4JYA E;  3LLH A;  2L3C A;  4DV4 E;  4JI2 E;  4LF4 E;  1YYO A;  2F4V E;  4JI8 E;  4WYQ B;  1X48 A;  4DR5 E;  5BR8 E;  2L33 A;  2L3J A;  3HTX A;  2B7V A;  1EKZ A;  2LUQ A;  4JV5 E;  4YHH E;  1T4O A;  1XNR E;  4M2Z A;  4KHP E;  2UUC E;  2NA2 A;  4JI3 E;  1YYK A;  2JY9 A;  1T4L B;  2NUG A;  2L2M A;  2VQF E;  2LRS A;  4M30 A;  2E5L E;  4DR6 E;  1WHN A;  1N34 E;  1HNX E;  2UUA E;  4JI6 E;  4JI0 E;  4OOG C;  4NXM E;  4DUZ E;  3ADJ A;  2RS7 A;  2B3T B;  4X65 E;  4GKK E;  2UU9 E;  1RC7 A;  2MDR A;  2NUE A;  3C4B A;  2L2N A;  4YY3 E;  1YYW A;  1HR0 E;  1T4N A;  2YT4 A;  1FKA E;  5CFF E;  4K0K E;  1GQE A;  2DMY A;  4DUY E;  1HNZ E;  1PKP A;  4DV7 E;  2IHR 1;  3C4T A;  3T1Y E;  2LTS A;  4LF9 E;  4JI4 E;  2LBS B;  2DB2 A;  4X62 E;  2EZ6 A;  4LFB E;  1RQ0 A;  1XMQ E;  4DKK A;  4B3T E;  2ZM6 E;  1ZBT A;  4WFT A;  3OTO E;  4DR2 E;  4DV5 E;  1YZ9 A;  1N33 E;  5LMU E;  2VQE E;  4LF5 E;  1IBM E;  4B3M E;  4LF7 E;  1X49 A;  4DR4 E;  1N36 E;  2N3H A;  3ADG A;  4X8W A;  1N32 E;  4B3R E;  4B3S E;  5IWA E;  2RSM A;  2CPN A;  2UUB E;  1IBL E;  4DR7 E;  4X66 E;  3VYX A;  2KHX A;  4LFA E;  4DV2 E;  1FJG E;  1IBK E;  1J26 A;  1J5E E;  4JI7 E;  2L2K B;  1STU A;  5LMN E; 
#chains in the Genus database with same CATH topology
 1A1G A;  2YTD A;  2EN8 A;  2EPO A;  2JP9 A;  4DV1 E;  2BBG A;  2RTX A;  5T6J A;  4DV6 E;  1X6F A;  4R8O A;  1YPN A;  1WHQ A;  2UXC E;  1YUI A;  4JI5 E;  3BF2 A;  1F2I G;  4JI1 E;  2V89 A;  2EM8 A;  2JXP A;  1UBD C;  4R2A A;  4F54 A;  5AAS A;  2G7H A;  3EPL A;  2L6M A;  2EE8 A;  4F6N A;  4DV3 E;  1XMO E;  4M9V C;  3FIG A;  1HNW E;  2LTR A;  2EOY A;  2K7I A;  2VRD A;  5IV8 B;  3LLH A;  2BB8 A;  2EPU A;  2EPR A;  2MC5 A;  4JI2 E;  2Q8U A;  2ODR D;  5FLX C;  2F4V E;  2GPI A;  4WYQ B;  3EPK A;  1X48 A;  4DR5 E;  4WXD A;  2L33 A;  2R1F A;  4JV5 E;  3C6M A;  2EM7 A;  1WXR A;  1T4O A;  1AH5 A;  3K6Q A;  2UUC E;  4KHP E;  2NA2 A;  2EMF A;  2VQF E;  2I9I A;  2DSY A;  2E5L E;  1WHN A;  2KOU A;  2EP3 A;  3DJW A;  3KZZ A;  3HPS A;  5A6J A;  4DUZ E;  2FTX B;  2B3T B;  2EMC A;  4X65 E;  4L8N A;  1RC7 A;  3AV0 A;  4R2Q A;  3C4B A;  2L2N A;  3J81 C;  2YSO A;  2EM3 A;  2YT4 A;  5CFF E;  4K0K E;  1SFE A;  2V83 A;  2WBT A;  1X5W A;  2V85 A;  4N4R B;  2YWQ A;  1L4S A;  3C4T A;  2YRK A;  2EPM X;  2EMY A;  4R03 A;  2DB2 A;  4ZYH A;  2PRT A;  3RMP A;  1XMQ E;  4B3T E;  4RH8 A;  1ZBT A;  4DV5 E;  1YZ9 A;  2B9D A;  4F6M A;  4R2C A;  1X49 A;  3BGH A;  4RHB B;  3ADG A;  4HEI A;  2DMI A;  5AE1 A;  4HTG A;  2CT1 A;  2EM5 A;  1IBL E;  2ELY A;  4O4K A;  2EN1 A;  4TUG A;  4WSG A;  4R2D A;  1TF6 A;  2VE7 C;  3P1X A;  2E1M A;  2EN3 A;  2GLI A;  1YUJ A;  2EOX A;  4LF6 E;  4MLQ A;  1QU6 A;  1XNQ E;  2RQL A;  2MKD A;  1DGC A;  2JWO A;  2DRP A;  2EMK A;  2ENA A;  2LV2 A;  4DR1 E;  2B7T A;  5ADZ A;  3BBG A;  4LF8 E;  2EN6 A;  1EH8 A;  3THO B;  2UXB E;  4ZYG A;  1G2F C;  2YRM A;  4AQY E;  3ADL A;  2JR1 A;  4GKJ E;  2UXD E;  2EOZ A;  1P47 A;  1A1K A;  1AAY A;  4O5G A;  1NEI A;  2HC5 A;  4OX9 E;  4F9A B;  1LLM C;  1UIL A;  2HJJ A;  4O24 A;  2EOM A;  4DMI A;  3MHH C;  1G2D C;  4BC9 A;  2K4V A;  2EN4 A;  4BC7 A;  2YTI A;  2EQ3 A;  3HTX A;  2M9A A;  1EH7 A;  3ZOQ B;  2EL5 A;  2MC6 A;  2YU5 A;  3KWR A;  4M2Z A;  2RPC A;  1KJK A;  5AC4 A;  4JI3 E;  2JY9 A;  4M30 A;  4KZS A;  1YSA C;  2V86 A;  4JI0 E;  5A6K A;  4LU9 A;  1WJP A;  3LML A;  2EOE A;  2UU9 E;  2H36 X;  2NUE A;  2LMZ A;  3AUZ A;  2YPN A;  2YU8 A;  1FKA E;  1IQS A;  2EMI A;  2EN2 A;  2YRH A;  2LJU A;  1PKP A;  4KWY A;  1A1I A;  4P7D A;  2LTS A;  2EMW A;  4LF9 E;  2HGH A;  4JI4 E;  4LFB E;  4DKK A;  2I13 A;  3OTO E;  2EPZ A;  1N33 E;  3ECR A;  2EL4 A;  1JK2 A;  3EPJ A;  2L8T A;  2V8Q B;  4GEQ B;  2ENC A;  1A1F A;  4B3R E;  4B3S E;  1BBO A;  5A6A A;  5AC5 A;  1IMU A;  2UUB E;  2EMH A;  5A6B D;  4DV2 E;  3JTZ A;  1UN6 B;  1IBK E;  3EPH A;  3IWB A;  4JI7 E;  4ZYE A;  4TUI A;  2L2K B;  1T38 A;  5KL6 A;  2M7Q A;  3EQ1 A;  5LMN E;  2EOQ A;  2HHH E;  3J7Y p;  3VYY A;  1EH6 A;  3UK3 C;  1I94 E;  4NHR A;  1MGT A;  3ADI A;  2E72 A;  2EMX A;  1WRJ A;  2LJH A;  2NAB A;  1SR9 A;  4BS9 A;  2KON A;  2EOI A;  5AE3 A;  3T1H E;  2EL6 A;  4LFC E;  2EJ4 A;  2NUF A;  2EPP A;  4NXN E;  2J7J A;  5A2Q C;  4BHC A;  2EOS A;  2VF1 A;  4X64 E;  4DV0 E;  4P78 A;  2WCC 3;  2EPL X;  4DR3 E;  3JAM C;  2YTP A;  2M4I A;  2EMG A;  2YTF A;  2DIX A;  4WSP A;  4R2R A;  2JVA A;  4JYA E;  2L3C A;  4DV4 E;  4LF4 E;  2EPX A;  2LO3 A;  3J7A G;  5KL3 A;  1T39 A;  5F3W A;  1DQ3 A;  5BR8 E;  1PJS A;  3MSW A;  2LUQ A;  2R76 A;  4YHH E;  1XNR E;  5AE2 A;  5LLQ A;  1IQO A;  1A1L A;  1T4L B;  2NUG A;  2LRS A;  4WX9 A;  2YZT A;  1GTK A;  1HNX E;  2N8X A;  2ELZ A;  2DLQ A;  2ENH A;  3J80 C;  2WBS A;  5TSE A;  1QNT A;  4I8O A;  2MDR A;  2JOX A;  4YY3 E;  1YYW A;  2ADR A;  2L92 A;  1GQE A;  4L5N C;  4F9C B;  4DUY E;  4IS1 C;  5IXM B;  3VK6 A;  3M99 B;  1Z1B A;  3IWD A;  4O43 A;  4X62 E;  2EZ6 A;  1JK1 A;  2M1S A;  1ZBQ A;  2EM4 A;  2ZM6 E;  3HPZ A;  4WFT A;  3BID A;  2WZO A;  4R2P A;  1KYQ A;  4DR2 E;  2JPA A;  2EOJ A;  3OML A;  5LMU E;  2YTQ A;  1X6H A;  2CTD A;  3THN A;  2VQE E;  1IBM E;  4LF7 E;  2EM6 A;  3IWC A;  1TN9 A;  4DR4 E;  1N36 E;  2LCE A;  4WPY A;  1NCS A;  2MDG A;  2EQ0 A;  4X8W A;  1N32 E;  2EN7 A;  2CSH A;  2ODR C;  3DF6 A;  4LTY A;  2RSM A;  4F2J C;  2CPN A;  2EMZ A;  2DGC A;  3F6H A;  4BHB A;  4X66 E;  4DR7 E;  4BMJ A;  2KHX A;  4LFA E;  2EOH A;  2LVH A;  2F8B A;  1J26 A;  4IJD A;  2YTN A;  1STU A;  4GZN C;  2JOB A;  2EOR A;  3F6G A;  3C6K A;  4NZV A;  3H09 A;  2EPC A;  4WXC A;  3JU0 A;  2EMA A;  1O0W A;  1RMD A;  2RS6 A;  4X9J A;  1UHZ A;  1B69 A;  2YSP A;  2N3G A;  4R2S A;  3QG5 C;  1X47 A;  2LUP B;  1BB8 A;  4F9B B;  1DI2 A;  2V88 A;  1A1H A;  1PDA A;  5A6B A;  3HQ1 A;  1YYO A;  4JI8 E;  2LE2 A;  5IT9 C;  2L3J A;  2EPN A;  2EM9 A;  2V87 A;  2B7V A;  2EM0 A;  1YFH A;  1EKZ A;  2EM2 A;  2EPK X;  2EQ1 A;  5KL5 A;  2EOO A;  1ZAA C;  3HXL A;  3KZY A;  2EPA A;  2YTE A;  1TF3 A;  1YYK A;  2L2M A;  2EOF A;  2WBU A;  4MLV A;  1X6E A;  2YTO A;  4DR6 E;  1N34 E;  2UUA E;  4JI6 E;  3L00 A;  1A1J A;  2YTG A;  2JYA A;  4OOG C;  4NXM E;  1GZ6 A;  3ADJ A;  2RS7 A;  2FGG A;  1PJT A;  2GHF A;  4Q28 A;  2EMB A;  4GKK E;  4R2E A;  1HR0 E;  1T4N A;  2D9H A;  1MEY C;  4ZYD A;  2LT7 A;  2DMY A;  4FK5 C;  5A69 A;  1HNZ E;  4DV7 E;  2MKN A;  4Q35 B;  2IHR 1;  5LL6 R;  3T1Y E;  2A25 A;  1PJQ A;  5KL7 A;  2LBS B;  4BBY A;  1RQ0 A;  3VHT B;  3MHS C;  2YTJ A;  5KL4 A;  4LF5 E;  4BCA A;  4B3M E;  1BBG A;  1ZU1 A;  2DLK A;  2N3H A;  3TQM A;  2EML A;  1X3C A;  5IWA E;  5KL2 A;  2FV4 B;  3VYX A;  4J8Z A;  1FJG E;  2EWL A;  1ZR9 A;  1J5E E;  4M0V A;  5DNY A;  2RSI A;  1N3G A; 
#chains in the Genus database with same CATH homology
 3F6G A;  3P1X A;  2E1M A;  2HHH E;  3H09 A;  3J7Y p;  3VYY A;  1I94 E;  4DV1 E;  2RTX A;  5T6J A;  4LF6 E;  4DV6 E;  3ADI A;  2LJH A;  1QU6 A;  4R8O A;  1XNQ E;  1SR9 A;  4BS9 A;  2KON A;  1WHQ A;  2UXC E;  3JU0 A;  4JI5 E;  4JI1 E;  1O0W A;  2JWO A;  5AE3 A;  3T1H E;  4DR1 E;  2V89 A;  2B7T A;  2RS6 A;  5ADZ A;  4LFC E;  1UHZ A;  4F54 A;  2NUF A;  4LF8 E;  5AAS A;  2G7H A;  2UXB E;  2L6M A;  4NXN E;  4DV3 E;  1XMO E;  5A2Q C;  4X64 E;  2VF1 A;  4DV0 E;  4AQY E;  3FIG A;  3ADL A;  2N3G A;  2LTR A;  2JR1 A;  4P78 A;  4GKJ E;  1HNW E;  2UXD E;  4DR3 E;  3JAM C;  2M4I A;  1X47 A;  4WSP A;  2DIX A;  2LUP B;  4OX9 E;  4F9A B;  4F9B B;  1DI2 A;  1UIL A;  2JVA A;  4JYA E;  3LLH A;  2L3C A;  4DV4 E;  2V88 A;  4DMI A;  2MC5 A;  4JI2 E;  4LF4 E;  4BC9 A;  2K4V A;  2ODR D;  3HQ1 A;  1YYO A;  2F4V E;  4JI8 E;  4BC7 A;  4WYQ B;  3J7A G;  2LE2 A;  5IT9 C;  1X48 A;  5F3W A;  4DR5 E;  1DQ3 A;  5BR8 E;  2L33 A;  2L3J A;  3HTX A;  3MSW A;  2V87 A;  2B7V A;  1EKZ A;  2LUQ A;  4JV5 E;  3ZOQ B;  4YHH E;  2MC6 A;  1WXR A;  1T4O A;  3KWR A;  1XNR E;  3HXL A;  4M2Z A;  5AE2 A;  3K6Q A;  2UUC E;  4KHP E;  2NA2 A;  4JI3 E;  1YYK A;  2JY9 A;  1T4L B;  2NUG A;  2L2M A;  2VQF E;  2LRS A;  2DSY A;  2YZT A;  4M30 A;  4KZS A;  2E5L E;  4DR6 E;  1WHN A;  1N34 E;  1HNX E;  2UUA E;  4JI6 E;  2V86 A;  2KOU A;  4JI0 E;  3DJW A;  4OOG C;  3HPS A;  4NXM E;  4DUZ E;  1GZ6 A;  3ADJ A;  2FTX B;  2RS7 A;  4LU9 A;  3J80 C;  2FGG A;  3LML A;  4Q28 A;  2B3T B;  4X65 E;  4GKK E;  4L8N A;  2UU9 E;  1RC7 A;  2H36 X;  3AV0 A;  4I8O A;  2MDR A;  2NUE A;  3C4B A;  2JOX A;  2L2N A;  2LMZ A;  4YY3 E;  3J81 C;  3AUZ A;  1T4N A;  1HR0 E;  1YYW A;  2YT4 A;  1FKA E;  5CFF E;  4K0K E;  2L92 A;  2V83 A;  1GQE A;  2DMY A;  4L5N C;  4F9C B;  2V85 A;  1PKP A;  4DUY E;  4DV7 E;  1HNZ E;  3VK6 A;  2IHR 1;  3C4T A;  5LL6 R;  5LMN E;  4P7D A;  3T1Y E;  2LTS A;  4LF9 E;  3IWD A;  4R03 A;  4JI4 E;  2LBS B;  2DB2 A;  4BBY A;  4X62 E;  2EZ6 A;  4LFB E;  1RQ0 A;  3RMP A;  1XMQ E;  2M1S A;  4DKK A;  1ZBQ A;  4B3T E;  2ZM6 E;  1ZBT A;  3HPZ A;  4WFT A;  2WZO A;  3OTO E;  4DR2 E;  4DV5 E;  1YZ9 A;  2B9D A;  1N33 E;  3OML A;  5LMU E;  2VQE E;  4LF5 E;  4BCA A;  1IBM E;  4B3M E;  4LF7 E;  1X49 A;  2L8T A;  2V8Q B;  3IWC A;  4GEQ B;  4DR4 E;  1N36 E;  4WPY A;  2N3H A;  3ADG A;  4X8W A;  1N32 E;  5AE1 A;  4B3R E;  2ODR C;  3DF6 A;  4LTY A;  4B3S E;  5IWA E;  2RSM A;  2CPN A;  2UUB E;  1IBL E;  3F6H A;  4DR7 E;  4X66 E;  2FV4 B;  4BMJ A;  2KHX A;  3VYX A;  4J8Z A;  4LFA E;  4DV2 E;  3JTZ A;  2F8B A;  1FJG E;  2EWL A;  1IBK E;  1J26 A;  1J5E E;  4M0V A;  3IWB A;  4JI7 E;  4TUG A;  4TUI A;  2L2K B;  5DNY A;  2M7Q A;  1STU A;  5FLX C;  2JOB A;  2VE7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...